A Oil 012 - Molecular Biology and Evolution

More documents

Recommendations

Info

ND4 Hum Chi Gor Ora Gib Jam Rhm Crm Barn Sqm Tar Lem Molecular Phylogeny and Evolution of Primate mtDNA 63 1 60 SFTGAVILMIAHGLTSSLLFCLANSNYERTHSRIMILSQGLQTLLPLMAFWWLLASLANL I TVT :: T TV R A S T MY NTL R ! T S T MY NTL R : T T T S TT MY NTLR I T T ST V MY I T F; T F M I T OFT", F GL N I !T T V T A AR AT T MT M I TLARI I T T 120 Hum ALPPTINLLGELSVLVTTFSWSNITLLLTGLNMLVTALYSLYMFTTTQWGSLTHHINNMK Chi S F I Gor T S P T Ora MAM I :T R TP Gib F HAS A T IT VI IM RT K Jam F IA S H IM I H RT MI Rhm F IA S HIM F I H RA MI Crm F IT S H IV I H IVRT MI Barn F IA S H IM I H RA MT Sqm A V LTI SS F IMF H YAS R i Y&s Tar I MMAA HLIIV T: LIM R KY Y IM Lem s I F TMAS II M I L R K Y SH LN 152 Hum PSFTRENTLMFMHLSPILLLSLNPDIITGFSS Chi L T Gor I T Ora L S A AY Gib L M L FL T N TP Jam P A I N L T Rhm P M A I N L T Crm P M A I N L T Barn P ML AI N L T Sam M MT TSKVMPP Tar P I F LI T KL M TMY Lem S MLL FT K L PTY ND 5 60 Hum MTMHTTMTTLTLTSLIPPILTTLVNPNKKNSYPHWKSIVASTFIISLFPTTMFMCLDQE Chi Y P L I Gor YA A F: S L Ora TA F A TA I P TAI AT I I G Gib A Y AI TA I L MT1 M M T Jam I PIIMT I TL FA I Y RP D TT MYA PS L IFSN Rhm I PIMMT I TL FA I Y RP D TT MYA PS L IFSN Crm I PIMMT I TL FA T Y R D TT MYA T PS L ILSN Barn I Y PIMMT I TL FA I HL N TAMYA T SS LYFN Sqm - FSI LM I LA A I STL Y LAIIYAL T TLSMMF ILTG Tar NLFSSSIL S L T FII TTKKYETHA Y NSI CA MT V ML LYTN Lem NLLSSF LV II TL IMNVT MY NYP AP SI CA T I ML ISSG 79 Hum VIISNWHWATTQTThLSLS Chi A Gor A S I Ora T VT C T L Gib T TA LE Jam TT WS MM LD T Rhm TT WS LD T Crm TT WS M LD T Barn T WS MM LS T Sqm SM MI IK Tar M M IH MK C Lem T MI LK I FIG. 2.-Amino acid sequences for the carboxy-terminal region of ND4 and amino-terminal region of NDS, corresponding to nucleotides 2-457 and 660-896 (fig. I), respectively, from the 12 species deduced from the nucleotide sequences. Amino acids are translated according to the genetic code table of Anderson et al. (198 1) and represented by single letters. Abbreviations for the species are the same as those in fig. 1. The whole amino acid sequence for the human is shown on the top. For the other species, only amino acids different from those in the human sequence are shown. A gap is denoted by a dash (-). In the ND5 gene of squirrel monkey, three bases corresponding to one amino acid have been deleted (figs. 1, 2). The deletion occurred at the second codon of the gene. The 5’-terminal regions of the ND5 gene in starfish (Himeno et al. 1987) and sea urchin ( Cantatore et al. 1987 ) are -70 bases longer and the same region of Dro-
Table 2 Percent Similarity of Amino Acid Sequences of ND4 (above the Diagonal) and ND5 (below the Diagonal) between Species SPECIES COMPARED Human . . . . . . Chimpanzee . . Gorilla . . . . . . . Orangutan . . . . . . . Gibbon . . Japanese macaque . . . . . . . . Rhesus macaque Crab-eating macaque . . Barbary macaque . . . Squirrel monkey . . . . Tarsier . . . . . . Lemur . . . . . . . . . SPECIES COMPARED Japanese Rhesus Crab-eating Barbary Squirrel Human Chimpanzee Gorilla Orangutan Gibbon Macaque Macaque Macaque Macaque Monkey Tarsier Lemur 92.4 87.3 72.2 75.9 95.4 94.1 88.2 94.1 86.8 87.3 86.8 72.2 67.1 77.2 70.9 75.9 80.9 82.2 82.2 82.9 53.2 51.9 50.6 55.7 54.4 53.2 51.9 50.6 55.7 54.4 79.6 78.3 77.0 78.3 70.4 70.4 72.4 79.6 79.6 77.0 78.3 69.7 69.7 72.4 77.6 77.6 76.3 77.0 69.7 69.1 71.1 78.9 77.0 77.6 78.3 68.4 75.7 75.7 77.6 77.0 78.3 78.3 67.8 72.4 73.7 98.7 54.4 51.9 50.6 53.2 51.9 92.4 93.7 54.4 55.7 53.2 55.7 57.0 82.3 83.5 50.6 50.6 48.1 50.6 51.9 53.2 53.2 43.0 44.3 43.0 41.8 45.6 36.7 35.4 46.8 49.4 44.3 49.4 46.8 50.6 50.6 guest on December 5, 2012 98.0 96.1 95.4 69.7 71.1 75.0 95.4 96.1 68.4 69.7 73.7 81.0 55.7 39.2 53.2 92.8 67.1 67.1 54.4 36.7 45.6 46.8 53.2 71.1 72.4 69.1 73.0 64.5 71.1 76.3 54.4
Page 1 and 2: Molecular Phylogeny and Evolution o
Page 3 and 4: 628 Hayasaka et al. On the basis of
Page 5: Table 1 Percent Similarity of Nucle
Page 9 and 10: Table 3 Synonymous and Nonsynonymou
Page 11 and 12: 636 Hayasaka et al. A Oil 012 No. o
Page 13 and 14: 638 Hayasaka et al. G b d e 10 20 3
Page 15 and 16: 640 Hayasaka et al. and hominoid li
Page 17 and 18: 642 Hayasaka et al. genus Macaca. P
Page 19: 644 Hayasaka et al. WILSON, A. C.,

A Oil 012 - Molecular Biology and Evolution

Create successful ePaper yourself

Delete template?

Save as template?