Zbornik sa održanih epizootioloških dana 2013. - pdf 4,11 MB.

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕFaculty of veterinary medicine Belgrade, University of BelgradeDepartment for infectious diseases of animals and bee diseases FVMSection of zoonozes Serbian Veterinary AssociationVeterinary Institute``Niš` NišAssociation of epizootiologists and epidemiologists of SerbiaTHIRD INTERNATIONALEPIZOOTIOLOGY DAYS&XV SERBIAN EPIZOOTIOLOGY DAYSPROCEEDINGSHotel Radon , Niška spa8.-11. May 2013.1

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYSFaculty of veterinary medicine Belgrade, University of BelgradeDepartment for infectious diseases of animals and bee diseases FVMSection of zoonozes Serbian Veterinary AssociationVeterinary Institute``Niš` NišAssociation of epizootiologists and epidemiologists of SerbiaTHIRD INTERNATIONALEPIZOOTIOLOGY DAYS&XV SERBIAN EPIZOOTIOLOGY DAYSPROCEEDINGSNiska banja, Serbia, hotel ~RADON~, May 8.-11 st , 2013.2ISBN: 978-86-81043-68-4

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕPublisher / ИздавачFaculty of veterinary medicine Belgrade, University of BelgradeDepartment for infectious diseases of animals and bee diseases FVMFor the publisher / За издавачаProf. dr Vlado TeodorovićEditor in Chief / Главни и одговорни уредникdr Tamaš Petrović, viši naučni saradnikReview / РецензијаDr Tadej Malovrh, Institute of Microbiology and Parasitology, VeterinaryFaculty, University of Ljubljana, SloveniaProf dr Almedina Zuko, Veterinary faculty Sarajevo, Zmaja od Bosne 90,Sarajevo, Bosnia and HerzegovinaTehnical Editor / Технички уредникProf dr Bosiljka ĐuričićPrint /ШтампаНаучна КМДТираж 200 примерака3

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYSOrganizer / ОрганизаторКатедра за заразне болести животиња и болести пчела ФВМ, БеоградСекција за зоонозе СВДВСИ ``Ниш``НишУдружење епизоотиолога и епидемиолога СрбијеSponsor / Покровитељ:Министарство за пољопривреду, шумарство и водопривреду Р.Србије - Управа за ветеринуSponsor / Спонзор VETERINARSKI ZAVOD SUBOTICA a.d.Članica VICTORIA GROUPDonator EKOSANСуорганизатори:Регионални одбори ВКС за Нишки, Пиротски, Пчињски, Јабланички и Топлички округOrganizational CommitteeПредседник/President: Проф. др Босиљка ЂуричићПотпредседник/Vice president: Др сц Милош ПетровићПроф др сц Новица СтајковићСекретари/ Secretaryes: др вет. мед. Ана Самоковлијадр вет.мед. Марија МанићСекретаријат/Secretariate: Анђелковић Радивојe, Бабић Милорад, Видић Бранка, Валчић Мирослав,Вељковић Предраг, Влаховић Мира, Вукелић Оливера, Гргић Бојана, Дакић Зорица, Дачић Мирољуб,Дебељак Зоран, Ђорђевић Игор, Ђуковић Вера, Живојиновић Милена, Живуљ Александар, ЗукоАлмедина, Илић Хранислав, Игњатовић Радисав, Јакић Димић Добрила, Јанку Ђорђе, ЈовановићВеселин, Јовановић Ненад, Катић -Радивојевић Софија, Лако Бранислав, Лаушевић Дејан, ЉубићБожидар, Максимовић Слободан, Марић Јелена, Марковић Драгутин, Маринковић Зоран, МарушићПредраг, Масловарић Предраг, Медић Снежана, Милковић Миодраг, Митровић Новалина, МолнарТибор, Недић Драго, Нешковић Милијана, Новаковић Зорица, Парлић Милан, Плавша Нада,Раденковић Дамњановић Брана, Радојичић Драгана,Раичевић Зоран,Рељић Мирјана, РогожарскиДраган, Самарџић Света, Сантрач Виолета, Сарић Милорад, Станков Срђан, Стокић-НиколићСлавонка, Стошић Оливер, Теодоровић Владо,Тиодоровић Бранислав, Томић Александар,УзелацСилва, Чеканац Радован, Шегуљев ЗорицаScientific Committee/Nauĉni odbor: Тамаш Петровић (председник), Никола Кнежевић, СтајковићНовица, Глигић Ана, Босиљка Ђуричић, Иван Павловић, Радивојевић Снежана, Величковић Зоран,Миланко ШеклерHonoryfic Committee./Poĉasni odbor: Белев Никола, Бобош Станко, Tomašiĉ Armin, Кранчић- ЗецИвана, Pugliese Antonio, Павловић Радован, Стојковић МиодрагInternational Scientific Committee: Norbert Nowotny (Austria), Nedelcho Nedelchev, Georgi Georgiev, IliaTsachev, (Bulgaria), Carlo Valente, Vincenzo Cuteri (Italy), Davor Ojkić (Canada), Drago Nedić, AlmedinaZuko (Bosnia and Herzegovina),Tadej Malovrh, Peter Hostnik (Slovenia), Vladimir Zlobin, Nikolaj Rudakov(Russia), Dejan Laušević (Montenegro), Jovan Bošnjakovski, Dine Mitrov (Macedonia), Ţeljko Cvetnić,Vladimir Savić (Croatia), Doina Danes, Marina Spidou (Romania), Evanthia Petridou, Spiridon Kritas,Katerina Loukaki (Greece) Juan Carlos Saiz (Spain)4

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕPROGRAMME - ПРОГРАМWednesday, Среда, 8. мај 2013.- Registration of participants -Регистрација учесника19 00 Opening ceremony -hotel ―RADON‖- Свечано отварање – хотел ''РАДОН''Welcome Address / Поздравна реч:1. President of the Organizing Committee2. Chief Veterinary Officer, Veterinary Directorate, Ministry of agriculture,trade, forestry and water management, Serbia3. Dean of Faculty of Veterinary medicine, University of Belgrade19 30 Заразне болести и национални брендови (Infectious diseases and nationalbrends) –1. Ветеринарско санитарни услови у производњи традиционалних сирева(The veterinary-sanitary requirements in cheese production) Зора Мијачевић,Снежана Булајић2. Актуелне заразне болести код нас и у свету (Current infectious diseases inSerbia and in the world) Босиљка Ђуричић, Љубић Б.20 00 Cocktail /КоктелThursday/Четвртак, 9. мај 2013.9 00 -12 00 I секција ИНФЕКЦИЈЕ ВЕКТОРСКОГ КАРАКТЕРА / VECTORBORN INFECTIONSмодератори Др Н. Стајковић, Мр Снежана Радовојевић и Др Т. Петровић9 00 -9 20 Епидемиолошке и епизоотиолошке карактеристике анаплазмозе натериторији Русије (Epidemiological and epizootiological features anaplasmoses inregions of Russia) Krasikov A.P., N.V. Rudakov9 20 -9 40 Изолација и пропагација Anaplasma phagocytophilum код пацијената сагранулоцитном анаплзмозом људи (Isolation and propagation of Anaplasmaphagocytophilum from patient with human granulocytic anaplasmosis) M. Petrovec, T.Malovrh, F. Strle, S. Lotrič-Furlan, T. Avšič-Ţupanc9 40 -10 00 Q грозница: епидемиолошки и епизоотиолошки аспекти (Q fever:epidemiological and epizootiological aspects) Rudakov N.V., Krasikov A.P.10 00 -10 20 Анализа појаве и епизотиолоошка ситуација Q-грознице од 1999-2012 уРепублици Српској (Analysis of the appearance and epizootiologiacal situation Q-fever in the Republic of Srpska from 1999 to 2012) Novalina Mitrović, T. Marković, M.Zelenović, B. Ivanić,5

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYS10 20 -10 40 Прва детекција шмаленберг вируса у Словенији (First detection ofschmallenberg virus in Slovenia) Toplak I, Cociancich V, Rihtarič D, Tomislav P.10 40 -11 00 Кримска-конго хеморагична грозница-екологија вируса (Crimean Congohemorrhagic fever - ecology of virus) Шеклер М.11 00 -11 20 Процена ризика од вектора лајмске болести у 2011. години на територијиБеограда (Risk assessment of vector lyme disease in 2011. in Belgrade) Stajković N.,Krstić Milena11 20 Дискусија17 00 -19 30 Секција II ГРОЗНИЦА ЗАПАДНОГ НИЛА У СРБИЈИ – округли сто(WEST NILE FEVER IN SERBIA – round table)модератор: Проф.др Олга Дуловић, дрАна Глигић, др М. Шеклер17 00 -17 20 Прво појављивање грознице Западног Нила код људи у Србији одавгуста до октобра 2012. године (First outbreak of West Nile virus infection amonghumans in Serbia, august to october 2012) Наташа Поповић, Б. Милошевић, А.Урошевић, Олга Дуловић17 20 -17 40 Грозница Западног Нила први пут откривена код људи на подручјуБеограда (West Nile fever first time in humans in Belgrade ) Радивојевић Снежана,Марис С. Љубић Б, Обреновић Ј.17 40 -18 00 Серолошко испитивање дивљих птица на присуство вируса ЗападногНила на територији Србије (Serologic survey of wild birds in Serbia for the presenceof West Nile virus (WNV) infection) Petrović T., Blázquez Ana-Belén, LupulovićDiana, Lazić Gospava, Fabijan D., Kapetanov M., Escribano-Romero Estela, Lazić S.,Saiz Juan-C.18 00 -18 15 Компаративна анализа вредности дијагностичких метода улабораторијској дијагностици вируса грознице Западног Нила (Comparativeanalysis of diagnostic methods in laboratory diagnosis of West Nile fever virus) АнаСамоковлија, Олга Дуловић, Наташа Поповић, Б. Милошевић, Марија Манић, Т.Петровић, Ана Глигић, Босиљка Ђуричић18 15 -18 30 Вектори West Nile вируса у Србији (Vectors West Nile virus in Serbia)Стајковић Н, Ђорђевић М, Пешић Б, Видановић Д, Шеклер М18 30 Дискусија6

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕFriday/Петак, 10. мај 2013.9 00 -13 00 Секција III ЗАРАЗНЕ БОЛЕСТИ БАКТЕРИЈСКЕ И ВИРУСНЕЕТИОЛОГИЈЕ - INFECTIOUS DISEASES OF BACTERIAL AND VIRALORIGINEМодератори: др Босиљка Ђуричић, др Бранка Видић, др N.V Rudakov9 00- 9 15 Резултати испитивања инфекције животиња микоплазмама у Сибиру(Mycoplasma infection in animals and the results of heir study in Siberia) KrasikovA.P., Rudakov N.V.9 15 -9 25 Лептоспироза свиња (Leptospirosis in pigs) Дошен Р., Проданов- РадуловићЈасна, Пушић И., Гргић Ж., Петровић Т.9 25 -9 35 Резултати испитивања заступљености Leptospira spp. са посебним освртомна L. bratislava у популацији уличних паса у поједним регионима РепубликеСрбије (Results of representation Leptospira spp. with special reference to L bratislavain population street dogs in certain regions of the Republic Serbia ) ВојиновићДрагица, Самоковлија Ана, Елезовић Милица, Манић Марија, Марић Ј., ПрокићНаташа, Смиљанић Јелена, Гргић Ж,.9 35 -9 45 Listeria monocytogenes у силажи намењеној за исхрану млечних крава(Listeria monocytogenes in silage intended for nutrition of dairy cows) Милица Лазић,Дагица Спасић Болботиновић, Д. Рогожарски, Љ. Стојиљковић, МиленаЖивојиновић, К. Матовић9 45 -9 55 Хламидиоза птица-приказ случаја (Avian chlamydiosis - case report) РаичвићЗ.,Меланија Митић, Д.Видановић, Костић М.9 55 -10 05 Раширеност туберкулозе у Црној Гори у периоду од 1999-2009.године (Theoutspread of tuberculosis in Montenegro from 1999 to 2009) Бојанић РашовићМирјана, Бојовић Оливера, Храповић Мевлида, Кажић Д, Куч Бојана10 05 -10 15 Испитивање преваленце за Salmonella spp. у популацији интензивноузгајаних свиња (Study on prevalence of Salmonella spp. in the population of pigs inintensive farming) Гргић Ж., Видић Бранка, Дошен Р., Савић Сара, ПродановРадуловић Јасна, Миланов Дубравка, Пушић И.10 15 -10 30 Изолација и карактеризација птичијег парамиксовируса – 1 (APNV-1) коддивљих голубова у Бугарској у 2011. години (Isolation and characterization of anavian paramyxovirus - 1 (APMV-1) from wild pigeons in Bulgaria in 2011) YulianTumbarski ,Gabriela Goujgoulova10 30 -10 45 Епизоотолошка истраживања појављивања парамиксовирозе кодголубова у Републици Србији (Epizootiological research of avian paramyxovirosis7

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYSoccurence in pigeons in Republic of Serbia) Димитрић А., Манић Марија., ПетровићТ., Ђуричић Босиљка.10 45 -11 00 Филогенетска анализа вируса Слинавке и шапа тип О изолованог ујугоисточном делу Бугарске у 2011 години (Phylogenetic analysis of Foot-and-mouthdisease virus type O isolated in south eastern Bulgaria in 2011) Lilyana Polihronova, T.Alexandrov, Simona Tchakarova, Krasimira Zaharieva, C. Filipov, G. Georgiev11 00 -11 10 Детекција, идентификација и карактеризација вируса авијарне инфлуенцеподтипа Х5 стандардним и биомолекуларним вирусолошким техникама(Detection, identification and characterization of avian influenza virus subtype H5 withstandard and biomolecular virological techniques) Шеклер М., Д. Видановић, В.Полачек, Н. Васковић, В. Курћубић, С. Обрадовић,11 10 -11 20 Испитивање крвних серума дивљих птица из фамилије Anatidae, саводотока Дунава, на присуство специфичних антитела против вируса авијарнеинфлуенце типа А, подтипова Х5 и Х7 (Investigation of blood serа of wild birdsfamily Anatidae, from Danube river, for the presence of specific antibodies againstavian influenza virus type A, subtypes H5 and H7) Шеклер М., Видановић Д.,В.Полачек, Н. Васковић, В. Курћубић, С. Обрадовић11 20 -11 30 Компаративна студија инактивсаних вакцина против беснила кодвакцинсанх коза (Comparative study of inactivated vaccines of rabies vaccinatedgoats) Кнежевић Н., Вељовић Љ.,Ђуричић Босиљка, , Станков С., Лазаревић-Иванц Љиљана11 30 -11 40 Примена биомолекуларних техника у идентификацији, карактеризацијии одређивању вируленце вируса Њукастл болести (Application of biomoleculartechniques in identification, characterization end determination of virulence ofNewcastle virus) Шеклер М., Видановић Д., Полачек В., Васковић Н., В. Курћубић,Обрадовић С.11 40 -11 50 Микотични колитис код свиња удружен са инфекцијом цирковирусомтип 2 (Micotic colitis of pigs associated with infection circovirus type 2 ) ЦветојевићЂ., Курељушић Б., Савић Б., Јездимировић Н., Вељовић Љ., Јасна Курељушић,Радановић О., Иветић В.11 50 -12 00 Утицај еколошких фактора на појаву и развој заразних болести (Effects ofenvironmental factors on the occurrence and development of infectious diseases)Бранка Видић, Сара Савић, Ивана Цирар, М.Видић, Надежда Прица12 00 -12 10 Имунохистохемијско испитивање Марекове болести (Immunohistochemical study of Marek's disease) Вучићевић Ивана, Нешић С, Вучићевић М.,Алексић Ковачевић Сања8

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕ12 10 -12 20 Епизоотиолошки надзор вирусних инфекција код врсте Apis mellifera(Epizootiological survey: viral infections of Apis mellifera) Виолета Сантрач,12 20 Дискусија13 00 -14 00 Секција V СЛОБОДНЕ ТЕМЕ –ПОСТЕРИ / FREE TOPICS-POSTERS1. Миксоматаза код нас и у свету –епизоотиолошка ситуација са освртом наимунопрофилаксу (Myxomatosis in Serbia and worldwide - current epizooticsituation with regard to immunoprophylaxis) Марић Ј., Кнежевић Н.,Нешковић Милијана, Lubos Korytar2. Епизоотиолошка слика беснила на територији општине Лозница(Episootiological situation of rabies in the municipality Loznica) ЂурићЉубица, Елезовић Радовановић Милица, Прокић Наташа3. Улога зоохигијенске службе ЈКП „Комуналије― - Сремска Митровица успречавању ширења,сузбијању и искорењивању заразне болести беснилаи других зооноза код паса луталица (Role of zoohygienic service PUC"Komunalije" - Sremska Mitrovica in preventing of spread,control anderadication rabies and other zoonoses in stray dogs) Чупић С., Драгановић Н.,Ћирић С., Вукелић Оливера, Марић Ј., Ристановић Весна4. Карантин семена и сперме домаћих животиња – епизоотиолошки значај(Seed and semen quarantine of domestic animals - episootiologicalimportance) Прокић Наташа , Миловановић А., Барна Т., Рогожарски Д.5. Приказ паразитске фауне на новоформираној фарми оваца пуњеној саразличитих подручја територије Србије (Review of parasitic fauna at thenewly established sheep farm filled with different areas from the territory ofSerbia) Славонка Стокић Николић, И.Павловић , И.Добросављевић , З.Илић6. Приказ паразитске фауне на новоформираној фарми коза пуњеној саразличитих подручја територије Србије (.Review of parasitic fauna at thenewly established goats farm filled with different areas from the territory ofSerbia) Павловић И., Стокић Николић Славонка, Добросављевић И., ИлићЗ.7. Приказ случаја амебозе у пчелињим друштвима са једног газдинства узападној Србији (Case report of amebiasis in hives from one place in westernSerbia) Лазић М, Манић Марија9

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYS8. Утицај промена биодиверзитета на људско здравље (Effects of biodiversitychange on human health) Ивана Хајзлер9. Појава паразита Philometra cylindracae код риба изловљених у Дунаву(Appearance of parasites Philometra cylindracae in fish caught in the Danube)Живојиновић Милена, Лазић Милица, Добросављевић И., Стокић НиколићСлавонка, Рогожарски Д.,Стојиљковић Љ., Живојиновић С., Павловић И.10. Leptospira Hardjo-резултати активно спроведеног серолошког надзора кодговеда (Leptospira Hardjo- results of serological active surveillance conductedon cattle) Марић Јелена, Илић Тања, Бркић З.17 00 -19 00 Секција IV ПАРАЗИТСКЕ ИНФЕКЦИЈЕ -PARASITIC INFECTIONSМодератори: Др И. Павловић, др Зорица Дакић, др Миланка Јездимировић17 00 -17 10 Токсокариаза људи у Београду (human toxocariasis in Belgrade) ДакићЗорица, Митровић Н., Инђић Н., Малинић Ј., Офори-Белић Ирена, Павловић М.17 10 -17 20 Први налаз Capillaria hepatica У Apodemus flavicollis у Србији (Firstreport of Capillaria hepatica (Bancroft, 1893) in Apodemus flavicollis in Serbia)Чабрило B., Јовановић В., Будински Ивана, Благојевић Јелена, Вујошевић М.,Оливера Бјелић-Чабрило17 20 -17 30 Епизоотиолошко епидемиолошки аспект молекуларног проучавањаехинококозе и хидатидозе домаћих и дивљих животиња (Epizootiologicalepidemiological aspect of molecular exemination of echinococcosis and hidatidosisdomestic and wild animals) Дебељак З., Кулишић З., Видановић Д., Томић А.17 30 -17 40 Упоредно испитивање ефикасности комбинације имидаклоприда саперметрином или моксидектином у сузбијању крпеља код паса (Comparativeefficacy evaluation of combination imidacloprid with permethrin or moksidectin incontrolling ticks in dogs) Јездимировић Миланка, Алексић Невенка, Јездимировић Н.17 40 -17 50 Присутност микрофиларије код паса на широј територији града Београда(Presence of dog`s microfilarie on wider teritory of Belgrade city) Марић Ј., Симић В.,Медић С., Надашкић М., Прокић Н., Павловић И.17 50 -18 00 Заступљеност ерлихиозе паса у прихватилишту за псе луталице уЛозници (Presence of erhlichiosis in animal shelters for stray dogs in Loznica)Елезовић Радовановић Милица,Ђурић Љубица, Прокић Наташа18 00 -18 10 Појава инфекције канаринаца са Sternostoma tracheacolum (носнe грињe),дијагноза и терапија-приказ случаја (Of infections canary with Sternostoma10

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕtracheacolum (nasal mites), diagnosis and treatment – case report) Шеклер М.,Видановић Д., Полачек В., Васковић Н., В. Курћубић, Павловић И.18 10 -18 20 Ектопаразити код преживара у Босни и Херцеговини (Ectoparasitoses inruminants in Bosnia- Herzegovina) Zuko Almedina,18 20 -18 30 Зоонотске нематоде код риба (Zoonotic nematodes of fish) Ћирковић М.,Новаков Н., Љубојевић Д., Алексић Н., Јовановић М.18 30 -18 40 Упоредно испитивање присуства ноземозе пчела класичниммикроскопским прегледом и квантитативнoм методом дијагностике (Comparativestudy of nosema presence in bees with classical microscopic examination andquantitative methods of diagnosis) Манић Марија, Плавша Нада, Раичевић З.,Ђуричић Босиљка18 40 Дискусија19 00 Закључци и затвaрање Симпозијума/ Conclusions and closing of theSymposium11

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYSSession 1VECTOR BORN INFECTIONS /ИНФЕКЦИЈЕ ВЕКТОРСКОГ КАРАКТЕРА12

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕ13

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYSEPIDEMIOLOGICAL AND EPIZOOTOLOGICAL FEATURES OFANAPLASMOSIS IN THE REGIONS OF RUSSIAKrasikov A.P., Rudakov N.V.AbstractAnaplasmosis are transmissive, natural-focal diseases caused by pathogens of the familyAnaplasmataceae.The aim of this work was investigation of natural and interflock foci of anaplasmosis inRussia, mainly in regions of Siberia.Human granulocytic anaplasmosis (HGA) agent was detected in ticks of the genusIxodes in a number of regions of Russia. Serological verification of HGA wasconducted in patients who were stabbed by ticks. This is the most likely way ofspreading this pathogens in Rusia through many types of ticks Ixodes persulcatus, witha possible epidemic manifestation of infection in natural foci.There is no doubt that it is necessary to distinguish the cases HGA from other commontick-borne infections - first of all with tick-borne encephalitis, tick-borne borreliosis andrickettsiosis. Prevalence of Anaplasma phagocytophilum in ticks in Russia is lower thanthe virus tick-borne encephalitis and pathogenic borreliae. The official registration HGAwas introduced into practice in recent years.Distribution of Ehrlichia muris, Anaplasma phagocytophilum, “Schotti variant” wasshown in I. persulcatus on the territories of Siberia and the Far East, Anaplasma bovis -in H.concinna on the Far East. With the use of cell cultures strain, causative agent ofcattle anaplasmosis - Anaplasma sp.Omsk was isolated.Results of examination of the animals from individual households shows widespreadanaplasmosis of cattle in the territory of Omsk region. Analysis of the results ofhematological and serological studies have shown that in the farms of the Omsk regionof the infectious process in cattle anaplasmosis may be in the form of mono-infection ortake an associative form causing severe clinical manifestations of the disease andabortions in the adult cattle.Experiments in this study have shown transstadial transmission of the Anaplasmae sp.Omsk in susceptibility ticks, D. reticulatus and D. silvarum. The possibility of not onlytransovarial transmission, but transstadial transfer also within one generation (time ofobservation) was shown in D. reticulatus and D. silvarum.Thus, anaplasmosis of cattle in regions of Russia has its own epidemiological andepizootical particular of manifestations, which should be considered when developingprevention and control measures against the disease.Key words: ticks, anaplasma, cattleProf dr A.P., Krasikov Institute of Veterinary Medicine and Biotechnology of Omsk State Agrarian Universitynamed by P.A. Stolypin of Ministry of Agriculture of the Russian Federation; prof dr Nikolaj.V.Rudakov,Omsk Research Institute of Natural Focal Infections of Russian Federal Consumer Rights Service,rickettsia@mail.ru14

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕAnaplasmosis (granulocytic ehrlichiosis) is transmissive, natural-focal disease causedby pathogens of the genus Anaplasma. The disease is widely spread and causeslivestock considerable economic losses as a result of the sharp reduction of productivityand loss of cattle [1].For a long time it was believed that Anaplasmataceae cause diseases only in animalsand do not represent a danger for a people. Later, it was proven development of threediseases in humans caused by Anaplasmataceae - fever Sennetsu (Neorickettsiasennetsu), human monocytic ehrlichiosis – HME (Ehrlichia chaffeensis) and humangranulocyte anaplasmosis - HGA (Anaplasma phagocytophilum). Alfa-Proteobacteria,causing human anaplasmoses, were reclassificated in three genera - Ehrlichia,Anaplasma and Neorickettsia instead of the same genus Ehrlichia [2,3].Anaplasmae of HGA genogroup were originally detected in ticks Ixodes persulcatus inthe Baltic region of Russia [4], hereinafter - the Far East of Russia - in the Primorje [5]and Khabarovsk regions [6]. Granulocytic anaplasmae were also detected in theNovosibirsk region [7] and Altay region [5].In the Far East of Russia HGA was first identified retrospectively by O.YU.Medjannikov et al. [6]. HGA cases have been identified on the territories of Siberiaretrospectively in the Altai territory in 1999 and in the Novosibirsk region in 2002[8].On the territory of the Altai region on the background of a rise in the incidence of tickbornerickettsiosis (TBR), part of the cases of ―serum negative‖ TBR was verified usingthe reaction of indirect immunofluorescence as granulocytic anaplamosis. Cases ofHGA in the Novosibirsk region have proceeded more difficult, often against thebackground of opisthorchiasis.HGA agent was detected in ticks of the genus Ixodes in a number of regions of Russia.Serological verification of HGA was conducted in patients who were stabbed by ticks. Itcan be regarded as quite probable way for spreading of the causative agent of HGA inRussia within the entire range of ticks Ixodes persulcatus, with a possible epidemicmanifestation of infection in natural foci. There is no doubt that it is necessary todistinguish the cases HGA from other common tick-borne infections - first of all withtick-borne encephalitis, tick-borne borrelioses and rickettsioses. Prevalence ofAnaplasma phagocytophilum in ticks in Russia is lower than the virus tick-borneencephalitis and pathogenic borreliae. The official registration HGA was introducedinto practice in recent years.Distribution of Ehrlichia muris, Anaplasma phagocytophilum, “Schotti variant” wasshown in I.persulcatus on the territories of Siberia and the Far East, A.bovis - inH.concinna in the Far East, with the use of cell cultures strain, pathogen of cattleanaplasmosis - Anaplasma sp.Omsk was isolated. The most common illness caused bythe representatives of the family of Anaplasmataceae (Anaplasma phagocytophilum),was HGA, with serologically verification in Russia in the areas spread by ticks Ixodesricinus - Ixodes persulcatus using ELISA. [5,9].According to Strelchik B.A et al. [10], the Teplova E.I., etc. [11] in some farms of theOmsk, Novosibirsk and Tyumen regions there were periodic outbreaks of bovinediseases with clinical signs of anaplasmosis. In all cases, in blood smears of sickanimals were found anaplasmae in red blood cells.15

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYSFor the prevention and effective measures against these diseases. it is very important astudy of the epizootic situation on cattle anaplasmosis in different regions of theRussian Federation, determination of the taxonomic position of the causative agent,epizootical and epidemiological risk of the disease and the role of insects in thetransmission of the infection.Results of examination of the animals from individual households shows widespreadanaplasmosis of cattle in the territory of Omsk region. [12, 13]. At the same timecarriers of anaplasmae were revealed in 11 from 12 farms of different geographicalzones (steppe, forest-steppe, and taiga) of the Omsk region. Infected animals carriesanaplasmae and they are the main source of infection in nature. They release bacteriafor several years, and sometimes throughout entire life.Results of hematological and serological investigations have shown that in the farms ofthe Omsk region, cattle anaplasmosis may be in the form of mono-infection and take anassociative form, causing severe clinical manifestation of the disease and abortions inthe adult cattle. In mixed infections could be isolated even three causative agents(usually a combination of Anaplasma, Chlamydia, Leptospira), and in calves even five(Anaplasma, Diplococcosis, infectious rhinotracheitis, PG-3, Listeriosis, and especiallyoften - Salmonella). The largest percentage of anaplasma‘s carriers, up to 90%. isamong the cattle of 3 - 5 years old, as accounted for farms located in the northern part ofthe Omsk region. This is due to the fact that the northern areas are located in the foreststeppeand sub-taiga areas, where the prevalence of ixodid ticks on animals is high andthe most favorable conditions are for the development of the main vectors – ticks D.reticulates who has two peaks of the invasion (in the spring and in the autumn).Taking into account role of ixodid ticks as vectors of anaplasmae, experimental study ofthe relations between them are essential for characteristics investigation of natural foci.In experiments on laboratory lines ticks of Dermacentor reticulatus and Dermacentorsilvarum we studied sensitivity and persistence of the causative agent of cattleanaplasmosis (A. sp. Omsk), thus, we contaminated ticks intracelomically. When this isestablished, 14 days after infection the number of infected individuals (A. sp. Omsk),constituted of 53,3±9.1% of ticks D. reticulatus and 43.3±9.0% D. silvarum ticks. After45 days, the infection was 63, 3±8.8% of ticks D. reticulatus and 56.6±9.0% of ticks D.silvarum. In the experiments for studying transstadial transmission of A. sp. Omsk, foroffspring feeding (larvae and nymphs) were used 6-7 days old baby mice. Infants ofwhite mice are very good experimental models for the feeding of the preimaginal formsof mites. The lack of hair on the body of infants greatly facilitates hungry mites transferand fed mites sampling.Experiments in this study have shown transovarial transmission of the Anaplasmae spOmsk in susceptibility ticks, D. reticulatus and D. silvarum. when was usedintracelomically tick‘s contamination, and also the quantity of the causative agent inthem for up to two months (the period of observation). The possibility of not onlytransovarial transmission, but also transstadial transfer within one generation (time ofobservation) was shown in D. reticulatus and D. silvarum, respectively.Experiments with classical hosts for D. reticulatus and D. silvarum shows the existenceof different ways for transmission, as evidenced by the presence of anaplasmae inspleen of contact animals. This was evidenced thanks to findings of increased offspringnumber who were belonged to infected female tick.16

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕIn animals with anaplasmosis, were observed following clinical symptoms: increasedbody temperature up to 40,5 o C, disorders of cardiac activity and emaciation of animals.In severe course of the disease, we noticed general weakness, loss of appetite, atony ofthe gastrointestinal tract, increased thirst, rapid breathing (up to 65 strokes per minute),eyelid and dewlap edema, slimy discharge from the nostrils etc. . In some cases, occuredabortions in the second half of pregnancy when anaplasmosis was associated withleptospirosisDuring examination of the suspects calves were identified following clinical signs:occurrence of skin alopecia with tipichal signs of ringworm, sero-catarrhal and purulentconjunctivitis, pale mucous membranes of oral and nasal cavities, sero-catarrhalbronchitis and bronchopneumonia.Our results of hematologic survey showed the presence of Anaplasma spp. inerythrocytes in 60% and 90% of investigated calves and cows, respectively. Red bloodpicture was characterized by deep violations of the medullar circulation, whichmanifests itself aniso-poikilocytosis, inclusions type reticular grid and anemia. Alsothere were rheological blood disorders that appear in formation of the "coin" as a resultof erythrocytes charge loss. White blood picture indicates dystrophic processes inlymphocytes and neutrophils. In each sampling from sick animals were registered whitecells (lymphocytes and monocytes) with the signs of lack of maturity. Changes inleukocyte profile of calves and cows manifested a neutrophilia and eosinophilia.As our observations showed, after clinical manifestation of the disease (acute, subacutecourse, often), infected animals become carriers, with the appearance of periodicrecurrence of illness. All stages of a painful process, especially in the clinical periodduring relapses is followed by hyperactive activity of bone marrow, culminating at theend with the appearance of aplasia and often leading to animal death In our researchanaplasmaemia fluctuated in a wide range from 1 - 3% to 26 - 30% of infected cells (per100 fields of view of microscope). However, the majority of infected animals did notexceed 10%.The results of our study on the possibility of experimental infection caused byAnaplasma sp. Omsk in the rabbits showed that they are susceptible to this pathogenand may be carriers within 50 days (the period of observation). The infectious processin spleenectomic rabbits leaking with the manifestation of the expressed clinical signs ofanaplasmosis. In addition, the intensity of the parasitic reaction of these rabbitsincreases up to 30 - 40% of infected cells in the period of 12 - 27 day after infection.In addition, in experimentally caused infection of white mice with Anaplasma sp. Omsk,it was found that pathogen not only makes clinical manifestations of disease and deathin experimental animals, but also is stored in following two passages (observation time).With repeated passages in the organism of experimental animals anaplasma did notincrease their anaplasmaemia (not exceed 8 - 10%). Thus, anaplasmosis of cattle inregions of Russia has its own particular epidemiological and epizootical manifestations,that should be considered in developing prevention and control measures against thedisease.Literature1. Kazakov N. A. Anaplasmosis of cattle: diagnostics, treatment, prevention, control measures /N. A. Kazakov // Vetinform. - 2003. - № 1. – p6-8.17

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYS2. Dumler J.S., Barbet A.F., Bekker C.P. etc. Reorganization of genera in familiesRickettsiaceae and Anaplasmataceae in the order Rickettsiales: unification of some speciesof Ehrlichia with Anaplasma, Cowdria with Ehrlichia, and Ehrlichia with Neorickettsia,descriptions of six new species combinations and designation of Ehrlichia equi and ‗HGEagent‘ as subjective synonyms of Ehrlichia phagocytophila// Int.J.Syst.Evol.Microbiol. 2001.Vol.51. p2145-2165.3. Dumler J.S. and Walker D.H. Tick – borne ehrlichioses// Lancet Inf.Dis., 2001, april.-p21-28.4. Dubinina E.V., Alekseev A.N. Dynamics of biodiversity pathogens of diseases carried byticks of the genus Ixodes: analysis of long-term data// Med.parasitology,1999.-№2.- p13-19.5. Schpynov S.N., Rudakov N.V., Yastrebov V.К. etc. New data on the identification ofehrlichiae and anaplasmae in ixodid ticks in Russia and Kazakhstan // Med. parasitology,2004. - №2. - p10-14.6. Medjannikov O.YU., Sidelnikov YU.N., Ivanov L.I, Zdanovskja N.I. To the question on theetiology with granulocyte erlihioza man in the far East of Russia. Pacific medical journal.№2 (7)- 2001.7. Morozova O.V., Dobrotvorsky A.K., Livanova N.N. et al. PCR detection of Borreliaburgdorferi sensu lato, tick – borne encephalitis virus, and human granulocytic ehrlichiosisagent in Ixodes persulcatus ticks from Western Siberia, Russia// J.Clin.Microbiol.,2002,Oct.,vol.40,N10.-p3802-3804.8. Rudakov N.V., Obert A.S., Kalmin O.B., Rudakova S. A., Samoylenko I.. New andreturning natural focal infections and laboratory verification of granulocytic erhlichiosis inthe Altai territory. Proceeding of conf. «Natural and anthropogenic background of the healthstatus of the population of Siberia», Barnaul, 2001.-p47-50.9. Schpynov S.N. Identification of ehrlichiae in ticks Ixodes persulcatus in the Urals and in theAsian part of Russia / / S.N. Schpynov, N. V. Rudakov, P.- E. Fournier, Raoult D. // Bull.ESSC SD RAMS. - Irkutsk, 2002. - №4. - T. 2. p139 – 141.10. Strelchik V. A. Epizootological and clinical-morphological characteristics of theanaplasmosis of cattle in the Omsk region / V. A. Strelchik, Yu. M. Gichev, V. I.Zainchkovskiy // Materials of all-Russian scientific-methodical conference of pathologists ofveterinary medicine (20-22 Sept., 2000 g.): scientific proceedings of Institute of VeterinaryMedicine and Biotechnology of Omsk State Agrarian University. - Omsk, 2000. - p142-145.11. Teplova E.I. Manifestation of anaplasmosis of cattle in different geographical zones / E. I.Teplova, A.IRusskova, L. K. Lichovoz [et al.] // Diagnosis, treatment, and prevention ofinfectious and parasitic diseases of agricultural animals: scientific proceedings. - Stavropol,1983. - p55.12. Krasikov, AP. [etc.] Anaplasmosis of cattle and associative forms of its expression / AP.Krasikov, K.K. Beisembaev, YU. Gichev, N.A. Bronnikova // Problems of veterinaryeducation and scientific research in agro-industrial complex. - Omsk, 2004. - p177-182.13. Krasikov, AP. [etc.] Improvement of methods of diagnostics of анаплазмоза cattle / AP.Krasikov, NV. Rudakov, N.A. Bronnikova, K.K. Beisembaev // Veterinary pathology. -2007.-№(20).-p22-124.18

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕЕПИДЕМИОЛОШКЕ И ЕПИЗООТИОЛОШКЕ КАРАКТЕРИСТИКЕАНАПЛАЗМОЗЕ У РЕГИОНИМА РУСИЈЕКрасиков А.П. .Рудаков Н.В.Кратак садржај - Анаплазмозе су трансмисивне, природножаришне инфекцијекоје изазивају патогени фамилије Anaplasmataceae.Циљ овог рада је да проучи природна жаришта и жаришта међу стадимаанаплазмоза у Русији, углавном у регионима Сибира.Узрочник хумане гранулоцитне анаплазмозе (HGA) је откривен у крпељима родаIxodes у великом броју региона Русије, а серолошка потврда HGA је рађена међупацијентима са убодима крпеља. Ово може бити посматрано као вероватан путширења узрочика HGA у Русији са читавим низом крпеља Ixodes persulcatus и самогућим епидемијским манифестацијама у природним жариштима инфекције.Без сумње је потребна диференцијацијa случајева HGA од других инфекција којепреносе крпељи - крпељског енцефалитиса, борелиозе и рикециоза. ПреваленцаAnaplasma phagocytophilum у крпељима у Русији је нижа него вируса крпељскогенцефалитиса и патогених борелија. Званична регистрација HGA је уведена упраксу у последњих неколико година.Приказана је дистрибутција Ehrlichia muris, Anaplasma phagocytophilum, “Schottivariant” у I.persulcatus на територијама Сибира и Далеког Истока, A.bovis - уH.concinna на Далеком Истоку, а употребом ћелијских култура изолована јепатогена анаплазма говеда - Anaplasma sp.Omsk.Резултати прегледа домаћинстава су показали раширеност анаплазмозе говеда натериторији регије Омска. Анализа резутата хематолошких и серолошких студијаје показала да је на фармама региона Омска инфективни процес аналазмозе говедау форми моноинфекције и некад има асоцијативну форму, што доводи до тежихклиничких манифестација и до абортуса крава.Експерименти у овом истраживању су показали трансстадијалну трансмисијуАnaplasma sp. Omsk код пријемчивих крпеља D. reticulatus и D. silvarum.Могућност не само трансоваријалне већ и трансстадијалне трансмисије токомједне генерације је доказана код D. reticulatus и D. silvarum.Стога, анаплазмоза говеда у регионима Русије има посебне епидемиолошке иепизоотиолошке манифестације, што треба узети у обзир код прављења мераконтроле и превенције ове болести.Кључне речи: крпељи, анаплазмоза, говедаПроф др А.П Красиков. Институт ветеринарске медицине и биотехнологије Државногпољопривредног универзитета у Омску П.А.Столyпин, Министарство Пољопривреде РускеФедерације; Проф др Николај В. Рудаков, Истраживачки институт природножаришних инфекцијаРуске Федерална Агенција за права потрошача у Омску, rickettsia@mail.ru19

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕKey words: isolation, Anaplasma phagocytophilum, propagation, immunofluorescencePetrovec M., Avšiĉ-Ţupanc Tatjana., Institute of Microbiology and Immunology, Malovrh T., Institute ofMicrobiology and Parasitology, Veterinary Faculty, University of Ljubljana, Slovenia, Strle F., Lotriĉ-Furlan S.,Department of Infectious Diseases, University Medical Centre, Ljubljana, SloveniaИЗОЛАЦИЈА И ПРОПАГAЦИЈА ANAPLASMA PHAGOCYTOPHILUM КОДПАЦИЈЕНАТА СА ГРАНУЛОЦИТНОМ АНАПЛАЗМОЗОМ ЉУДИПетровец М., Маловрх Т., Стрле Ф., Лотрич-Фурлан С., Татјана Авшич-ЖупанцКратак садржајСловенија је добро позната ендемска регија за бројне болести које се преносекрпељима. Године 1996, описали смо први потврђен случај гранулоцитнеанаплазмозе људи (ХГА) у Европи. Са циљем да се боље окарактерише инфекцијаизазвана A. phagocytophilumоm код људи у Словенији, покушали смо изолацијуузрочника. Дакле, стратегија инокулације мишева је коришћена за иницијалнохватање и одржавање изолата. Од пацијената је 17. дана након почетка болестиузоркована крв са ЕДТА антикоагулансом. По 0,5 мл крви пацијента саантикоагулансом инокулисано је интраперитонеално интактним BALB/Cмишевима женског пола. Крв је мишевима инокулисана у року од 30 минутанакон узимања од пацијената. Затим је од мишева 5. дана након инокулацијеузоркована крв из ретроорбиталних синуса и испитивана на присуство инфекцијеса анаплазмама применом Diff-Quik методе (Dade Behring; Germany), односнобојењем крвног размаза. Након успешнe инфекције мишева инокулисаном крвљу,зa следећу пасажу су коришћене слезине мишева. Животиње су жртвованецервикалном дислокацијом 10. или 12. дана после инокулације. Слезина јеуклоњена и хомогенизована. Ћелије су суспендоване у RPMI 1640 медијуму ибројане у коморици хемоцитометра. Пропагација инфекције је постигнутаинтраперитонеалном инокулацијом око 1,5 x 10 6 ћелија слезине добијене изпретходно инфицираног миша. Овај поступак је понављан сваких 10. до 12. дана.Све животиње су биле здраве после експерименталне инокулације и нисупоказивале никакве видљиве знаке инфекције. Припремљене су HL-60 културећелија. Након шест пасажа на мишевима инокулисане су културе ћелија HL-60 са1.6 x 10 6 ћелија добијених из слезина претходно инфицираних мишева. Културећелија HL-60 су одржаване у приближној густини од 10 6 ћелија по мл, чуване су уинкубатору на 37º С са додатком 5% СО 2 . Свакодневно се је испитивао изглед,опште стање ћелија и одсуство контаминације на ћелијским културама HL-60.Мале количине ћелија су биле уклоњене при свакој замени подлоге и провераваноје присуство специфичних цитоплазматских инклузија (морула) помоћу Diff-Quikбојења припремљеног размаза ћелија. После инокулације на HL-60 култури ћелија24. дана почело је прво појављивање посебних морула у појединим ћелијама.Стопа инфекције ћелија премашила је 80% после 28. дана инкубације. Изолат јеозначен као Словенија-1 (СЛО-1). Након изолације A. phagocytophilum на култури21

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕANAPLASMOSISMalovrh T.Institute of Microbiology and Parasitology, Veterinary Faculty, University of Ljubljana, SloveniaIntroductionAnaplasmosis is a tick-borne disease of blood cells caused by bacteria in the groupAnaplasma. The disease occurs in tropical and subtropical regions worldwide, includingSouth and Central America, the USA, southern Europe, Africa, Asia, and Australia.Anaplasmosis was originally believed to infect only ruminants (cattle, sheep, goats,deer, elk, bison, antelopes, etc). Following recent reclassification (2001), some formermembers of the Ehrlichia group that infect humans, dogs, and horses, are nowconsidered to be part of the group called Anaplasma. So, the Anaplasma genus includesspecies: Anaplasma bovis (previously E. bovis), A. caudatum, A. marginale, A. centrale,A. ovis, A. phagocytophilum (compiled from species previously known as Ehrlichiaphagocytophila, E. equi, as well as human granulocytic ehrlichiosis agent-HGE) and A.platys (previously E. platys), all of which invade blood cells of their respectivemammalian hosts.Taxonomy of the pathogen after 2001AnaplasmataceaeAnaplasmaA. bovisA. caudatumA. marginaleA. centraleA. ovisA. phagocytophilumA. platysAegyptianellaEhrlichiaE. canisE. chaffeensisE. ewingiiE. murisE. ruminantiumNeoehrlichiaNeorickettsiaWolbachiaXenohaliotisTransmission and Epidemiology - Up to 20 different tick vector species (includingBoophilus, Dermacentor, Rhipicephalus, Ixodes, Hyalomma, and Ornithodoros) have23

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYSbeen reported to transmit Anaplasma spp. After feeding on an infected animal,intrastadial or trans-stadial transmission may occur. Transovarial transmission may alsooccur, although this is rare. A replicative cycle occurs in the infected tick. Mechanicaltransmission via biting dipterans occurs in some regions. Transplacental transmissionhas been reported and is usually associated with acute infection of the dam in the secondor third trimester of gestation. Anaplasmosis may also be spread through the use ofcontaminated needles or dehorning or other surgical instruments. People can acquire thedisease from the bite of a tick carrying the bacteria, and from blood transfusions ororgan transplants. Hunters and meat processors have acquired the disease whilebutchering hunted animals, so it is important for those processing meat from thesespecies to wear gloves while preparing carcasses. People should also wear long pantsand long sleeves when outside in potential tick habitats. Ticks should be promptlyremoved if found on people or pets. Domestic animals can introduce ticks to theirowners and can themselves become infected with Anaplasma spp. Tick bite preventionis the key to protecting humans and domestic animals from this disease.A. bovis - is a bacterium detected mainly in cattle, but also observed in small mammalswhich are probably a reservoir of this bacterium. It occurs in monocytes, and the diseaseis called monocytic anaplasmosis. The symptoms of the disease are most visible incalves, but also in adult animals. A. bovis has been detected in Brazil, North America,Africa and Japan.A. caudatum - might infect cattle and wildlife elsewhere in the world. Cattle infectedwith A. caudatum may result in severe disease. Healthy calves younger than 9 monthshave innate resistance as well as cattle living in an endemic region develop naturallyacquired immunity. Wild ruminants (antelope, buffalo, deer, eland) can function asreservoirs of the pathogen without clinical disease. It is the anaplasmosis of erythrocytes(Gall Sickness).A. marginale- are obligate intracellular bacteria parasitizing in erythrocytes of highervertebrates, mostly ruminants and has been described in domestic and wild animals. It isthe most prevalent tick-borne pathogen causing bovine anaplasmosis in cattleworldwide with significant economic losses, especially in tropical and subtropical areas.A. central - is a parasite in the erythrocytes of ruminants, mainly cattle. As opposed toA. marginale, it creates concentrations in the central part of the cell. This bacterium iswidely-spread throughout the world. In spite of morphological differences, occurrenceand virulence, A. centrale is closely related to A. marginale and causes the mild form ofanaplasmosis in cattle (mild anemia in most cases). Because A. centrale provoke crossreactive immune response to A. marginale, therefore it is used for the preparation of livevaccine strains, assuring immunological protection against bovine anaplasmosis.A. ovis - mainly parasitizes small ruminants like sheep and goats, and its presence hasbeen confirmed in most regions of the world both in farm and wild animals. Thesebacteria live in erythrocytes, that's why the anaemia of the infected animals. Thesymptoms of the disease depend on age, on the general condition of the animals andtheir breed. The infection is also potentially lethal. Current research shows that A. ovisis a problem not only in poorer countries. These bacteria have been detected in theU.S.A., Italy and Hungary. The spread of this bacterium may also be enhanced bymodern climatic changes.24

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕA. phagocytophilum - is the most frequently described bacterium from the genusAnaplasma. In the nature, several strains of A. phagocytophilum capable of causingdisease in sheep, cattle, horses, dogs, cats and humans have been found. In the case offarm animals anaplasmosis caused by A. phagocytophilum is a disease with subclinicalor severe symptoms. It has unspecific symptoms, such as fever, drowsiness, anorexia,abortions and drop in body weight as well as reduction in milk production. Leftunattended, especially in weaker individuals, it can lead to death. Different A.phagocytophilum variants show disparities in clinical severity and diseasemanifestation. Biological and ecological differences between A. phagocytophilumstrains (or genetic variants) were documented; including DNA sequences, antigenicdiversity, reservoir competence, hosts pathogenicity, vector competence andgeographical distribution. Recent studies indicate that vectors and hosts may be infectedwith several variants simultaneously and that these variants behave differently in themammalian host.A. platys - is mainly a pathogen of canines, usually dogs. It lives in blood cells,causing Canine Cyclic Thrombocytopenia (CCT). Clinical symptoms of this diseasevary depending on the species of the dog. These bacteria do not cause death, andtreatment with suitable antibiotics is usually successful after four weeks. A. platys wasdetected in the USA, Venezuela, Asia, Australia and Africa, thus in Europe, thepresence of A. platys was confirmed around the Mediterranean Basin, in France, Greece,Spain and Italy.Diagnostics - Classical microscopic diagnosis of infection relies on identification ofmorulae in circulating monocytes, neutrophils, or platelets in Giemsa-stained bloodsmears. However, morulae are usually difficult to find in blood smears, even during theacute stage of the disease. Inoculation and isolation on mice are possible on the otherhand cell culture isolation, which some consider a gold standard for confirming thisinfection, is laborious, expensive, time-consuming and available only in specializedresearch laboratories. Serology may be helpful in identifying the presence of antibodiesbut may not detect early infections during the acute phase of disease. Antibody titersmay persist months to years after treatment and resolution of clinical signs. However,the presence of antibodies alone does not indicate a need for treatment in the absence ofany evidence of clinical disease. Indirect fluorescent antibody (IFA) assays to determineIgM and IgG titers are available through diagnostic laboratories as well as ELISA.Cross-reaction among the Ehrlichia spp. and Anaplasma spp. is commonly recognized,and nonspecific IFA titers may develop due to infection with related agents.Molecular diagnostics from the whole blood is available. However, results should beinterpreted with caution because the techniques used in different diagnostic laboratoriesvary. To maximize the effect of molecular diagnostics, blood samples should becollected as early as possible in the course of clinical disease, before the initiation ofantimicrobial therapy, and should be submitted to experienced diagnostic laboratorieswith stringent quality control measures in place.The case report: Isolation of Anaplasma phagocytophilum from human patientIntact BALB/C female mice were inoculated intraperitoneally with 0.5 ml of the patient‘sEDTA-anticoagulated blood drawn on the 17 th day after disease onset. Mice were25

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYSinoculated with blood within 30 minutes after collection from the patient. Blood samplesof challenged mice were collected from the retroorbital sinus at 5 days after inoculationand the blood was checked for Anaplasma infection by examination of Diff-Quik (DadeBehring; Germany) stained blood smear. After successful establishment of infection inmice inoculated with blood, the spleens were used for the next passage. The animal wassacrificed by cervical dislocation, either on day 10 or 12 after inoculation. The spleen wasremoved and homogenized. Cells were suspended in RPMI 1640 medium andenumerated in a haemocytometer microscopic slide. Propagation of infection wasachieved by intraperitoneal inoculation of approximately 1.5 x 10 6 spleen cells derivedfrom a previously infected mouse. This procedure was repeated every 10 to 12 days. Allanimals appeared healthy after experimental inoculation and did not show any obvioussigns of infection. Cultures of HL-60 cells were prepared. After six passages in mice HL-60 cells were inoculated with approx. 1.6 10 6 spleen cells removed from previouslyinfected mice. HL-60 cells were maintained at a density of approx. 10 6 cells per ml in anincubator at 37 ºC supplemented with 5 % CO 2 . HL-60 cell cultures were examined dailyfor cellular appearance, general health, and absence of contamination. Small aliquots ofcells were removed on each feeding and checked for the presence of specific cytoplasmicinclusions (morulae) using Diff-Quik stained cytospin preparations of cells. On the 24 thday after inoculation in HL-60 cell culture, the first distinct morulae began to appear inindividual cells. The infection rate of cells exceeded 80 % after 28 days of incubation.The isolate was designated Slovenia-1 (SLO-1).Literature1. Anaplasmosis. 2011. The Merck Veterinary Manual.2. Kocan KM, La Fuente J, Blouin EF, Garcia JC. 2004. Anaplasma marginale(Rickettsiales: Anaplasmataceae): recent advances in defining host–pathogenadaptations of a tick-borne rickettsia. Parasitology. 129: 285-300.3. La Fuente J. Torina A, Caracappa S et all. 2005. Serologic and molecularcharacterization of Anaplasma species infection in farm animals and ticks from Sicily.Veterinary Parasitology. 133: 357-62.4. Matthew DE, Pedro PV, Melissa JB et all. 2011. Typical and Atypical Manifestations ofAnaplasma phagocytophilum Infection in Dogs. J Am Anim Hosp Assoc. 47: 86-94.5. McQuiston JH, McCall CL, Nicholson WL. 2003. Ehrlichiosis and related infections. JAm Vet Med Assoc. 223; (12): 1750–6.6. Nováková M, Víchová B. 2010. Granulocytic anaplasmosis-emerging tick-bornedisease of humans and animals. Biologia. 656: 925-31.7. Pennsylvania Game Commission Wildlife Disease Reference Library: Anaplasmosis.8. Rikihisa Y. New Findings on Members of the Family Anaplasmataceae of VeterinaryImportance. 2006. Ann NY Acad Sci. 1078: 438-45.9. Rymaszewska A, Grenda S. 2008. Bacteria of the genus Anaplasma-characteristics ofAnaplasma and their vectors: a review. Veterinarni Medicina. 53, (11): 573-84.10. Smith RD, Hungerford LL, Armstrong CT. 1989. Epidemiologic investigation andcontrol of an epizootic of anaplasmosis in cattle in winter. J Am Vet Med Assoc. 15,195(4): 476-80.11. Torina A, Caracappa S. 2007. Anaplasmosis in Cattle in Italy. Vet Res Comm. 31;(Suppl. 1): 73-8.26

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕQ FEVER : EPIDEMIOLOGICAL AND EPIZOOTOLOGICAL ASPECTSRudakov N.V, Krasikov A.P.AbstractThe aim of this study was to analyze modern epidemiological and epizootic aspectsof the distribution of Q fever in Russia.The paper presents results of years of research complex of Q fever outbreaks inRussia using epidemiological, microbiological, serological and clinical-epizooticmethods. Q fever was found in all former republics of the Soviet Union and in morethan 50 regions of the Russian Federation. The appearance of persistent natural fociof infection in large cattle farms was confirmed by isolation of different strainsfrom milk of cows from maternity ward.Research shows that cattle coxiellosis is disease with multiple potential causes,where the number of microorganisms involved in the infection can be from 5 to 7.It was estimated different epidemiological significance of Q fever natural foci,depending on the species, the level of industry development and epizootiologicalprocess. Importance of natural foci of coxiellosis in the poultry farms reflected theincidence of human Q fever. In the observed areas with cattle farms in the foreststeppe area of Western and Middle Siberia, it was experimentally proved infectionof ticks D. Nuttal and D. reticulatus with C.burnetii. Nearly of cattle farms it hasbeen isolated strain of C.burnetii from rodents (Mus musculus).Q fever has the largest distribution among the herds, which determines itsepidemiological features. In case of an outbreak of Q fever in Western Siberia itwas demonstrated the role of goat hair and sheep wool. Q fever outbreaks amongherds determine the main epidemiological rules and play a significant role in thecirculation and maintenance of C.burnetii. Goats, sheep and cattle are the mostimportant hosts for Q fever, especially during reproduction period. During anepidemics, C.burnetii was confirmed with biological assay, ELISA test,mycroimmuno-fluorescence test in samples taken from placenta, soft goat hair andmilk of ill animals.Analysis of current epidemiological situation showed two main types (goat - sheepand cattle) of infection among the herds, and increased role of animals onindividual farms as a source C.burnetii.It is necessary to create an active epizootiological monitoring programs with auniform approach that would be carried out by doctors and veterinarians interritories where Q fever occurs among herds.Key words: Q fever, epidemiological and epizootiologic aspects, goats, sheeps.Prof dr NikolajV Rudakov Omsk Research Institute of Natural Focal Infections of Russian FederalConsumer Rights Service; Prof dr A.P. Krasikov Institute of Veterinary Medicine and Biotechnology ofOmsk State Agrarian University named by P.A. Stolypin of Ministry of Agriculture of the RussianFederation 644080 prospect Mira Omsk Russia, rickettsia@mail.ru;27

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYS28Nearly 80 years after its recognition as a clinical entity [1], Q fever (coxiellosis)remains a serious problem for public health and veterinary medicine. This is awidely spread zoonotic disease in different countries of the world. Differentlandscapes - environmental types of natural foci and intensive distribution betweenherds are two most typical characteristics of Q fever.The occurrence of infection in healthy herds indicates the increased role of peoplewho circulate between the different herds and thus transmit pathogens from oneplace to another. However, up to now the existence of such hot spots that are notdirectly related to the natural focal points as well as the forms of their relations inareas with different levels of economic development, have not been studied enough.Moreover, these foci represent a source of infection.The aim of this study was analysis of modern epidemiological and epizootologicalaspects of distribution of Q fever in Russia. Q fever was detected in all republics offormer Soviet Union and more than 50 regions of Russian Federation. During aperiod of 1957-1995, the official statistics showed 11058 cases of Q fever diseaseamong the people [2, 3]. The importance of this infection is associated with highresistance C. burnetii for various factors of the environment, high diversity of agentdistribution and the presence of natural foci of infection in different territoriesamong mammals, birds and many species of ectoparasites [4]. In farm animals, thisis mostly asymptomatic disease whereby the amount of specific antibodies in theblood is constantly increasing [5, 6]. Q fever is a very dangerous infection forhuman, especially for those people who are working on farms and for children, aswell. Diagnose of Q fever in humans based only on clinical symptoms is extremelydifficult because of the polymorphism of clinical manifestations. It is oftenmisdiagnosed as acute respiratory disease, pneumonia, influenza, etc. One of theserious gaps in the study of Q fever is a lack of detailed data for regionalepizootiology. A significant obstacle for the prevention and eradication of thisdisease is the insufficient development of diagnostic methods and diagnostic tools.For example, test of complement fixation to the antigen on phase I, recognized as arelevant laboratory test for the diagnosis of Q fever, does not give opportunity toidentify all cases of the disease [7].Q fever increases the susceptibility of cattle to secondary infections, which makes itthe more severe, often causing death of ill animals. So far, discovered clinical casesbased on the clinical features of the disease, does not represent the exact currentsituation, because most disease outbreaks remains outside the territories whichconducts active epizootiological monitoring. Taking into account the specificcharacteristics and pathogenesis of the disease, it is necessary to timely carry outdiagnosis of Q fever and other infection diseases using modern rapid methods. Theresults of the integrated survey of households, showed quite widespread coxiellosisof cattle on the territory of Omsk region. So, out of 29 surveyed farms Q fever wasdiagnosed in 17 (59 %) farms, whereby an average 10.6 % of infected cattle.Studies have shown that cattle coxiellosis has complex etiology, since it is usuallymixed infection caused by a number (5 to 7) different microorganisms. Most oftenC.burnetii is registered with mycoplasmas (33 %), leptospirae (44 %), listeriae (48%), and the highest frequency in the association belongs to the chlamydia spp.- 59%.

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕSpecifics of distribution and epidemiological manifestation of Q fever natural fociwere described in the context of industrial development. The possibility ofexistence of a long-term focal infection in the large livestock complexes wasdetected on the basis of causative agents‘ isolation from milk of cows in thematernity ward. Epidemiological significance of Q fever natural foci can bedifferent, depending on animal species and the level of industrial development.The existence of hot spots of coxiellosis on poultry farms was discovered after theappearance of Q fever among the people who were employed there. As a result ofthe conducted research, natural foci of Q fever were detected on poultry farms inWestern Siberia for the first time. Significant positive results were obtained in thereaction with the complement fixation to the antigen of C. burnetii of the 2nd phaseamong employees at poultry farms and in three species of birds (ducks, chickens,geese). Cases of Q fever in humans from one of the poultry farms were confirmedby serological tests. This is important epidemiological data for this part of Russia.An outbreak of disease on poultry farms depends on technological conditions forpoultry farming, as well as bird species. Despite the small number of registeredclinical cases of Q fever disease on farms for duck breeding, findings of significantantibody titers against C. burnetii, among the people who work on farms and inpoultry also, is significant evidence that these natural foci are active.In the observed areas with cattle farms in the forest steppe area of Western andMiddle Siberia, it was experimentally proved (seroconversion in guinea pigs incomplement fixation test, titers were 1:40-1:640) infection of ticks D. Nuttal and D.reticulatus with C.burnetii. Nearly of cattle farms it has been isolated strain ofC.burnetii from rodents (Mus musculus).Q fever has the largest distribution among the herds, which determines itsepidemiological features. In case of an outbreak of Q fever in Western Siberia itwas demonstrated the role of goat hair and sheep wool. Natural foci of Q fever thatare spreading within the herd, determine the main epidemiological characteristics ofan area and play an important role in the circulation and maintenance of C.burnetiiin nature. Natural foci were confirmed on large farms of cattle, sheep and poultry aswell as on small individual farms. Goats, sheep and cattle are the most importanthosts for Q fever, especially during reproduction period. During the outbreaks,C.burnetii was detected by bioprobes, ELISA test and micro-immunofluorescencetest with samples taken from placenta, soft goat hair and from milk of theseanimals.Analyzing of current epidemiological situation of Q fever in Russia, we revealedtwo main types (―goat-sheep‖ and ―cattle‖) of inter flock focus and increasing roleof animals from individual farms, as sources of C.burnetii. The natural foci of thesetypes have different ecological, epizootic and epidemiologically characteristics(activity and stability of natural foci, main mechanisms and factors of the pathogentransmission).Stable and highly active natural foci of the ―goat-sheep‖ type in individual sectorhave been formed in the European and Asiatic parts of Russia during the past fewyears. They have caused series outbreaks of Q fever in Novosibirsk, Voronezh andAltay regions. More than 70% of Q fever cases in Russia have been registered in29

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYSthe administrative territories, where the ―goat-sheep‖ type of natural foci wasdiscovered.During last 30 years, the epidemiological role of the goats as sources of C.burnetiiin different regions of Russia has increased [2]. It was due to the increase of theirquantity, high epizootic potential of the ―goat-sheep‖ type of natural foci,epidemiologically highly dangerous mechanism of airborne transmission in thetime of the processing of animal products, shearing the animals, specific economicconditions and human activities in these regions.In West Siberia the first ―goat-sheep‖ outbreak of Q fever in individual sector wasdiscovered in the Barabinsk district of Novosibirsk region in autumn-winter 1983-1984. Later outbreaks with a crucial role of goats and sheep were registered inseveral territories of Novosibirsk and Altay regions. For the past few years, Q feverwasn‘t detected in these regions.Concept of Q fever as an infection with facultative tick transmission in the naturalfoci, was widely spread. However, for the maintenance of this agent, the alterationof inter flock and natural cycles of C.burnetii was considered to be necessary as―metaxenosis‖ of this microorganism.Results of several years long observing of inter flock foci movement of Q fever inSiberia, we have concluded that there is an intense transmission of C. burnetiiamong farm animals in large complexes. We also revealed a long standingepidemiological activity of inter flock foci on the huge territories of Siberia, wherenatural foci are absent and where there is no connection between inter flock andnatural cycles of C.burnetii. These facts give a number of arguments that there iscirculation and maintaining of causative agent between herds.Adaptation of C.burnetii to domestic animals and its stability under differentenvironmental conditions do not support the previous idea of an exclusive role ofticks as the only carrier of this agent. Moreover, the termination of connectionsbetween domestic animals and ticks, as a result of human activities, can promotethe return of Q fever as a typical zoonotic disease that is spreading among domesticanimals.This conclusion has booth theoretical and practical significance, because it helps todetect and eliminate the epidemiologically active inter flock foci. It is necessary toelaborate active program of the epizootologic monitoring with uniform systemicapproaches used by all specialists of medical and veterinary services in theterritories, where the inter flock foci of Q fever occur.Based on previous results, we can make following conclusions:1. Transition of livestock production on an industrial basis and other kinds ofrational economic activities, may lead to the reduction of inter flock foci tensionsand improvement of the epidemiological situation in respect of Q fever;2. Characteristics of cattle breeding on the agro-industrial levels do not exclude thepossibility of the formation of foci of Q fever among livestock herds on large farmcomplexes. Onset, duration and epidemiological characteristics of the diseasedepend on the type of animal, the type of work on the farm and the number ofworking hours.30

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕ3. The biggest role in the formation of hot spots among domestic animals plays thecloseness of relationships that they have with vectors. Stable and strong focus of Qfever is in intensive exchange of C. burnetii.Findings of our study suggest the need for preventative measures aimed atpreventing the transmission of the causative agent from sick to healthy animals andhumans; the destruction of vectors-ticks and rodents, as well as the timelyexecution of preventive measures and improvement of health activities in majorreservoirs of Coxiella burnetii - large and small ruminants.Literature1. Derrick, E.H. Q fever, new fever entity: clinical features, diagnosis and laboratoryinvestigation. Med.J.Aust.1937.2, p281-299.2. Rudakov N.V., Fetisova N.F., Syskova T.G. Coxiellesis in Russian Federation // Thehealth of the population and the environment: the monthly newsletter, 1994.-№2.-p10-12.3. Rudakov N.V. Ecologico-epidemiological observations of Q-fever in Russia //Rickettsiae and Rickettsial Diseasis: proceedings of the 5th International Symposium -Bratislava, 1996, p524-527.4. Balashov, Yu. S. Bloodsucking arthropods and Rickettsiae / Yu. S. Balashov, A. B.Dajiter. - L.: Science, Leningrad dep., 1973. p250.5. Yusupov, R. P. The development and improvement of the laboratory methods ofdiagnostics of Q fever of animals: Dis.PhD in veterinary: 16.00.03 / Yusupov R. P. -Kazan, 1995 - p137.6. Gosmanov, P. G. Improvement of the diagnosis of Q fever of agricultural animals // R.G. Gosmanov, P. X. Yusupov // Scientific Tr. Diagnostics, prophylaxis and methods ofstruggle with tuberculosis of animals. - Kazan, 1985. - p57-65.7. Sidorchuk, A. Rickettsioses of animals// A. Sidorchuk, and A. Glushkov. - M., 2001.p83.Q ГРОЗНИЦА: ЕПИДЕМИОЛОШКИ И ЕПИЗООТИОЛОШКИАСПЕКТИРудаков Н.В 1 ., Красиков А.П. 2Кратак садржајЦиљ овог рада је анализа савремених епидемиолошких и епизоотиолошкихаспеката дистрибуције Q грознице у Русији.Изложени су резултати комплексног вишегодишњег истраживања жаришта Qгрознице у Русији коришћењем епидемиолошких, микробиолошких,серолошких и клиничких-епизоотиолошких метода. Q грозница је утврђена усвим бившим републикама Совјетског савеза и у преко 50 региона Рускефедерације. Појава дуготрајних жаришта инфекције у великим комплексимаза узгој говеда потрвђена је изолацијом сојева из млека крава у породилишту.Истраживања показују да је кокциелоза говеда болест са више потенцијалнихузрочника где број микроорганизама који учествују у инфекцији може да буде31

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYSод 5 до 7. Утврђен је различити епидемиолошки значај жаришта Q грознице узависности од врсте животиња, нивоа индустрије и активности епизоотичкогпроцеса. Значај жаришта коксиелозе на живинарским фармама се огледао уобољевању људи од Q грознице. На посматраним подручјима фарми говеда ушумској и степској зони Западног и Средњег Сибира у огледима је доказанаинфекција са C.burnetii иксоидних крпеља D. nuttalli и D. reticulatus. Ублизини фарме говеда изолован је сој C.burnetii из глодара (Mus musculus).Q грозница има највећу дистрибуцију међу стадима, који одређују његовеепидемиолошке карактериситике. У случајевима избијања Q грознице уЗападном Сибиру доказана је улога козје длаке и овчије вуне. Жаришта Qгрознице између стада одређују главна епидемиолошка правила и играјузначајну улогу у циркулацији и одржавању C.burnetii. Козе, овце и говеда сунајзначајнији домаћини за Q грозницу, посебно у току размножавања. Токомепидемија, C.burnetii је потврђена биолошким огледима, ЕЛИСА тестом,тестом микроимунофлуоресценције из узорака плацента, меке длаке коза имлека ових животиња.Анализа тренутне епидемиолошке ситуације је показала два главна типа(козе-овце и говеда) преношења инфекције међу стадима, као и повећануулогу животиња на индивидуалним фармама као извора C.burnetii.Неопходно је прављење активног програма епизоотиолошког мониторинга сауниформним приступом којег би спроводили специјалисти медицине иветеринарске медицине на територијама где долази до појаве Q грознице међустадима.Кључне речи: Q грозница, епидемиолошки и епизоотиолошки аспекти, козе,овцеПроф др Николај В. Рудаков, Истраживачки институт природножаришних инфекција у ОмскуРуске Федералне Агенције за права потрошача у Омску, rickettsia@mail.ru; Проф др А.ПКрасиков. Институт ветеринарске медицине и биотехнологије Државног пољопривредногуниверзитета у Омску П.А.Столyпин, Министарства Пољопривреде Руске Федерације 644080пројекат Мира Омск Руссиа,32

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕАNALYSIS OF APPEARANCE AND EPIZOOTIOLOGICAL SITUATION OFQ FEVER DISEASE FROM 1999-2012. IN THE REPUBLIKA SRPSKAMitrović Novalina, Marković T., Zelenović M.,Ivanić B., Muris BegagićAbstractQ fever is an infectious disease of animals and humans. In domestic and wild animalsoccurs as asymptomatic (latent infection) or causes miscarriages andbronchopneumonia. The disease is widespread in all five continents and had beendiagnosed in more than 60 countries, so far. Distribution intensity of human populationcoincides with the degree of infection in domestic animals, especially cattle, sheep andgoats, which are important reservoirs of C. burnetii. In the region of central Balkans andSouthern Russia disease was first described during World War II ("Balkan grippe"Imhauser in 1943., Caminopetros, 1948). The first case of Q fever in humans were inthe Western Balkans, described in 1947. in Croatia and then in other parts ofYugoslavia (Banat, Pirot, Sandzak, etc.). In animals first outbreak of enzootic diseasesform was described in 1952., in the southwestern part of the central Balkan (Sandzakregion, Travnik, Zenica, Bugojno and Prozor, Pirot). Since then till today, Q feveroccurs in larger or smaller outbreaks on the territory of central Balkans.Тoday кnown epidemiological and epizootiological data, related for most of the Balkanterritories and also Republic Srpska, do not show real situation of Q fever prevalence onthis territory. To this statement largely contributes latent form of infection in domesticanimals, because, unless abortions are expressed, veterinarians on the field does nothave reasons for suspicion on Q fever. A similar problem exists in the cases of human Qfever, which is often misdiagnosed due to non-specific clinical symptoms of disease andas such cured with longer antibiotic treatment.Key words: Q fever, diagnosis, serological methodMr Sci Novalina Mitrovic, specialist epizootiologies, DVM Teodor Markovic, DVM Mladen Zelenovic,DVM Boriša Ivanic, Veterinary Institute Ltd. "Teolab" KaraĊorĊeva bb., Dvorovi, Bijeljina; DVM MurisBegagić, Ltd."Bosnavet" ZenicaАНАЛИЗА ПОЈАВЕ И ЕПИЗОТИОЛООШКА СИТУАЦИЈА Q-ГРОЗНИЦЕОД 1999-2012 У РЕПУБЛИЦИ СРПСКОЈМитровић Новалина, Марковић Т., Зеленовић М., Иванић Б., Мурис БегагићКратак садржајQ-грозница је инфективна болест животиња и људи која код домаћих и дивљихживотиња пролази углавном асимптоматски (латентно) или изазива побачаје ибронхопнеумоније. Болест је распрострањена на свих 5 континената и досада једијагностикована у преко 60 земаља. Интензитет распрострањености код33

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYSстановништва поклапа се са степеном заражености домаћих животиња, нарочитоговеда, оваца и коза, које представљају значајне резервоаре за C. burnetii. Напросторима централног Балкана и Јужној Русији први пут је описана за време IIсветског рата (―Balkan grippe” Imhauser, 1943., Caminopetros, 1948.). Први случајQ-грознице код људи на просторима западног Балкана, описан је 1947. уХрватској a затим и у другим деловима СФРЈ ( (Банат, Пирот, Санџак и др.). Кодживотиња прва ензоотија болести описана је 1952., у југозападном делуцентралног Балкана (подручје Санџака, Травник, Зеница, Бугојно и Прозор,Пирот,). Од тада до данас Q грозница се у мањим или већим епизоотијама јављалана подручју централног Балкана.Познати епидемиолошки и епизоотиолошки подаци данас, везани за већи диотериторије Балкана па и Републике Српске не говоре о правој слици раширеностиQ-грознице на овој територији. Томе у великој мјери, доприноси и латентни обликинфекције код домаћих животиња који, осим у случајевима изражених побачаја,ветеринарима на терену не даје основ за сумњу да се ради о Q-грозници. Сличанпроблем је и у случајевима Q-грознице људи, гдје често услед неспецифичнихклиничких симптома обољење ―промакне‖ под другом дијагнозом и као таквобуде излијечено дужим антибиотским третманом.Кључне ријечи: Q грознице, дијагностика, серолошке методеМр sc Новалина Митровић, специјалиста епизоотиолог, др.вет.мед.Теодор Марковић, др вет. мед.Младен Зеленовић, др вет.мед. Бориша Иванић, Ветеринарски завод доо―Теолаб― Карађорђева ббДворови, Бијељина, др. вет. мед. Мурис Бегагић доо. „Боснавет― ЗеницаУводQ-грозница је инфективна болест животиња и људи која код домаћих и дивљихживотиња пролази углавном асимптоматски (латентно) или изазива побачаје ибронхопнеумоније. Узрочник болести је Coxiella burnetii. Клинички, Q грозницасе код људи манифестује грозницом као и пнеумонијом праћеном наглимнападима главобоље. Обично се јавља у акутном току, док се ређе јавља усубакутном и хроничном току са честим срчаним компликацијама.Болест је распрострањена у цијелом свијету, и досада је дијагностикована у преко60 земаља. Интензитет распрострањености код становништва поклапа се састепеном заражености домаћих животиња, нарочито говеда, оваца и коза, којепредстављају значајне резервоаре за C. burnetii.За разлику од представника из фамилије Rickettsiaceae где је до скора припадала,C. burnetii карактерише феномен фазне варијације. Coxiella burnetii је изразитиинтрацелуларни паразит. Једини је представник рикеција у коме су откривениплазмиди, што се доводи у везу са великом резистенцијом C. burnetii премаантибиотицима. У спољашњој средини у облику сличном спори, показује високуотпорност према исушивању, али и према високим температурама, ниској pHвриједности, антибиотицима и дезинфекционим средствима. Крпељи убодоминфицирају животињу, док је тај начин инфекције веома риједак код људи.Најчешћи вид инфекције код људи је удисањем ―аеросола‖ у коме се налазеузрочници и то најчешће у току контакта људи са животињама у току порођајаили побачаја, када се веома велики број узрочника излучује преко плаценте и34

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕплодових вода, али и преко урина и фецеса. Због честог изостанка клиничкихсимптома код животиња тешко је пратити појављивање Q-грознице. Када сепостави сумња о појављивању болести, једина поуздана дијагноза може сепоставити лаборатпријски. Важно је да се узму парни серуми, како би могли да сеоткрију појава и титар антитјела, а резултати сигурније повежу са датом болести.Од серолошких метода за дијагностиковање Q-грознице најчешће се користе:микроаглутинација (МА), реакција везивања комплемента (RVK, CFT),индиректна имунофлуоресценција (IFT), и имуноензимски тест (ELISA). Могу секористити још и: макроаглутинација (MAG), капиларна аглутинација (KA),пасивна (капиларна) хемаглутинација (PHA, IHA), прстенаста (ринг)преципитација (PP,RP), агар-гел имунопреципитација (AGIP), инхибицијахемолизе (IHT), имуноензимски-флуоресцентни тест (ELIFA), радиоимунолошкитест (RIA). У савременој лабораторијској дијагностици Q грознице важно местоприпада и моноклонским антителима (MAt) и техници електрофоретскихиспитивања антигена у полиакрил-амид гелу (SDS-PAGE).Циљ и задаци рада: На основу изнијетог а у складу са познатим епизоотиолошкоепидемиолошким подацима који прате проблематику Q грознице циљ радапредставља реалну потребу сагледавања опште епизоотиолошке ситуације иепизотиолошко-епидемиолошких карактеристика болести на подручју РепубликеСрпске.Материјал и методи рада Као материјал за рад коришћени су крвни серумиживотиња и људи оболелих или сумњивих на Q-грозницу; FITC антитела –антиовчија /IgG+IgM+IgA/ (INEP – Земун); ELISA китови (IDEXX LaboratorijesB.V.) и др. Као методи истраживања послужила су епизоотиолошка испитивања,патоморфолошки налаз, клиничка слика болести на терену и др. а одлабораторијских истраживања за испитивање присуства специфичних антитијелау крвним серумима животиња и људи коришени су реакција везања комплемента(RVK), ELISA тест и индиректна имунофлуоресценција (IFT). У оквируепизоотиолошких и епидемиолошких истраживања коришћени су и подаци изМинистарства за пољопривреду, шумарство и водопривреду Реп. Српске (БиХ)као и Министраства за здравље Реп. Српске.Резултати испитивања Резултати добијени током наших испитивањараширености Q грознице код оваца и говеда на територији Републике Српске упериоду 1999-2012 године приказани су у табели 1.Током периода 1999-2012.године претражено је укупно 45290 крвних серума,говеда и оваца са подручја 93 општина Републике Српске, при чему је Q грозницазабиљежена у 339 жаришта са 1349 оболелих јединки ( 271 говеда и 1078 оваца).Утврђена серопреваленца је износила 2,97%.Ако упоредимо 2001 годину гдје је серопреваленца износила 0,9% и 2011 годинусеропреваленца је износила 10,2% видљиво је да се знатно повећава број оболелихживотиња. У поменутим годинама (2001 и 2011) рађен је плански мониторинг доксе у осталим годинама реаговано тек по избијању болести када су спровођененаређене мјере.35

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYSТабела. 1. Приказ појаве Q грознице у РС у периоду 1999-2012 годинеГод.Бр.Бр.Говед Овц Бр.прегледан Говед Овцжаришта оболелих а е општина о серума а е1999 1 7 7 - карантин 7 7 -2000 - - - - - - - -2001 203 207 86 121 2422845 11964 108812002 9 11 - 11 3 596 5962003 22 184 69 115 29 10301 4489 58122004 3 3 3 -2(1 арантин) 1222 1222 -2005 6 9 3 6 5 2362 2000 3622006 22 83 - 83 4 946 - 9462007 6 11 2 9 3 542 7 5352008 4 11 2 9 4 824 211 6132009 1 2 2 - карантин 156- 156 -2010 24 287 28 259 3 287- 28 2592011 36 532 67 465 15 5200 1500 37002012 2 2 2 - 1 карантин 2 2Укупн45290 21584 2370339 1349 271 1078 93о6Картограм 1. Епизотиолошка слика Q грознице током 2001. године у Р.Српској(подаци Министарства пољопривреде РСрпске).Појава болести везано за сезону јагњења оваца и испашу животиња на примеру из2008. године указује да је највећи број испитаних био у марту и јуну (табела 2.,картограм 2) када је испитано је 824 крвна серума говеда и оваца, а болестрегистрована на територији општине Рудо, Бијељина и Сребреница. Такође,најчешће је био случај да су власници самоиницијативно тражили анализе или су36

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕузорковани серуми од грла у карантину (на основу Рјешења за увоз стоке). Уопштини Бијељина позитивне животиње су потицале из групе јединки из увоза(карантин).Табела 2.: Резултати прегледаних узорака на Q грозницу код говеда и оваца уРепублици Српској током 2008. годинеМјесецБр. ЕЛИСА тест РВК тест Врстаузорака Прегл. + Прегл. + животињеОпштинајануар 60 60 - - -Говеда(карантин)ШамацФебруар 32 32 - - -говеда(карантин)ШамацМарт 289 289 1 1 1 говеда РудоАприл 42 42 - - -говеда(карантин)ШамацМај 20 20 4 4 4овце(карантин)БијељинаЈун 304 304 5 5 5 овце СребреницаЈул 7 7 - - - говеда БијељинаАвгуст 26 26 - - - говеда БијељинаСептембар 5 5 - - - говеда БијељинаОктобар 16 16 - - - говеда СребреницаНовембар 1 1 - - - говеда СребреницаДецембар 33 33 1 1 1говеда(карантин)БијељинаУкупно 824 824 11 11 11 -Картограм 2. Пприсуство Q грознице код говеда и оваца у Републици Српскојтоком 2008. годинеПојава Q грознице код људи у Р.Српској у посматраном времену забележена јетоком периода 2002.- 2006. године када је дијагностиковано 27 оболелих.37

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYSЗабиљежена је стопа инциденције од 1,9% и процентуално учешће од 35,06% уукупном обољевању од антропозооноза. Општине гдје се болест појавила кодљуди су Бања Лука (Бронзани Мајдан) 11 обољелих и Шарговац 4 обољеле особе,Костајница (насеље Ужице) 5 оболелих, Рудо (Расићи и Гаочичи) 7 оболелих.Кретање морбидитета ове болести у петогодишњем периоду од 2002-2006 годинеприказујемо на графикону 1 .Графикон 1. Стопа инциденције кју грознице код људиу периоду од 2002-2006 године2520151052006-1,92005-2,12004-19,52003-0,52002-14,802002 2003 2004 2005 2006ЗакључциНа снову добијнеих резултата на епизоотиолошком подручју Р.Српске Q-грозницаје значајно присутна код говеда, оваца и људи и са мањим или већим интензитетмсе јавља скоро сваке годие. У периоду 1999-2012 године од испитаних 45290крвних серума животиња, присуство специфичних антитјела за C. burnetiiутврђено је код 1349 јединки. Општ епизоотиолошка и епидемиолошка слика Q-грознице у Реп. Српској указује на неопходно шире праћење болести на теренуали истовремено у оба ентитета БиХ (Р:Српској и Федерацији). Ово нарочито имана значају када се има у виду неконтролисани промет животиња на цијелојтериторији Републике. Неопходно је провести истраживања присуства узрочникакод вектора ко и неопходна је ближа сарадња здравственог и ветеринарскогсектораЛитература1. Andric B., Lausevic D., Lako B., Vucinic N., Dupanovic B., Terzic D., Draskovic N.(2005) Q Fever in human and veterinary pathology in Montenegro, The FirstSymposium of Zoonoses with internacional participation, Sarajevo, April 23th.,20052. Bajrović T.( 2005 )Cross reactivity during the serotesting of blood samples uponbrucellosis and Q-fever, The First Symposium of Zoonoses with internacionalparticipation, Sarajevo, April 23th.,20053. Bazlikova M., Brezina R., Schramek Š., Kovačova E., (1985): Phase variationphenomenon of Coxiella burnetii in ticks, In: Kazar J. (Ed): Rickettsiae and Rickettsialdiseases, VEDA, Bratislava, p. 150-155.38

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕ4. Berberović M., Prajninger B., Altabari G., (1990): Dijagnostiĉka vrijednost serološkohtestova RVK i MA pri otkrivanju latentno inficiranih stada ovaca Q-groznicom, Vet.glasnik 44, (2), p. 195-199.5. Crowther W.R., Spicer J.A., (1976): Abortion in sheep and goats in Cyprus caused byCoxiella burneti, The Veterinary Record, 99, p. 29-30.6. Čekanac R., Stajković N. ( 2005) Q- fever in Serbia, The First Symposium ofZoonoses with internacional participation, Sarajevo, April 23th.,20057. Daiter A.B., (1985): Ecology of Coxiella burnetii in relation to invertebrate host, In:Kazar J. (Ed): Rickettsiae and Rickettsial diseases, VEDA, Bratislava, p. 364-369.8. Đuričić Bosiljka, Laušević D., Radovanović D.,Mitrović Novalina, Marković D.,(2005 )Q Fever in animals in the regions around the river Drina, The First Symposium ofZoonoses with internacional participation, Sarajevo, April 23th.,20059. Fournier P.E., Marrie T.J., and Raoult D., (1998): Diagnosis of Q Fever, Journal ofClinical Microbiology, Vol. 36, 7, 1823-1834.10. Gimenez D.F., (1964): Staining rickettsiae in yolk-sac cultures, Stain Technal, 39, 125.11. Golubović S., Kubelka D., Šarić M., Đuričić Bosiljka (1999): Kliniĉka i nekaepidemiološko-epizootiološka zapaţanja o Q-groznici u okolini Banja Luke – Našaiskustva, Zbornik radova – I jugoslovenski epizootiološki dani, oktobar 1999., Ţabljak12. Heneberg Nada, Heneberg Đ., ĐorĎević D., Morelj M., Karlić P., (1971): IzolacijaCoxiellae burnetii od ţutogrlog miša i adultnih krpelja u jednom ţarištu Q-groznice,Vojnosanitetski Pregled, 28:4, p. 181-185.13. Kovačova E., Kazar J., Španelova D., (1996): Analisis of Antobody Response inHumans and Goats with the use Different Coxiella burnetii Antigenic Preperations, In:Rickettsiae and Rickettsial diseases, J. Kazar and R. Toman (Ed.), VEDA, Bratislava, p.463-468.14. Laušević D.,Vidić Branka,Đuričić Bosiljka, Šeguljev Zorica (1999): Q-groznica(Coxiellosis)- Eizootiološka situacija u Jugoslaviji, Zbornik radova - I jugoslovenskiepizootiološki dani, oktobar 1999, Ţabljak p.49-58.15. Laušević D.(2000): Ispitivanje prisustva Q-groznice kod ovaca na epizootiološkompodruĉju Crne Gore, magistarski rad, Beograd16. Maric Jelena., Santrac Violeta., M. Saric, B., Bjelajac, S. Golubovic, Z. Djeric, D.Kubelka (2005) Nomadic grazing of sheep and widespread epidemic of Q fever inRepublic of Srpska, The First Symposium of Zoonoses with internacionalparticipation, Sarajevo, April 23th.,200517. Samardzic S., Dasch G., Djuricic B., Lako B., Ristanovic E, Bozovic B., Vukov B.,Simovic T., Milic A., Eminovic M., Stajkovic N., Čekanac R. and Gligic A.(2005)Seroprevalence specific antibody to rickettsia in humans serum from different localityin Serbia, The First Symposium of Zoonoses with internacional participation, Sarajevo,April 23th.,200518. Vesenjak J., Spalatin J., Lovrić Š., Jamšek P., Vodička Lj., (1957): Epidemija Qgroznice na otoku Uljanu, Poseban otisak "Radovi Medicinskog fakulteta u Zagrebu",vol. III. p. 219-231.19. Vidić Branka, Đuričić Bosiljka, Šeguljev Zorica, Lako B.(1997): Q-groznicaepidemiološkoepizootiološka slika u SRJ, Zbornik radova 10. Savetovanje veterinaraSrbije, p. 21-28, Zlatibor39

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYSFIRST DETECTION OF SCHMALLENBERG VIRUS IN SLOVENIAToplak I, Cociancich V, Rihtariĉ D, Tomislav PAbstractsIn November 2011, Germany, France and the Netherlands reported the first occurrenceof clinical disease in sheep, cattle and goats caused by a novel Orthobunyavirus, namedSchmallenberg virus, which emerged in Europe. Schmallenberg virus infections wereidentified in January 2013 for the first time also in Slovenia as first country of theBalkan area. The first clinical case of Schmalenberg virus was reported from a flock ofsheep where nine aborted fetuses were recognized on farm with 23 sheep, later anotherthree bovine herds were identified as positive out of 20 suspicious cases. The majorityof malformed animals and stillbirth were diagnosed during necropsy with one or morepathological signs: brachygnathia, arthrogryposis, hydranecephaly, torticollis and brainmalformations. Viral nucleic acid of Schmallenberg virus was demonstrated in fouraffected herds by real-time RT-PCR (RT-qPCR) method, with a protocol developed byFriderich-Loeffler Institute, from the brain and spleen samples. The sequencing resultsof partial L segment confirmed, that detected strain in Slovenia is 100% identical tostrain named Schmallenberg virus, identified in Germany in 2011. The first detection ofvirus on our territory means, that a new viral disease has already spread to our farmsand that it may result in increased losses due to abortions in pregnant animals and lossesin neonatal lambs, calves and kids. According to previous observations, we can assume,that infections were already present in our herds in autumn 2012 and this new virus willbe probably detected also in other Balkan countries soon.Key words: Schmallenberg virus, detection, Slovenia* Toplak Ivan, PhD, DVM , Cociancich V, Rihtariĉ D., Tomislav P., University of Ljubljana, Veterinaryfaculty, National veterinary Institute, Gerbiĉeva 60, 1000 Ljubljana, SloveniaIntroductionSchmallenberg virus (SBV) is informal name of the new emerged virus first detected inautumn 2011 in Germany from cattle associated with milk drop, fever and diarrhoea(Beer et al., 2013). Later SBV infection was associated also with congenitalmalformations in lambs, calves and goat kids as a result of infection of mother duringvulnerable early stage of gestation (Hoffman et al., 2012). Since the first report SBVhave been continuously spreading to neighbouring countries and after more than oneyear SBV become endemic in north-west part of Europe (Elbers et al., 2012; Hoffman etal., 2012; Beer et al., 2013; Kaba et al., 2013). Data reports from the Netherlands andBelgium indicate that virus was easily spread between herds and reached seroprevalence80-90% in few months (Elbers et al., 2012; Garigliany et al., 2012 Bouwstra et al.,2013). From 15 European countries data for more than 6.000 infected herds wasavailable till the end of 2012 (EFSA, 2012). Detection of SBV in Culicoides (C.obsoletus complex, C. dewulfi and C. chiopterus) during the summer and early autumn40

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕin Belgium, Denmark and Poland by RT-qPCR strongly indicated that these species arerelevant vector for SBV and are probably involved in rapid disease transmission (DeRegge et al., 2013; Rasmussen et al., 2012; Larska et al., 2013). Infection of herd isconfirmed by virus detection or detection of antibodies (Beer et al., 2013; Mansfield etal., 2013). Comparative analysis of different organs and tissues suggests that cerebrum,cerebellum and brain steam are the most appropriate tissues for SBV detection by RTqPCR(Bilk et al., 2012; De Regge et al., 2013).The aim of this study was providing the results of first observation of clinical samplesof malformed fetuses and laboratory confirmation of SBV infection by RT-qPCR inSlovenia.Material and methods Samples were collected between January to February 2013 onthe basis of clinical suspicion of SBV made by famers or veterinarians. Samples werecollected and tested according to the state plan for SBV as recommended by TheAdministration of the Republic of Slovenia for Food Safety, Veterinary Sector and PlantProtection (AFSVSPP). Altogether 20 malformed calves and 2 malformed lambsoriginating from 17 different herds were included in the study. From 22 malformedanimals showing arthrogryposis-hydranencephaly syndrome tissue samples of thespleen and brain (cerebral cortex, brain stem and cerebellum) were collected and testedby RT-qPCR.In the laboratory 2 g of tissue samples (spleen, cerebral cortex, brain stem andcerebellum) from individual animal were homogenized as a pool. 22 tissuessupernatants were recovered and used for the extraction of total RNA using theQIAamp ® viral RNA mini kit (Qiagen, Germany) according to the manufacturer‘sinstructions. The primers and probes for the detection of SBV genome (L-segment) bythe RT-qPCR were previously designed and protocol was kindly provided by FLI,Germany (Hoffman et al., 2012). The protocol with minor changes was adapted to ourlaboratory conditions using single step with Superscript III Platinum ® One–Step RT-PCR kit with ROX (Invitrogen, USA).The positive sample from the first three SBV positive herds were directly sequencedfrom RT-PCR products in both directions using the Macrogen sequencing service(Macrogen, The Netherlands) and the RT-qPCR amplification primers to confirm thespecificity of the RT-PCR assay. For each sample, 144 nucleotide long sequences ofsegment L were aligned with the published data using BLAST (available athttp://www.ncbi.nlm.-nih.gov/) at the National Centre for Biotechnology Information(NCBI).ResultsFirst clinical cases were observed in December 2012 in ovine flock in municipalitySemiĉ located in south part of Slovenia (near Croatian border) and between January andFebruary additional 20 calves from 16 different cattle herds at were sent for necropsy,where various degree of deformities were observed: arthrogryposis, torticollis, scoliosis,brachygnataia, hydranencephaly, hypoplasia of the cerebrum, cerebellum and spinalcord. The first laboratory confirmed case by RT-qPCR in Slovenia was identified inJanuary 9 th 2013 from a flock with 23 sheep, where nine aborted fetuses were found(Figure 1). Later additional three bovine herds, located in central part of Slovenia, were41

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYSidentified SBV positive. RT-qPCR results showed that 4 (18,18%) of 22 examinedsamples were interpreted as SBV genome positive according to detected Ct values. Thepositive samples were detected with Ct values between 26,45 to 36,37 (Table 1).The sequencing results confirmed, that detected strain in Slovenia shows 100%homology in 144 determined nucleotides (partial L segment, genome position 379-522)with strain named Schmallenberg virus, identified in Germany in 2011 (GenBank Acc.No. JX853179).Table 1: Total number of SBV positive animals detected by RT-qPCR between Januaryand February 2013 with location of herds, detected Ct value and description of observedmalformations during necropsy.The meaning of abbreviations in table; ART: arthrogryposis, BRA: brachygnathia,TOR: toticollis, SCO: scoliosis, HYD: hydranencephaly, HYP: cerebellar hypoplasia,ABO: abortusName ofsample111-1/2013111-2/2013641/20131360/20131580/2013Date ofsampling MunicipalityCtvalueART.BRA.TOR.SCO.HYD.HYP.ABO.04 January2013 Semiĉ 26,48 X X04 January2013 Semiĉ 27,07 X X30 January2013 Kamnik 36,67 X X X X19 February2013 Komenda 34,23 X X X22 February Gorenja vas-2013 Poljane 35,31 X X X X42

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕFigure 1: The result obtained from first SBV positive case detected by RT-qPCR fromtwo lambs on February 9 th 2013 in Slovenia; blue curve (positive lamb 1), gray curve(positive lamb 2), orange curve (positive control).Figure 2: Map of Europe, where SBV infections were already confirmed.DiscussionOur study demonstrates the detection of SBV genome for the first time from clinicallyaffected ruminants in Slovenia. The officially first detection of SBV genome in twomalformed lambs was in January 9 th 2013 from ovine flock located in Semiĉ nearCroatian border in the south part of Slovenia, but later SBV has been detected in calvedcollected from additional three cattle farms located in central part of Slovenia.Malformations found in detected SBV positive cases in aborted and stillborn animalswere similar as those described in lambs and calves in other European countries(Germany, France, Belgium) and correspond to the fact that causative agent is identicalas well. The rapid and wide expansion of SBV is probably the result of transmission byvectors in direction of south during summer time since first SBV antibodies weredetected in September 2012 in neighbouring country Austria (Schiefer et al., 2013).Previous reports showed that the acute infection with SBV in adult animals causes mildor unspecific clinical signs in ruminants (Hoffmann et al., 2012; Beer et al., 2013) thusit will be not surprising that this first stage of SBV infection was already in autumn2012 and was not recognised by our farmers and veterinarians. At the end of December2012 and in January 2013 the number of reports of devastating malformations in newbornsincreased and samples from different locations were sent to laboratory. Themonth of first detection of malformed foetuses and rapid spreading of disease throughthe country with one year delay in Slovenia is very similar to the reports from Germany,The Netherlands, Belgium and France in autumn 2011 and at the beginning of 2012(Hoffmann et al., 2012; Bouwstra et al., 2013 Bilk et al., 2013). The detection of SBVoutbreaks in new areas of Europe in 2012 such as Sweden, Norway, Finland, Estonia,Switzerland, Poland, Austria and now in Slovenia suggests tendency of spreading of the43

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYSinfection to new areas with naïve population (Figure 2). Our results support the previousobservations that the presence of SBV RNA could be detected only in part of SBVsuspected newborns, because of SBV clearance after infection of fetus (De Regge et al.,2013). Some authors suggested to use additional tests for antibody detection inmalformed animals, such as virus neutralization test (VNT) or ELISA test to increasethe reliability of SBV diagnosis (Mansfield et al., 2013). This observation suggests thatin addition to confirmed SBV positive cases there were malformed calves that were theresult of infection with SBV, but were diagnosed as false negative by RT-qPCR in ourlaboratory.Slovenia is the first SBV infected country near Balkan area and because continuousspreading of infection in Europe we may expect that this new virus will be probablydetected soon in other Balkan countries.AcknowledgmentsSamples were collected and examinations partially financed on behalf of the statemonitoring program for detection of SBV provided by The Administration of theRepublic of Slovenia for Food Safety, Veterinary Sector and Plant Protection(AFSVSPP). This research was financially supported also by the Slovenian ResearchAgency; program group P4-0092 (Animal health, environment and food safety). Specialthanks to Bernard Hoffmann and Martin Beer from FLI, Germany, for providingprotocols and SBV positive control.References1. Beer M, Contraths FJ, van der Poel WH. ''Schmallenberg virus''- a novelorthobunyavirus emerging in Europe. Epidemiol Infect 2013; 141: 1-8.2. Bilk S, Schulze C, Fischer M, Beer M, Hlinak A, Hoffamann B. Organ distribution ofSchmallenberg virus RNA in malformed newborns. Veterinary Micobiol 2012; 159:236-238.3. Bouwstra RJ, Kooi EA, de Kluijver EP, et al. Schmallenberg virus outbreak in theNetherlands: Routine diagnostics and test results. Veterinary Micobiol 2013, in press.4. De Regge N, Deblauwe I, De Deken R, et al. Detection of Schmallenberg virus indifferent Culicoides spp. by real-time RT-PCR. Transbound Emerg Dis 2012; 59: 471-475.5. De Regge N, van den Berg T, Georges L, Cay B. Diagnosis of Schmallneberg virus inmalformed lambs and calves and first indications for virus clearance in the fetus.Veterinary Micobiol 2013; 162: 595-600.6. Elbers ARW, Loeffen WLA, Quak S, et al. Seroprevalence of Schmallenberg virusantibodies among dairy cattle, the Netherlands, Winter 2011-2012. Emerg. Infect. Dis.2012, 18, 1065-1071.7. European Food Safety Authority (EFSA). Schmallenberg virus: analysis of theepidemiological data and assessment of impact. Eurosuveill 2012; 10: 2768.8. Garigliany MM, Bayrou C, Kleinen D, Cassart D, Desmecht D. Schmallenberg virus indomestic cattle, Belgium, 2012. Emerg Infect Dis 2012; 18: 1512-1514.9. Hoffmann B, Scheuch M, Hoper D, et al., Novel Ortobunyavirus in Cattle in Europe,2011. Emerg Infect Dis 2012; 18: 469-472.10. Kaba J, Czopowicz M, Witkowski L. Schmallenberg Virus Antibodies Detected inPoland. Transbound Emerg Dis 2013; 60: 1-3.44

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕ11. Larska M, Polak MP, Grochowska M, Lechowski L, Zwiazek JS, Zmudzinski JF. Firstreport of Schmallenberg Virus Infection in Cattle and Midges in Poland. TransboundEmerg Dis 2013; 60: 97-101.12. Mansfield KL, La Rocca SA, Khatri M, Johnson N, Steinbah F, Fooks AR. Detection ofSchmallenberg virus serum neutralising antibodies. J Virol Meth 2013; 188: 139-144.13. Rasmussen LD, Kristensen B, Kirkeby C, et al. Culicoids as vectors of Schmallenbergvirus. Emerg Infect Dis 2012; 18: 1204-1206.14. Schiefer P, Steinring A, Wodak E, Schmoll F. Rapid spread of Schmallenberg virus inAustrian domestic ruminants. International meeting on Emerging Diseases andSurveillance 2013, pp. 184.ПРВА ДЕТЕКЦИЈА SCHMALLENBERG ВИРУСА У СЛОВЕНИЈИToplak I., Cociancich V., Rihtariĉ D., Tomislav P.Кратак садржајУ новембру 2011, Немачка, Француска и Холандија су пријавиле прве клиничкеслучајеве обољења код оваца, говеда и коза изазване вирусом из фамилијеOrthobunyavirus, под називом Schmallenberg вирус, која се појавио у Европи.Schmallenberg вирусна инфекција је идентификована у јануару 2013, по први пут,такође и у Словенији, као првој земљи у региону Балкана. Први клинички случајSchmallenberg вируса је пријављен у стаду оваца, у коме је код девет побаченихфетуса детектован вирус на фарми са 23 оваца, касније још три стада говеда суидентификована као позитивна од укупно 20 сумњивих случајева. Већинаживотиња је била наказна и мртворођена, а током аутопсије дијагностиковани суједан или више патолошких знакова: брахигнација, артрогрипоза, хидроцефалус,тортиколис, малформације мозга и увећан тимус. Нуклеинска киселинаSchmallenberg вируса је доказана РТ-ПЦР методом у узорцима из мозга и слезинекод четири погођених крда, према протоколу који је развијен од стране Фридрих-Лефлеровог института. Редослед секвенци Л сегмента нуклеинске киселинепотврдио је да је откривени сој вируса у Словенији 100% идентичанSchmallenberg вирусу идентификованом у Немачкој 2011.године. Прво открићеSchmallenberg вируса на нашој територији значи да се нова вирусна инфекција већпроширила на нашим фармама и да може довести до повећања губитака збогабортуса гравидних животиња и губитака неонаталних јагњади и телади. Премадосадашњим посматрањима, можемо претпоставити, да је инфекција већ билаприсутна у нашим стадима у јесен 2012, и да ће овај нови вирус вероватно ускоробити откривен и у другим балканским земљама.Кључне речи: Schmallenberg вирус, прва детекција, РТ-ПЦР метод* Др вет. мед. Toplak Ivan, Цоцианцицх В, Рихтарич Д, Томислав П., Ветеринарски факултет,Национални ветеринарски институт, Универзитет у Љубљани, Гербичева 60, 1000 Љубљана,Словенија45

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYSCRIMEAN HEMORRHAGIC FEVER CONGO - ECOLOGY OF VIRUSŠekler M. *AbstractCrimean-Congo Hemorrhagic Fever (CCHF) is a contagious viral infectious disease,registrated in 40 countries on а 3 continents. Of the all viral zoonosis transmitted byticks, CCHF has the largest geographic spread, and that refers also to the geographicdistribution of ticks of the genus Hyalomma.Crimean-Congo haemorrhagic fever was first described in the 12th century, on theterritory of Tajikistan, and the first description of CCHF, wich was accompanied byviral isolation, occurred in 1944., when from the hemorrhagic fever get illed a numerouslocal people and Russian soldiers, who were in the peninsula of Crimea.Epidemiological study in patients revealed a high degree of frequency of tick bites.Epidemics that have subsequently appeared in the USSR and Bulgaria, were the resultof conducted socio-economic measures (re-distribution of large landholdings), andabrupt changes in the crop and livestock production.Way back in 1956. a boy got sick and died from viral haemorrhagic fever, which wasfollowed up by previous tick bite, in the field of the city Kisangani (state Congo).During 1965. the epidemic of CCHF occurs in China, with a mortality rate of about80%. In 1969. it was found that the viruses that were isolated in the Crimea, as well asthose in the Congo, were identical, and since then, this contagious disease got nameCrimean-Congo haemorrhagic fever. Since the 1970s. the CCHF occur regularly in theUSSR (Crimea, Astrakhan, Rostov, Uzbekistan, Kazakhstan, Tajikistan), followed byBulgaria, Congo and Uganda. At the begining of the eighties, the disease also occurredin South Africa, Mauritania, Burkina Faso, Tanzania, Senegal, Kenya, Iraq, the UnitedArab Emirates, Saudi Arabia, Oman, Pakistan and China.When we talk about our country (territory of the former Yugoslavia), CCHF was firstdiscovered in Serbia in 1954. (Kosovo and Metohija) and in 1973. from 2 ticks(Hyalomma plumbeum plumbeum and Ixodes ricinus) from Macedonia (near Tetovo)were isolated three strains of CCHF virus (Ćiflik 1.6 and 11). Since that time, thedisease occurs almost every year in the Balkan, with a number of cases thatapproximately match the number of infected ticks. In Serbia, the CCHF usually occursnear Klina and Peć (Kosovo and Metohija) and in the region of Zajeĉar. During the2012. CCHF occurred in Iran, India, Kosovo and Turkey. In October 2012. case wasreported in the UK, with one returnee from Afghanistan.Key words: CCHF, Hyalomma plumbeum plumbeum, Ixodes ricinusDr Milanko Šekler PhD, Veterinary Institute „Kraljevo―, Kraljevo, Zicka 37,milankosekler@yahoo.com46

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕКРИМСКА-КОНГО ХЕМОРАГИЧНА ГРОЗНИЦА - ЕКОЛОГИЈА ВИРУСАШеклер М.Кратак садржајКримска-Конго хеморагична грозница (ККХГ) је контагиозна преносива вирусназаразна болест, о чијој појави до сада постоји регистрација у око 40 земаља светана 3 континента. Од свих вирусних зооноза које преносе крпељи, ККХГ иманајвећу географску распрострањеност, за коју се може рећи, да у суштинипредставља географску дистрибуцију крпеља рода Hyalomma.Кримска-Конго хеморагична грозница је по први пут описана у 12 веку, напросторима данашњег Таџикистана, a први опис ККХГ, који је био праћен ивирусном изолацијом узрочника се десио 1944. године, када је од хеморагичнегрознице оболео велики број локалног становништва и руских војника, који су сезатекли у области полуострва Крима. Епидемиолошко испитивање је кодоболелих открило висок степен учесталости убода крпеља. Епидемије које су сепоследично јавиле у СССР-у и Бугарској, су биле последица спроведених социоекономскихмера (поновна расподела великих земљишних поседа), као и наглапромена у процесима ратарске и сточарске производње.Давне 1956. године, дечак се разболео и умро од вирусне хеморагичне грознице,која је била праћена предходним убодом крпеља, у области града Кисангани(држава Конго). У току 1965. године се јавља епидемија ККХГ у Кини, саморталитетом од око 80%. Године 1969. је установљено да су вируси који суизоловани на Криму, као и они у Конгу, били идентични, па се од тада ова заразнаболест назива Кримска- Конго хеморагична грозница. Од 1970. године ККХГ сеучестало јављала у СССР-у (Крим, Астракхан, Ростов, Узбекистан, Казахстан,Таџикистан), затим у Бугарској, Конгу и Уганди. На прелазу у осамдесете годинеХХ века, болест се јавила и у Јужној Африци, Мауританији, Буркина Фасо,Танзанији, Сенегалу, Кенији, Ираку, Уједињеним Арапским Емиратима,Саудијској Арабији, Оману, пакистану и Кини.Када говоримо о нашим просторима (подручију бивше Југославије), ККХГ је првипут откривена у Србији 1954. године (Косово и Метохија), a 1973. г. из 2 крпеља(Hyalomma plumbeum plumbeum и Ixodes ricinus) са подручја Македоније (околинаТетова) изоловали три соја вируса ККХГ (Ћифлик 1,6 и 11). Од тог времена, оваболест се јавља скоро сваке године на подручју Балкана, са бројем који углавномодговара броју инфицираних крпеља. У Србији се ККХГ најчешће јавља уоколини Клине и Пећи (Косово и Метохија) и у региону Зајечара. Током 2012.,ККХГ се јавила у Ирану, Индији, Косову и Метохији и Турској. Током октобра2012. јавио се случај ККХГ и у Великој Британији, код једног повратника изАвганистана.Кључне речи: ККХГ, Hyalomma plumbeum plumbeum, Ixodes ricinusДр Миланко Шеклер, Ветеринарски специјалистички институт "Краљево", Краљево;Жичка37, milankosekler@yahoo.com47

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYSУвод - Кримска-Конго хеморагична грозница (ККХГ) је контагиозна преносивавирусна заразна болест, о чијој појави до сада постоји регистрација у око 40земаља света, на 3 континента. Од свих вирусних зооноза које преносе крпељи,ККХГ има највећу географску распрострањеност, за коју се може рећи, да усуштини представља географску дистрибуцију крпеља рода Hyalomma.Кримска-Конго хеморагична грозница је по први пут описана у 12 веку, напросторима данашњег Таџикистана, када непознати лекар примећује и описујехеморагичну заразну болест људи, која укључује појаву крви у мокраћи, ректумуи садржају повраћања, и то код особа које су убадали крпељи, који се каопаразити често налазе код птица, врста кос или дрозд (Anonymus, 2010).Први опис ККХГ, који је био праћен и вирусном изолацијом узрочника се десио1944. године, када је од хеморагичне грознице оболео велики број локалногстановништва и руских војника, који су се затекли у области полуострва Крима.Епидемиолошко испитивање је код оболелих открило висок степен учесталостиубода крпеља. Епидемије које су се последично јавиле у СССР-у и Бугарској, субиле последица спроведених социо-економских мера (поновна расподела великихземљишних поседа), као и нагла промена у процесима ратарске и сточарскепроизводње. Такве промене у начину коришћења земљишта су често доводиле допоремећаја равнотеже у екосистему, који је за последицу имао изненаднуекспанзију у броју и врстама животиња које су могле служити као домаћини, асамим тим и до нагле екпанзије броја и популације паразита-вектора, који живе нањима. Давне 1956. године, дечак се разболео и умро од вирусне хеморагичнегрознице, која је била праћена предходним убодом крпеља, у области градаКисангани (држава Конго). У току 1965. године се јавља епидемија ККХГ у Кини,са морталитетом од око 80%. Године 1969. је установљено да су вируси који суизоловани на Криму, као и они у Конгу, били идентични, па се од тада ова заразнаболест назива Кримска- Конго хеморагична грозница. Од 1970. године ККХГ сеучестало јављала у СССР-у (Крим, Астракхан, Ростов, Узбекистан, Казахстан,Таџикистан), затим у Бугарској, Конгу и Уганди. На прелазу у осамдесете годинеХХ века, болест се јавила и у Јужној Африци, Мауританији, Буркина Фасо,Танзанији, Сенегалу, Кенији, Ираку, Уједињеним Арапским Емиратима,Саудијској Арабији, Оману, пакистану и Кини.Када говоримо о нашим просторима (подручију бивше Југославије), ККХГ је првипут откривена у Србији 1954. године (Косово и Метохија, Хенеберг, Ана Глигићи сар.1977.). Исти аутори су 1973. г. из 2 крпеља (Hyalomma plumbeum plumbeum иIxodes ricinus) са подручја Македоније (околина Тетова) изоловали три соја вирусаККХГ (Ћифлик 1,6 и 11) (Ана Глигић и сар.1977., Милутиновић Марија 2003.). Одтог времена, ова болест се јавља скоро сваке године на подручју Балкана, сабројем који углавном одговара броју инфицираних крпеља. У Србији се ККХГнајчешће јавља у околико Клине и Пећи (Косово и Метохија) и у регионуЗајечара. Током 2001. забележени су нови случајеви болести у Албанији и наКосову и Метохији, а почетком 2002., болест се поново јавила и у Јужној Африции Пакистану. Током наредних година ККХГ је поново у Намибији, Судану,Украјини, Ирану и Турској, при чему се у Ирану и Турској, као по правилу, јављаса стотинама оболелих скоро сваке године. Слична слика је и на Косову и48

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕМетохији и Бугарској где се болест скоро редовно јавља сваке године у задњих 15година, са повећањем броја случајева у 2008. и 2009. години, да би 2010. већ било70 случајева хоспитализације (од тога 4 умрла). У јуну 2008. године забележен јепрви клинички случај ККХГ у Грчкој. Током 2012., ККХГ се јавила у Ирану,Индији, Косову и Метохији и Турској. Током октобра 2012. јавио се случај ККХГи у Великој Британији, код једног повратника из Авганистана.Циљ рада је да указе на екологију вируса ККХГ, као и основне карактеристикеове болести, при чему ће посебно бити наглашена и обрађена она научна сазнањакоја кроз изнете податке указују на све до сада познате и могуће развојеспецифичних и комплексних односа између вируса и животне средине, истих,сличних или врло различитих географских подручија. Ти односи између вируса испољне средине, најчешће се одвијају кроз већ постојеће различите типовебиоценозе, а које се услед утицаја разних фактора, знају и да убрзано и трајномењају, и неретко креирају повећану могућност ширења вируса, како на новедомаћине, резервоаре, тако и на човека.Материјал и методе - У намери да што приступачније и једноставније изнесемонајновије податке о ККХГ, користићемо по нама такав облик изношењанајновијих научних чињеница и претпоставки, уз такву дидактичку поделуматеријала, да он буде лако приступачан и у таквом облику, и складу са изнетим ипостављеним циљем и задацима овог рада.Питања која ће у виду поднаслова дати заокружене и потпуне целине су следећа:етиологија (о номенклатури вируса, његовој морфологији и репликацији),патогенеза, епидемиологија (географска распрострањеност, домаћини,резервоари, начини преношења, вектори, начини уношења вируса у векторе,фактори који утичу на ширење вируса, спољна средина), клинички знаци,патологија (код људи, код животиња), дијагнози, превентива и контрола.Етиологија - Вирус ККХГ-е је члан рода Nairovirus који припада фамилијиBunyaviridae у коју улазе још 4 рода вируса и то: Orthobunyavirus, Hantavirus,Phlebovirus и Tospovirus.У оквиру рода Nairovirusa, налази се 34 различите врстевируса, који су подељени у 7 серогрупа. У оквиру ових група, најважнија је групаККХГ (обухвата вирусе ККХГ и Hazara вирусе) и група Nairobi заразних болести(обухвата вирусе Nairobi заразне болести и Dugbe вирус); у оквиру родаNairovirusa: вирус ККХГ, вирус Nairobi болести и Dugbe вирус су патогени зачовека. Сви вируси овог рода се преносе преко крпеља (из два рода Argasidae илиIxodae). Свакако најзначајнији за здравље људи је управо вирус ККХГ.У почеткусу сви изолати вируса ККХГ, пореклом из разних региона света, били подељени у8 главних група (clade), са ставом да их није могуће антигено разликовати.Развојем биомолекуларних техника, било је могуће доказати значајне генетскеразлике. Тако су вируси на следећи начин сврстани у 8 група:‣ Clada 1: вируси из југозападне Русије, Турске и југозападне Србије(Косово и Метохија).‣ Сlada 2: вируси из Европе и југоисточне Русије.49

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYS50‣ Klada 3: изолати из централне Азије, посебно Казахстана, Таџикистана,Узбекистана и западне Кине.‣ Сlada 4: вируси из Ирана, Пакистана и са Мадагаскара.‣ Сlada 5: вируси из Сенегала, Мауританије, Јужне Африке и Ирана‣ Сlada 6: има само један изолат нађен у Грчкој и означен са иницијалимаAP92. Изолован је из крпеља рода Rhipicephalus bursa, а не из родаHyalomma.(Нешто већа генетска разлика између овог изолата вируса и осталихизолата вируса (из других клада) је последица другог вектора и области укојој је вирус детектован: географски изолована област (на граници саБугарском) окружена планинама од 2500 метара надморске висине, која јеспречила процес генетског мешања у многим врстама током дужегвремена.)‣ Сlada 7: вируси из Нигера и Централноафричке Републике‣ Сlada 8: чине је само вируси изоловани из Уганде.Морфологија вируса и његова репликација - Вирус ККХГ има двострукилипидни омотач (envelope), који је пореклом од липида ћелије домаћина идебљине је 5-7 нм, сферичног је облика и дијаметра између 90 и 120 нм. Вирусима 4 структурна протеина: 2 гликопротеина омотача (енвелопе) и то GN i GC(кодира их сегмент M), један нуклеокапсидни протеин означен као N (кодира гасегмент S) и једну RNK зависну RNK полимеразу или протеин L (кодира гасегмент L). Вирусна RNK је једноланчана, са негативним поларитетом и подељенаје на 3 сегмента, и то: L-велики, M-средњи и S-мали. Нема много података остабилности и резистенцији вируса ККХГ-е. као и сви вируси са омотачем, и овајвирус је осетљив на раствараче липида и уништава га ниска концентрацијаформалина и бета-пропиолактона. У људском ткиву након смрти није нималорезистентан. Доказано је да се инфективност у узорцима пацијента, у серумуможе сачувати неколико дана, ако се чувају на собној температури. Вирус ККХГсе инактивише на 100 C и аутоклавирањем; умножава се у многим примарнимкултурма и ћелијским линијама као што су: VERO, CER и BHK, којом приликомсе не умножава у високом титру и изазива слаб цитопатогени ефекат, па се вируститрира најчешће преко имунофлуоресценције или преко интрацеребралнеинокулације у новорођеним мишевима.Патогенеза - Процес патогенезе ККХГ није у потпуности познат. Као и другевирусне заразне болести које се преносе преко артропода, вирус ККХГ се првоумножава на месту уношења (инокулације) и потом се шири кроз крвни и лимфнисистем органа, посебно јетре (преферирајуће место репликације вируса). Ћелијскиелементи најснажаније захваћени инфективним процесима су мононуклеарнифагоцити и ендотелијалне ћелије.Епидемиологија - Област географске дистрибуције ККХГ је највећа од свихвирусних зооноза које преносе крпељи. Болест је присутна у 38 земаља Африке,Европе и Азије. Испитивања изведена на хуманим и анималним серумима судетектовала специфична антитела против вируса ККХГ у неким земљама Западне

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕЕвропе (Француска, Грчка, Португал и Мађарска), Африке (Египат и Бенин) иАзија (Индија и Турска), али болест никада није откривена у Италији. Код већинеевроазијских и афричких земаља, циркулација вируса је била детектована прекоad hoc лабораторијских испитивања пре него преко препознавања и регистровањаклиничких облика ове болести. Географска дистрибуција вируса ККХГ-е сеуглавном преклапа са дистрибуцијом крпеља рода Hyalomma.Резервоари/кичмењаци домаћини - Вирус ККХГ је изолован из бројнихдомаћих и дивљих животиња укључујући говеда, овце и козе, зечеве, јежеве,мишеве и псе. Специфична антитела против вируса ККХГ су детектована у крвиследећих врстс: говеда, еквиди, овцаца и коза, свиња, глодара, слепи мишева,жирафе и носорога, пореклом из разних региона Европе, Азије и Африке.Специфична антитела су нађена чак и код корњаче у Таџикистану. Птице сууглавном отпорне на инфекцију, тако да приликом експерименталне инфекције,птице нису развијале никакве симптоме болести, као ни антитела, нити антиген укрви.И поред чињенице да птице не развијају виремију, оне се сматрајунајважнијим носиоцем ширења вируса у природи, обзиром да су оне примарнидомаћин незрелих облика крпеља групе која приапда врстама сличним Hyalommamarginatum, који се сврставају међу главне векторе за вирус ККХГ. Миграцијаптица омогућава незрелим формама крпеља, који могу бити инфициранитрансоваријалним преношењем које се одиграло још у ларвеном стадијуму, даколонизирају и шире се једностасвним одбацивањем у новим далекимгеографским областима. Нојеви који су експерименатлно инфицирани субкутаноразвијали су виремију после 1-4 дана, а од 5 дана је вирус могао бити изолован изцрева. У два одвојена случаја у Јужној Африци је дошло до инфицирања људи, ито месара и фармера, који су били у контакту са месом инфицираних нојева,односно инфицираним нојевима, при чему је до инфекције дошло контактом саинфицираном крвљу или уједом инфицираних крпеља приликом драња коже, илинеге нојева. Домаћини код којих вирус ККХГ изазива болест су људи,лабораторијски мишеви, пацови и Сиријски заморци. Ширење ККХГ јеиндиректно, преко крпеља, али и директним контактом са крвљу виремичнихживотиња и људи. Крпељи као вектори – вирус ККХГ. Вирус ККХГ је изолованиз преко 30 врста крпеља и код 1 врсте хематофагних инсеката (Culicoides spp.).Главни вектори су Ixodиdae-крпељи рода Hyalomma: H.margиnatum; H. anatolиcumи H.truncatum. Присуство и густина крпељских врста, зависи од њиховеспособности да се адаптирају на околну спољну средину, погодности за незрелеформе крпеља да се шире у датој природној средини, кроз кретање и миграцијуптица, као и присуства домаћина за одрасле облике.Начин преношења у векторима - Неке врсте из фамилије Ixodidae, посебноHyalomma marginatum, Rhipicephalus rossicus и Dermacentor margиnatus, имајунеке карактеристике које од њих стварају добре векторе и резервоаре заразнеболести: -- Велики капацитет да покупе вирус преко само једног оброка узетог на виремичнојживотињи;- Директни пренос вируса од незреле форме крпеља на јаја ларве-нимфе-адултне развојнефазе, који се потом преноси уједом и на секундарног домаћина (трансстадијалнопреношење);51

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYS- Способност да пренесу вирус од инфициране мајке на њена јаја (трансоваријанопреношење);- Способност преношења вируса са инфицираних крпеља на здраве крпеље у процесухрањења на истој животињи (цофеединг);- Способност да пренесу вирус са инфицираног мужјака на здраву женку за време парења;- Фактори који утичу на ширење болести (животна средина, социолошки итд.)Сезонске разлике у активности вектора значе да појављивање преносивихзаразних болести зависи од великог броја варијација у неким климатскимпараметрима (пре свега температуре и влажности), као и општих климатскихпромена. Поред климатских фактора, промене у коришћену земље, као што сунапуштање или реконверзација пољопривредних површина може нарушитиравнотежу екосистема. Ово може индиректно повећати активност и густинуартропода и њихових главних домаћина, као што је био случај на Криму 1944.године и у Турској 2002. године. Епизоотиолошко-епидемиолошки, само људи иноворођени мишеви показују озбиљне знаке болести и умиру, то јест угињавају одове болести. Друге животиње, укључујући и пацове, могу бити инфициране безикаквих клиничких знакова болести, показујући само пролазну виремију.Пролазна виремија се може јавити и код говеда и оваца. Виремичне животиње(максимално до 1 недеље траје) изгледају клинички здраво, и представљајувелики ризик за људе који долазе у контакт са инфицираном крвљу у овомпериоду, док обављају своје професионалне дужности, као што су: обезрожавање,кастрације, обележавање ушним маркицама, клање или узимање узорака крви.Методе које се користе у дијагностици ККХГ су - изолација вирусаинтракранијалном или интраперитонеалном инокулацијом новорођених мишева,идеално узетим узорком крви код акутне фазе болести или хомогенизованогкрпеља. Узорак може бити и крвна плазма, делови органа добијени биопсијом илиаутопсијом, и то јетра, плућа, слезина, коштана срж, мозак или бубрези, при чемуузорак мора бити узет најкасније 11 часова након смрти; Електронскамикроскопија омогућава детекцију за свега 3-5 часова, али мора бити коришћенасамо у BSL-4 новоу биосигурности; -имунофлуоресценција са специфичниммоноклонским антителима.Диференцијална дијагноза увек мора узети у разматрање: рикециозу, ерлихиозу,лептоспирозу, Лајсмку болест, Q грозницу, као и инфекције које изазивајухеморагичне болести (менингококалне инфекције, Хантавирусну хеморагичнугрозницу, маларију, жуту грозницу, денга грозницу, Омску хеморагичнугрозницу, мајмунску грозницу, грозницу долине Рифт), Еболу и Марбург болест.Превентива и контрола - Популације људи које су најугроженије од ККХГ суоне које живе у областима, где је забележено присуство крпеља из фамилијеHyalomma а највшем степену ризика су изложене оне особе чији рад и активностису везане за боравак у ендемичним областима, или долазе у контакт саинфицираним животињама или људском крвљу и органима, (фармери, ловци,путници, излетници, истраживачи, медицинско особље, месари и ветеринари). Ускоријим епидемијама у Турској, фармери и локално становништво су чинилискоро 90% свих пријављених случајева појаве болести код људи. Најважнијифактори ризика су везани за контакте са крвљу и органима виремичних животињаи крпељима (месари и ветеринари се заражавају за време клања, месари токомпроцеса скидања коже-невољно гњечење крпеља са скривене стране коже и52

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕискрварења, а ветеринари током прегледа). У оваквим случајевима је потребноувести забрану клања животиња инфестираних крпељима, то јест ослободити истекрпеља најмање 14 дана пре клања. Месо закланих животиња не поседује никакавризик по јавно здравље (вирус у њему веома брзо инактивише). Преношењеболести преко ваздуха је забележено само као сумња у многим случајевима уРусији, док је у Турској било и појава инфекције дојењем, мада се зна да је могућеи директно преношење са мајке на дете. Контрола популације крпеља у областимагде је болест ендемична, или где је висока густина популација потенцијалнихдомаћина крпеља је један од могућих начина смањења ризика од инфекције иприсуства вируса ККХГ. Ветеринарске технике које могу бити примењене суследеће:-третман стоке акарицидима, -биолошка контрола (паразитима илигљивицама), -промена природне средине, -употреба мамака (феромони +акарициди). Биолошка контрола популације крпеља укључује предаторе крпеља,њихове паразите или патогене. Неке врсте ентомопатогених гљивица(Metharhizium anisopliae i Beauveria bassianis), дају добре резултате, а испитује сеи могућа употреба неких нематода као биолошких вектора такође. БактеријаBacillus thuringinesis, која је патогена за многе инсекте, се препоручује вероватнои за све крпеље. Неке Афричке птице (Buphagus erythrorhynchus i Buphagusafricanus) се хране крпељима на кожи папкара и битно умањују популацијукрпеља.Крпељи су високо зависни од екосистема у коме живе, што се огледа у односудомаћин-паразит (многи крпељи требају 2-3 домаћина да би комплетиралиразвој), локалном микроклимату и одређеном типу вегетације.Прогнозирајуће епидемиолошке студије које користе географске информационесистеме (GIS) и даљинско очитавање (Remote Sensиng(RS)) у анализи климе иподатака који се односе на окружење или животну средину, могу да одреде ризикод појаве и ширења ККХГ у одређеној области света. Прогнозе се могу односити,како на ендемичне области, али и на области тренутно слободне од ове болести.Ова техника омогућава да вирусна активност буде процењена у некој области, исходно томе, ако је могуће буду спроведене превентивне и контролне мере.Поред мера личне предострожности (заштитна одећа, репеленти итд.) не постојестандардизоване мере заштите јавног здравља циљане да контролишу илисистемски превнирају ККХГ у некој земљи. треенутно не постоји ни OIEреферентна лабоараторија за ову болест, већ само 2 саардничка центра SZO-a:Ljubljana, Slovenia и Sandringham, South Africa. Mnoge laboratorije bivšegSovjetskog saveza imaju veliko iskustvo u radu sa KKHG.Литература1. Anonymus, 2010:Istituto Zooprofilattico Sperimentale dell'Abruzzo e del Molise "G.Caporale" Campo Boario 64100 TERAMO2. Глигић, А., Стаматовић, Л., Стојановић, Р., Обрадовић, М., Бошковић, Р. (1977)Прва изолација вируса кримске хеморагичне грознице у Југославији.Војносанитетски преглед, 34(5): 318-213. Милутиновић Марија Ј., Орешчанин Зорана, Зарић Марија, Радуловић Жељко М.Вирусне хеморагичне грознице Ветеринарски гласник 2003, вол. 57, бр. 7-8, стр.473-47953

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYSASSESSMENT OF THE RISK OF LYME DISEASE VECTORS IN BELGRADEIN 2011.Stajković N., Krstić MilenaAbstractLyme disease is multisystem illnes of people and animals, caused by the spirocheteBorrelia burgdorferi complex, and transmitted by the Ixodes ricinus complex tick bites.In Belgrade are the optimal climatic, ecological and other conditions for themaintenance of the vector of Lyme disease. Assessment of the risk of transmission B.burgdorferi is important for the prevention of Lyme disease. In 2011. the riskassessment was conducted at 28 localities. Total of 7623 ticks were collected in thewild. Of patients with tick is removed 1175. Once of month the localities collectedticks, viewed on B. burgdorferi from ticks and patients on the basis of making theassessment of potential and actual risk. At each localities there is a potential risk, theactual type locality park-forests and forests. With one tick bite was the largest numberof patients and with 12 hours spent in the skin. This phenomenon indicates a lowprobability of transmission of B. burgdorferi.Keywords: assessment, risk, lyme disease, vector, Ixodes ricinusDr Novica Stajković, Mr Milena Krstić, Institute of epidemiology, Military Medical Academy, BelgradeIntroductionLyme borreliosis is a chronic, cosmopolitan, multisystem, zoonotic disease caused byBorrelia burgdorferi sensu lato. People and animals become infected with thoseBorrelia by ticks of the genus Ixodes. Education of the population is not sufficient toachieve complete protection against vectors of Lyme disease in areas where there arefavorable conditions for their development and maintenance. Moderately continentalclimate, a number of host species and favorable environmental factors contribute to themaintenance of the vector in Belgrade, and therefore an increased risk of attacks anddisease. If the risk is caused by exposure, habitat, and season of vector activity, it is allof these factors need to be studied.AimThe aim of this study was to present the risk of Lyme disease vectors in Belgrade in2011 year at sites where chemical treatments are performed and a control site, over thecriteria for assessment of potential and actual risks, and the number of people with atick bite, the theritory's.Material and methods In 2011 from 28 sites in Belgrade, abundance of ticks and theirinfection rates with Borrelia burgdorferi (B. burgdorferi) were investigated. These sitesbelonging to all ecological categories: parks, park-forests, forests. Ticks were collectedonce a month, using flag-hourse (Maupin et al.1991) Based on the criteria given by54

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕSchulze et al. 1991st we calculated potential, and then the actual risk of transmission ofB. burgdorferi. Time spend by a tick in the skin was determined on the basis of scutalindex (Gray et al. 2005; Meiners et al. 2006). Other parameters were monitored usingprotocol of patients (age, site where a person is bites by a tick, number of tick bite).Species and the stages of ticks were determined by keys, and B. burgdorferi wasdiscovered using dark field microscope (Furman and Catts 1982; Kovalevskij 1990).ResultsFrom 28 localities between March to October, were collected a total of 7623 ticksincluding the 6442 (84,5%) belonged to Ixodes ricinus, 41(3.01%) Dermacentorreticulatus and 178 (13,1%) Rhipicephalus sanguineus. All 6442 Ixodes ricinus wereexamined in B. burgdorferi and discovered in 1745 (27,1%) its presence. The number ofticks per month ranged from 372 to 1154. Their largest presence was registered in Apriland May.When assessing the potential risk to the 13 sites was obtained at high risk, while theothers moderate risk. No sites with low potential risk. Actual risk varied betweenlocalities and the monthly tests. Forests generally had a high actual risk.With a tick bite in 2011. were processed 1098 persons. From Belgrade with Ixodesricinus 837, from other parts of Serbia 223 and 15 in the other countries: Greece,Slovenia, Croatia, Montenegro, Macedonia and the Serbian Republic. Among theremoved ticks were other species: Dermacentor reticulatus 7, Rhipicehalus sanguineus9 and Haemaphysalis spp. 2. In 220 (26.3%) of ticks removed from patients in theBelgrade area was discovered the presence of B. burgdorferi. The infected ticks were118 females, 3 males, 88 nymphs and 11 larvae. The biggest number of ticks in the skinfor about 12 hours which indicates a low level of transmmision of B. burgdorferi.With a single tick bite was 1059 people, 21 people with two tick bites, 17 people withthree bites of ticks and 8 people with multiple tick bites. According to age distribution,most of the tick bite was discovered at the age of 10.ConclusionConditions for existence of ticks and the potential risk for transmission of B.burgdorferi in researched localities of Belgrade have exist. Actual risk for thetransmission of B. burgdorferi was determined by the activity of ticks especially duringApril and May and the activities of chemical control of ticks. The most of people had asingle a tick bite, which were removed within 12 hours after the injection, which is infavor of reducing the risk of transmission of B. burgdorferi.References1. Maupin OG, Fish D, Zultowsky J, Campos GE, Piesman J. Landscape Ecology ofLyme Diesease in a Residental Area of Westchester Country, New York. Am JEpdemiol 33, 11: 1105-13, 1991.2. Schulze LT, Taylor CR, Taylor CG, bosler EM. Lyme disease: A Proposed EcologicalIndex to Assess areas of Risk in the Norteastern United States. Am J Pabl Health, 81,6:714-8, 1991.3. Korenberg EI, Kuznecova RI, Kovalevskij JV, Vasilenko ZE, Mebel BD. Osnovni ĉertiepidemiologii boleyni lajma na sverozapade SSSR. Med Parasitol, 3:14-7, 1991.55

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYS4. Furman PD, Catts EP. Manuel of medical entomology. Cambridge University Press,London, 1982.5. Gray J, Stanek G, Kundi M, Kocianova E. Dimensions of engorging Ixodes ricinus as ameasure of feeding duration. Int J Med Microbiol, 295:567-72, 2005.6. Meiners T, Hammer B, Gobel B U, Kahl O. Determining the tick scutel index allowsassessment of tick feding duration and estimation of infection risk with Borreliaburgdorferi sensu lato in a person bitten by an Ixodes ricinus nymph. Int J MedMicrobiol, 296: 103-7, 2006.PROCENA RIZIKA OD VEKTORA LAJMSKE BOLESTI U 2011. GODINI NATERITORIJI BEOGRADAСтајковић Н., Крстић МиленаКратак садржајЛајмска болест је мултисистемско обољење људи и животиња, узроковано јеспирохетом Borrelia burgdorferi, а преноси се преко крпеља Ixodes ricinus. УБеограду постоје оптимални климатски, еколошки и други услови за одржавањевектора Лајмске болести. Процена ризика од преноса B. burgdorferi је важна заспречавање Лајмске болести. У 2011. години спроведена је процена ризика одЛајмске болести на 28 локалитета. Укупно је прикупљено 7623 крпеља изприроде. Са пацијената је уклоњено 1175 крпеља. Прикупљени крпељи са свихлокалитета из природе и са пацијената су прегледани на присуство B. burgdorferi уциљу процене потенцијалног и стварног ризика одд Лајмске болести. На свакомлокалитету постоји потенцијални ризик, нарочито на типовима локалитета паркшумеи шуме. Највећи број пацијената је са уједом крпеља који је 12 сати провеоу кожи. Ова појава указује на малу вероватноћу преноса B. burgdorferi.Кључне речи: процена ризика, Лајмска болест, вектор, Ixodes ricinusДр Новица Стајковић, професор, Мр Крстић Милена, Институт за епидемиологију ВМА, Београд,Црнотравска 26, n.stajkovic@sbb.rs56

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕSession 2WEST NILE FEVER IN SERBIA /ГРОЗНИЦА ЗАПАДНОГ НИЛА У СРБИЈИ57

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYS58

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕFIRST OUTBREAK OF WEST NILE VIRUS INFECTION AMONG HUMANSIN SERBIA, AUGUST TO OCTOBER 2012Popović Nataša, Milošević B., Urošević A., Dulović OlgaAbstractThe aim of this study was to describe characteristics and outcome of patients in the firsthuman outbreak of West Nile virus infection in Serbia, August-October 2012. as well asto define risk factors for the development of encephalitis and fatal outcome. Fifty-eightpatients with the average age of 61.09±15.17 years were analyzed. Forty-four patients(75.9%) were from Belgrade and its` suburbs. Fifty-two patients (89.7%) hadneuroinvasive disease, 8 patients (15.4%) had meningitis, while 44 patients (84.6%) hadencephalitis. Acute flaccid paralysis developed in 14 patients (26.9%) withneuroinvasive disease, who also had encephalitis. Age over 60 and immunosuppressionwere independent predictors for the development of encephalitis in multivariate analysis(p= 0.001, Odds ratio-OR (95% confidence interval-CI) = 44.8 (4.93-408.59); p=0.045, OR (95%CI) = 10.76 (1.06-109.65), respectively). Respiratory failure with thenecessity for mechanical ventilation developed in 13 patients (29.5%) with encephalitis.The average duration of mechanical ventilation was 11.08±16.98 days (ranging from 2-50 days). Thirty five patients (60.3%) had completely recovered by discharge. Ninepatients (15.5%) died. The presence of acute flaccid paralysis, consciousnessimpairment and respiratory failure were found to be predictors of death at discharge inunivariate analysis (p

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYSПРВО ПОЈАВЉИВАЊЕ ГРОЗНИЦЕ ЗАПАДНОГ НИЛА (WЕСТ НИЛЕФЕВЕР) КОД ЉУДИ У СРБИЈИ, У ПЕРИОДУ АВГУСТ-ОКТОБАР 2012.ГОДИНЕПоповић Наташа, Милошевић Б., Урошевић А., Дуловић ОлгаКратак садржајЦиљ овога рада био је да се анализирају карактеристике и исход болести кодљуди који су боловали од Грознице Западног Нила која је први пут регистрованау Србији у периоду од августа до октобра 2012. Такође су анализирани и факториризика за настанак енцефалитиса и смртног исхода код оболелих. Анализом јеобухваћено 58 болесника просечне старости 61.09±5.17. Четрдесет четириболесника (75,9%) је било из Београда и његове околине. Педесет двоје (89,7%) јеимало неуроинвазивну болест, од чега је 8 (15,4%) имало менингитис, а 44пацијента (84,6%) енцефалитис. Акутна флакцидна парализа се развила код 14болесника (26,9%) са неуроинвазивном болешћу, у склопу клиничке сликеенцефалитиса. Независни предиктори за развој енцефалитиса у мултиваријантнојанализи су били старост преко 60 година и имуноспупресија (п= 0.001, Odds.ratio-OR (95% интервал вероватноће-CI) = 44.8 (4.93-408.59); п= 0.045, ОR(95%CI) = 10.76 (1.06-109.65). Респираторна недовољност са потребом завештачком вентилацијом настала је код 13 болесника (29,5%) у токуенцефалитиса. Просечно трајање вештачке вентилације било је 11.08± 16.98 дана(распон од 2-50 дана). Комплетан опоравак при отпусту са лечења постојао је код35 болесника (60,3%). Девет болесника (15,5%) је умрло. Присуство акутнефлакцидне парализе, поремећај свести и респираторна недовољност били су ууниваријантној анализи предиктори смртног исхода при отпусту (п

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕFIRST DETECTION OF WEST NILE FEVER IN HUMAN POPULATION INTHE TERRITORY OF BELGRADERadivojević Sneţana, Maris S., Ljubić B., Obrenović J.SummaryWest Nile fever is an zoonotic infectious disease with viral etiology, which istransmitted to humans and animals via bite of infected mosquito. The aim of this paperis to present the first discovery of West Nile fever during 2012. in the human populationin the territory of Belgrade.Data from the alerts of infectious diseases, clinical findings, epidemiological survey ofaffected people and the results of active epidemiological and laboratory investigationswas used for elaborate and analysis in this paper. Laboratory analyzes were conductedat the reference laboratory for arbo viruses, of the Institute of Virology, Vaccines andSerum "Torlak". This study was conducted using epidemiological-descriptive method.In August-September 2012., for the first time in our country West Nile fever in humanpopulations was detected. A total of 55 patients were hospitalized at the Clinic forInfectious and Tropical Diseases with clinical signs of meningitis and encephalitis, inwhom existed a suspicion of infection with the West Nile virus. Among the patients, 44(80.0%) were from the territory of Belgrade, and 11 from Serbia.Laboratory testing of blood samples and CSF in all patients (44) from the territory ofBelgrade confirmed West Nile fever (30 confirmed cases and 14 probable cases bylaboratory criteria - presence of IgM antibodies in the cerebrospinal fluid and / orserum). The most affected age group was people over 50 years of age (88.6%),including 76.9% having a chronic disease, and an increased risk of severe form ofillness. Most of the affected patients lived in the municipalities of Novi Beograd,Palilula and Grocka (45.5%).Five death outcomes were recorded in the territory of Belgrade during analized period.Deceased persons belonged to the category of over 60 years of age.Concerning the method of infection over 40.0% of affected people stated increasedexposure to mosquito bites during the 3 weeks before the onset of symptoms. In theremaining patients the way infection is unknown. In all cases, the sick person in theincubation period did not travel outside the country.During August 2012. Institute for Biocides and Medical Ecology collected 3000 Culexpipiens mosquitos from three locations in Belgrade, and sent 150 pools of females inthe National Reference Laboratory of the Republic of Serbia for Avian Influenza at theSpecialist Veterinary Institute "Kraljevo" in Kraljevo for the detection of West Nilevirus genome (WNV). WNV was confirmed in 10 of 150 Culex pipiens pools using RT-PCR methods(WestNile).Conclusion - The emergence of outbreaks of West Nile fever in the human population inthe territory of Belgrade is the event that can have serious consequences for publichealth. In order to eliminate/reduce the risk of infection it is necessary to implementappropriate measures: reduction in the number of mosquitoes in indoor and outdoorenvironments, systematic extermination of larvae and adult forms of mosquitoes,61

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYSstrengtening of epidemiological and epizootic disease surveillance, education of thepopulation.Key words: West Nile Fever, WNV, patients, laboratory testing.Prim. mr. sc dr Sneţana Radivojević, epidemiologist; Prim. Dr Boţidar Ljubić, epidemiologist; Dr SlavicaMaris, epidemiologist, Institute of Public Health, Bul. Despota Stefana br.54a, Belgrade; Jelena Obrenović,epidemiologist, Institute of Public Health of Serbia "Dr Milan Jovanović-Batut" Dr Subotića br. 5, Belgrade.ГРОЗНИЦА ЗАПАДНОГ НИЛА ПРВИ ПУТ ОТКРИВЕНА КОД ЉУДИ НАПОДРУЧЈУ БЕОГРАДАРадивојевић Снежана, Марис С. ,Љубић Б., Обреновић Ј.Кратак садржајГрозница Западног Нила је инфективно обољење из групе зооноза, вируснеетиологије које се на људе и животиње преноси убодом зараженог комарца.Рад има за циљ да прикаже прво откриће грознице Западног Нила 2012. годинекод људи на подручју Београда.За приказ и анализу су коришћени подаци из пријава заразних болести, клиничкиналази, епидемиолошке анкете оболелих испитаника и резултати активнихепидемиолошких и лабораторијских испитивања. Лабораторијске анализе суобављене у Националној референтној лабораторији за Arbo вирусе, Института завирусологију, вакцине и серуме, „Торлак―. У раду је примењен епидемиолошкодескриптивниметод.У периоду август-септембар 2012. године, први пут је у нашој земљи откривенагрозница Западног Нила у хуманој популацији. Регистровано је укупно 55хоспитализованих болесника у Клиници за инфективне и тропске болести саклиничком сликом менингитиса и енцефалитиса, код којих је постављена сумњана инфекцију вирусом грознице Западног Нила. Међу оболелима 44 пацијента(80,0%) су из Београда, а 11 са територије Србије.Лабораторијским испитивањима узорака крви и ликвора код свих оболелих (44) саподручја Београда дијагностикована је грозница Западног Нила (30 потврђених и14 вероватних случајева на основу лабораторијских критеријума – присуство IgMантитела у ликвору и/или серуму). Према узрасту оболелих највише сузаступљене особе старости преко 50 година (88,6%), а међу њима 76,9% имахронично обољење, односно повећан ризик за тежи облик болести. Највишеоболелих је са територије општина Палилула, Нови Београд и Гроцка (45,5%).У анализираном периоду на подручју Београда забележено је 5 смртних исхода.Умрле особе припадају категорији старијих од 60 година.У односу на начин заражавања преко 40,0% оболелих наводи повећануизложеност убодима комараца у периоду од 3 недеље пре појаве симптома. Кодосталих оболелих начин заражавања је непознат. У свим случајевима оболелеособе у периоду инкубације нису путовале ван земље.62

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕЗавод за биоциде и медицинску екологију је током августа 2012. године, одсакупљених 3000 комарца Culex pipiens, са три локалитета на територијиБеограда, послао 150 пулова женки на детекцију генома West Nile Virusa (WNV) уНационалну референтну лабораторију за авијарну инфлуенцу Републике Србије уВетеринарском специјалистичком институту „Краљево― у Краљеву. WNV јепотврђен у 10 од 150 пулова Culex pipiens-а коришћењем методе RT-PCR (WestNile).Појава случајева обољевања од грознице Западног Нила у хуманој популацији наподручју Београда представља догађај који може да има озбиљне последице појавно здравље. За отклањање/смањење ризика за инфекцију неопходно јеспровођење адекватних мера: редукција броја комараца у затвореном и наотвореном простору, систематско сузбијање ларви и одраслих форми комараца,јачање епидемиолошког и епизоотиолошког надзора над болешћу и спровођењеконтинуиране едукације становништва.Кључне речи: грозница Западног Нила, WNV, оболели, лабораторијскаиспитивања.Прим. мр сц. др Снежана Радивојевић, епидемиолог; Прим. др Божидар Љубић, епидемилог; ДрСлавица Марис, епидемилог; Градски завод за јавно здравље, Булевар Деспота Стефана бр.54а,Београд; Др Јелена Обреновић, епидемиолог, Институт за јавно здравље Србије „Др Милан Јовановић-Батут―, Др Суботића бр. 5, Београд.63

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYSSEROLOGIC SURVEY OF WILD BIRDS IN SERBIA FOR THE PRESENCEOF WEST NILE VIRUS (WNV) INFECTIONPetrović T., Blázquez Ana-Belén, Lupulović Diana, Lazić Gospava, Fabijan D.,Kapetanov M., Escribano-Romero Estela, Lazić S., Saiz Juan-CarlosAbstractWest Nile virus (WNV) is a neurovirulent mosquito-transmissible Flavivirus withzoonotic potential, which is maintained in nature in an enzootic transmission cyclebetween avian hosts and ornithophilic mosquito vectors, although the virus occasionallyinfects other vertebrates, including humans and horses, in which it may cause sporadicdisease outbreaks that may result fatal. WNV was first isolated in the Uganda (WestNile district) in 1937 and today is considered, after Denga virus, as second mostwidespread flavivirus in the world. In Europe the virus has been present for decades but,recently, the number, frequency and severity of outbreaks with neurologicalconsequences for birds, humans and horses have increased dramatically throughoutcentral and south Europe, constituting a serious veterinary and public health problem.To evaluate the presence of WNV in Serbia, presence of specific anti-WNV antibodieshas been examined in 92 blood sera from 30 migratory and resident wild bird speciescollected during 2012 in Vojvodina. Samples were collected from living-captured wildbirds (some of them during bird-ringing activities), wild birds that died in arehabilitation centre or from those found dead and sent to the centre. The presence ofanti-WNV IgG antibodies was assayed by a validated ELISA based on WNVrecombinant envelope E (rE) protein. All blood sera samples that tested positive byELISA and a representative number of negative samples were assayed for the presenceof anti-WNV specific neutralizing antibodies by Plaque Reduction Neutralization Test(PRNT 90 ) on Vero cell cultures.Out of 92 examined wild birds sera samples tested, WNV antibodies were detected byELISA in 7 (7.6%) sera samples: 4 from Mute swans (Cygnus olor), 2 from a Whitetailedeagle (Haliaeetus albicillas), and 1 from a Common pheasant (Phasianuscolchicus). Five of them neutralized WNV in cell culture with low PRNT 90 valuesranging from 22 to 58, except the With-tailed eagle with the highest P/N value (11.2)that had a PRNT 90 >160. None of ELISA positive blood sera samples neutralized Usutuvirus (USUV) as another flavivirus confirmed in Europe. Obtained results confirm thecirculation of WNV in wild birds in Serbia and remark the risk of infection for humansand horses, thus, pointing to the need of WNV surveillance programs implementation inSerbia.* This study was supported by grant TR31084 from Serbian Ministry of Education, Science andTechnological Development64

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕKey words: West Nile virus, wild birds, ELISA serology, PRNT 90 neutralization, SerbiaDr Tamas Petrović, dr Diana Lupulović, dr Milos Kapetanov, dr Sava Lazić, Lazić GospavaScientific Veterinary Institute ―Novi Sad‖, Novi Sad, Serbia Fabijan D., Bird Protection and StudySociety of Serbia, Novi Sad, Serbia ; Blázquez Ana-Belén., Escribano-Romero Estela, Saiz Juan-Carlos Department of Biotechnology, Instituto Nacional de Investigación y Tecnología Agraria y Alimentaria(INIA), Madrid, SpainСЕРОЛОШКА ИСТРАЖИВАЊА ПРИСУСТВА ИНФЕКЦИЈЕ ВИРУСОМЗАПАДНОГ НИЛА КОД ДИВЉИХ ПТИЦА У СРБИЈИ*Петровић Т. 1 , Blázquez Ana-Belén 2 , Лупуловић Диана 1 , Лазић Госпава 1 , ФабијанД. 3 , Капетанов М. 1 , Escribano-Romero Estela 2 , Лазић С. 1 , Saiz Juan-Carlos 2Kratak sadržajВирус Грознице западног нила (WNV) је неуровирулентан, комарцима преносивиФлавивирус зоонозног потенцијала, који се одржава у природи и ензоотскипреноси између птица као домаћина и орнитофилних комараца као вектора.Такође, вирус повремено инфицира и друге кичмењаке, укључујући ту и човека икоње, код којих може изазвати обољење које некад може завршити смртнимисходом. WNV је први пут изолован у Уганди (Вест Ниле округ) 1937. године, аданас се, након Денга вируса, сматра другим најраспрострањенијимфлавивирусом у свету. У Европи је овај вирус присутан већ деценијама, али сенедавно, број, учесталост и озбиљност епидемија са неуролошким последицама заптице, људе и коње драматично повећао у централној и јужној Европи,представљајући озбиљан проблем у ветеринарском и јавном здрављу.У циљу утврђивања присуства WNV у Србији, испитано је присуствоспецифичних антитела против WNV код 92 крвна серума пореклом од 30миграторних и немиграторних врста дивљих птица прикупљених током 2012.године на подручју Војводине. Узорци су прикупљени од живих-заробљенихдивљих птица (неке од њих током поступка прстеновања), дивљих птица које суугинуле у рехабилитационом центру или од оних које су пронађене угинуле ипослате у центар. Присуство анти-WNV IgG антитела је испитивано валидованимЕЛИСА тестом базираном на рекомбинантном Е (rE) протеину омотача вируса.Сви узорци крвних серума који су дали позитивну реакцију у ЕЛИСА тесту, као иједан број узорака са негативним налазом, су испитани и на присуство вирусспецифичних неутрализационих антитела помоћу неутрализационог тестаредукције плакова (PRNT 90 ) на култури Vero ћелија.Од 92 испитана узорка крвних серума дивљих птица, присуство анти-WNV IgGантитела је утврђено ЕЛИСА тестом код (7,6%) узорака: 4 узорка серума лабудова(Cygnus olor), 2 узорка орла белорепана (Haliaeetus albicillas), и 1 узорка фазана65

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYS(Phasianus colchicus). Пет од ових узорака су неутралисала вирус западног нила накултури ћелија у ниском PRNT 90 титру који се кретао од 22 до 58, осим једногузорка орла белорепана, који је дао и највећи П/Н однос (11.2) у ЕЛИСА тесту,код кога је утврђен титар антитела преко 160 (PRNT 90 >160). Ниједан од ЕЛИСАпозитивних узорака серума није неутралисао Усуту вирус (USUV) као другифлавивирус чије је присуство потврђено у Европи.Добијени резултати потврђују циркулацију вируса западног нила код дивљихптица у Србији указујући на ризик од инфекције за људе и коње, као и на потребуспровођења имплементације програма надзора ове вирусне инфекције у Србији.* Рад је реализован по пројекту ТР31084 финансираном од стране Министарствапросвете, науке и технолошког развоја Републике СрбијеКључне речи: вирус западног нила, дивље птице, ЕЛИСА серологија, PRNT 90неутрализација, СрбијаДр Тамаш Петровић, др Диана Лупуловић, Госпава Лазић, др Милош Капетанов, др СаваЛазић Научни институт за ветеринарство―Нови Сад‖, Нови Сад, Србија; Фабијан Д. Удружење зазаштиту и проучавање птица Србије, Нови Сад, Србија; Blázquez Ana-Belén, Escribano-RomeroEstela , Saiz Juan-Carlos, Департман за Биотехнологију, Национални институт за истраживања упољопривреди и храни (ИНИА), Мадрид, Шпанија66

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕCOMPARATIVE STUDY OF DIAGNOSTIC METHODS’ VALUE INLABORATORY DIAGNOSTICS OF WEST NILE VIRUS *Samokovlija Ana, Dulović Olga, Popović Nataša, Milošević B , Manić Marija,Petrović T., Gligić Ana, Đuriĉić BosiljkaAbstractWest Nile virus (WNV) is among the most significant vector-born viruses. The presenceof this emerging virus has influenced epidemiological and epizootiological situation inthe past 20 years. With the outbreak in the USA in 1999. WNV became the first „old―world virus to appear in the „new― world. The occurence of lineage 2 of WNV inEurope brought many affected people and animals with significant precentage of lethaloutcomes. In 2012. the first epidemic of WNV was reported in the Republic of Serbia.Severity of epidemiological and epizootiological situation had influence on need foraccurate and rapid laboratory, mainly serological diagnostics of WNV. The methods ofchoice in serological diagnostics of WNV are: immunoenzym IgG and IgM ELISAtests, hemmaglutination inhibition test (HI), indirect immunofluorescence assay (IFA),plaque reduction and neutralisation test (PRNT). Molecular methods like polimerasechain reaction (PCR), real time PCR (RT-PCR) etc., have a great importance in modernlaboratory diagnostics. The success in diagnostics of causative agent‘s presence dependson choice of adequate method in relation with submitted pathological material.Although reference laboratories do diagnostics according to recommended accreditedmethods of choice for each disease, there are also other methods which could helpobtaining the accurate diagnosis with less costs (agar gel immunodiffusion method-AGID, for example). The goal of this paper is to present the most significant diagnosticsmethods for WNV and to make comparison of their diagnostic value. In this paper wealso present preliminary results of comparison of „in house― IFA and AGID tests, aswell as commercial ELISA assay for determination of WNV specific antibodies inblood sera of people and horses in the territory of the Republic of Serbia* This study was supported by grant TR37015 from Serbian Ministry of Education, Science andTechnological DevelopmentKey words: West Nile virus (WNV), diagnostic methods, Republic of Serbia, people,horsesAna Samokovlija, DVM, research assistant; Marija Manić, DVM, research assistant; Prof. Bosiljka Đuriĉić,PhD, Department of infectious diseases of animals and bee diseases, Faculty of Veterinary Medicine, BulevarOsloboĊenja 18, Belgrade, Serbia, ana.samokovlija@gmail.com; Prof. Olga Dulović, PhD, Nataša Popović,Clinical assistant, Doc. Branko Milošević, PhD, Institute for infectious and tropical diseases, Clinical centerof Serbia, Pasterova 2, Belgrade; Tamaš Petrović, PhD, senior research associate, Scientific VeterinaryInstitute „Novi Sad―; Ana Gligić, PhD, senior research associate, Institute for virology, vaccines and sera„Torlak―, Vojvode Stepe 458, Belgrade;67

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYSКОМПАРАТИВНА АНАЛИЗА ВРЕДНОСТИ ДИЈАГНОСТИЧКИХМЕТОДА У ЛАБОРАТОРИЈСКОЈ ДИЈАГНОСТИЦИ ВИРУСА ГРОЗНИЦЕЗАПАДНОГ НИЛА *Самоковлија Ана, Дуловић Олга, Поповић Наташа, Милошевић Б., , Манић Марија ,Петровић Т., Глигић Ана , Ђуричић БосиљкаКратак садржајВирус грознице западног Нила (WNV) је један од најзначајнијих вируса који сепреносе путем вектора-инсеката. Присуство овог „емергинг― вируса је обележиоепидемиолошку и епизоотиолошку ситуацију у последњих 20 година. У САД1999. године избија велика епидемија и епизоотија, а WNV постаје први вирус„старог― света који се појављује у „новом― свету. Појава линије 2 WNV у Европидоноси велики број оболелих људи и животиња од којих су неки умрли. Током2012. у Реп. Србији први пут је забележена епидемија WNV код људи. НасталаЕпидемиолошка и епизоотиолошка ситуација је наметнула потребу тачне и брзелабораторијске, првенствено серолошке дијагностике WNV. Методе избора усеролошкој дијагностици WNV су: имуноензимски IgG и IgM ELISA тест, HI(реакција хемаглутинације и инхибиције), IFA (метод индиректне имунофлуоресценције), тест редукције и неутрализације плакова (PRNT). Велики значају модерној лабораторијској дијагностици заузимају молекуларне методе- ланчанареакција полимеразе (PCR), RT- PCR, као и друге модерне методе дијагностике.Успех дијагностификовања присуства узрочника болести у лабораторији зависиод доброг избора дијагностичког метода у односу на достављен патолошкиматеријал. И ако референтне лабораторије врше дијагностику по акредитованимметодама које су прописане као методе избора за одређену болест, нарасполагању је још читав низ метода које могу да помогну да се благовременодобије права дијагноза, а које захтевају мање економске трошкове нпр.агар гелимунодифузиона метода (AGID). Циљ овог рада је да представи најважнијелабораторијске методе у дијагностици WNV, као и да изврши поређење вредностидијагностичних метода. У раду су представљени прелиминарни резултатикомпарације „in house― теста индиректне имунофлуоресценције и агар гелимунодифузионог теста, као и комерцијалног ЕЛИСА теста, у испитивањуприсуства специфичних антитела за WNV у крвним серумима људи и коња натериторији Републике Србије.* Рад је финансиран од стране Министарства просвете, науке и тех. раѕвоја ПR ТР37015Кључне речи: WNV, дијагностички методи, Р. Србија, људи, коњи.Ана Самоковлија, ДВМ истраживач приправник, Марија Манић, ДВМ, истраживач приправник,Проф.др Босиљка Ђуричић, Катедра за заразне болести животиња и болести пчела, ФВМ, Универзитету Београду, ana.samokovlija@gmail.com; Проф. др Олга Дуловић, Наташа Поповић, клинички асистент,Доц. Бранко Милошевић, PhD, Институт за инфективне и тропске болести, Клинички центар Србије,Београд; Др Тамаш Петровић, виши научни сарадник, Научни институт за ветеринарство „Нови Сад―;Др Ана Глигић, виши научни сарадник у пензији, Институт „Торлак―, Београд.68

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕVECTORS WEST NILE VIRUS IN SERBIAStajković N., Djordjević M., Pešić B., Vidanović D., Šekler M.AbstractWest Nile virus (WNV) is a zoonotic, mosquito transmitted disease which causedarbovirus a virus of the genus Flavivirus, family Flaviviridae. In nature, WNV ismaintained in mosquitoes and birds, humans and animals are accidental hosts. Thenumber of countries affected by the virus in the world is increasing, and thereforenozoareal the virus and the number of people suffering from it.The spread of the virus attaches primary importance to migratory birds, although itsspread from endemic to non-endemic areas is not ruled out by animals and mosquitoes.In humans, the virus can spread between individuals by blood transfusion and organtransplantation. Few reports describe the possible transmission from a mother to hernewborn via the intrauterine route or via breast feeding. Genetic analysis of WNVisolates separates strains into two clades, although increasing supports the division of 7lineages. Lineages 1 and 2 are significant and geographically determined, but there is nodata in the presence of both lines in one space. In the surrounding on the countries inwhich the WNV epidemic occurred (Romania, Hungary, Greece, etc.) and migratorybirds on the way Serbia could not be isolated from the spillover of this virus on itsterritory. The emergence of WNV was not a surprise to people who are dealing with thisissue. In 1969 antibodies to WNV detected in sera from 1.2 to 19.4% in a number ofareas, but this fact does not figure in the foreign literature. Studies of mosquitoes andbirds initially were negative. In patients from Vojvodina is found the presence ofantibodies to WNV in the group who had the disease meningoencephalitis and in thecontrol group. In Belgarde, were established in 4.76% of the antibodies in the sera ofWNV maintained green area. There were warnings of possibility of WNV from anepidemiological point of view, and finally, 2012 the illness comes in the population ofthe Serbia and a number of fatal outcomes. The same year in Belgrade, mosquitoes werecollected and RT-PCR detected WNV in the mosquito Culex pipens. This phenomenonwas confirmed that the transmission in our community this virus established and to takeall of the research that followed this zoonotic.Key words: vectors, West Nile virus, birds, mosquitoesDr Novica Stajković, Institute of epidemiology, Military Medical Academy Belgrade, Dr Milutin Djordjević,Faculty of Veterinary Medicine, Belgrade, Dr B. Pešić, Institute for biocides and medicine ecology, Belgrade,Dr Dejan Vidanović, dr Milanko Šekler, Veterinary Instutute, Kraljevo.Introduction - West Nile virus (WNV) is a zoonotic arbovirus in the group, the genusFlavivirus of the family Flaviviridae. The genus Flavivirus also including Japaneseencephalitis virus, St Louis encephalitis virus, Murray Valley virus, Usutu virus andKunjin virus, among others. In the nature of enzootic WNV circulations among birds asreservoirs and genes Culex mosquitoes as vectors. Females mosquitoes become infectedduring blood feeding the birds. People and animal, especially horses, are accidental69

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYShosts. Besides the mosquito Culex sp. may participate in the transmission of the othermosquito species as secondary vectors. WNV to humans can transmit during thetransfusion, transplantation, from mother to baby milk in the handing of infected birds.Spread of WNV from endemic to non-endemic areas usually accomplishes migratorybirds but it is not impossible that the same takes place through infected mosquitoes oranimals. People can become infected with WNV is endemic in going. Since the firstdiscovery of WNV in 1937 in Uganda, the number of areas in which sporadically or as aregistered WNV epidemic in on the rise. Genetic analysis isolated two separate clades,although in recent years more and more talk about existence of lineage 7. According tothe first interpretation is well known that the lineage 1 was isolated in northern andcentral Africa, Israel, Europe, India, Australia ( Kunjin virus) and in North and CentralAmerica, and Columbia and Argentina in South America. Lineage 2 strains are endemicin central and southern Africa and Madagascar, with co-circulation of both viruslineages in central Africa. First of WNV illness in humans have been registered inSerbia 2012 th year. Even before the appearance of WNV investigated its presence in thesera of people with mosquitoes and birds. Detection of WNV in mosquitoes wasperformed RT-PCR method and confirmed the primary vector mosquito Culex pipens.The situation in Serbia in terms of WNV -Many years before the appearance ofWNV and its detection in Serbia, there are studies that are included and this arbovirusinfection. Year in 1969 one group investigate the seropositivity found in human serum,in a considerable number of areas of Serbia. The seropositivity ranged from 1.2 to19.4% (1). A group of researchers from the Institute of Veterinary Kraljevo examinedthe presence of the virus in a number of birds, domestic birds and mosquitoes in theterritory of Kraljevo, Donji Milanovac, Kragujevac and Niš, but did not reveal itspresence (2). Testing mosquitoes in Vojvodina IgG ILISA test did not give positiveresults, and the two people in the group who had a diagnosis meningoencefalit and twopeople in the group of volunteers from 89 individuals were discovered antibodies toWNV (3). In 2004 is based on the epidemiological situation in the region and thepresence vectors and reservoirs in our area, by researches Military Medical Academypointed to the potential danger threatened by the appearance of WNV in ourcommunity. In 2007th in 100 blood samples of persons who maintain green space fromBelgrade seropositivity to WNV detected in 5(4.76%) (4). Finally, 2012 is coming tothe emergence of disease in people who have not traveled outside the country, whichwas the first sign that the WNV in our mist. With the outbreak of disease in human ofdisease in humans launched a search for the presence of virus in mosquitoes in Serbia.At the very beginning of setting traps were done at sites where there has been a diseaseof people and sites where they were registered primary types of WNV vectors, whichare potential habitats of mosquito of the genes Culex.Characteristics of the territory where it was detected WNV - In Belgrade with anarea of 322268 ha live through 1639121 inhabitants in 17 municipalities. Size ofmunicipalities ranges from 3 to 447 km 2 . Forest iz 37443 ha of agricultural land and has219418 ha. Flow in the city of two rivers ( Sava, Danube) and 17 small rivers. Waste ofthe river 2236 ha and 541 ha on the island. Besides these rivers, the territory there are10 lakes, a large number of irrigation and transmission channels and depots for the70

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕwaste water. On this territory there are 19 forest park whose surface 732.50 ha of greenarea 2236.42 ha. Elevation ranges from 71 to 682 m. This territory is moderatelycontinental climate with an average annual temperature from 14 o C, the coldest month ofDecember, and the warmest July. In the coastal area of the Danube and Sava center,there is a large number of houses on stilts and boat house restaurant where the eveninggoat a large number of citizens. During the summer months in the coastal rivers restingseveral hundred thousand people. It the estimated that each year in the territory, thereare over 20,000 ha of permanent and temporary areas that are under water and arefavorable conditions for the development about 20 species of mosquitoes genera Culex,Anopheles, Aedes,Culiseta . Among the mosquitoes in this territory are usuallyregistered the following species: Aedes vexans, Aedes sticticus, Aedes flavescens, Aedesdorsalis, Aedes cinereus, Aedes cataphila, Aedes rossicus, Aedes geniculatus, Aedescaspius, Anopheles maculipinnis, An. claviger, An. Atroparvus, An. messeae, An.typicus, Culex pipiens, Culex molestus, Culex modestus, Culiseta anullata, Culisetasubochrea Compared the host, the species has: zoophylic, zooantropophylic,anthropophylic. Against infectious agents, although there are malaria vectors,occasionally been Dirofilaria sp. Infectious potential in relation to arbovirus andparasites studied the emergence of West Nile virus.The basic characteristics of the primary vector Culex pipens - In America, the genusCulex pipns complex belongs to 28 species. Culex pipens is known as mosquito of WestNile virus or the even more popular‖house mosquito‖. In our environment, there arethree species of the genus Culex as followes: Culex pipens, Culex molestus and Culexmodestus. Representatives of the genus Culex in terms of their habitats, the most notablewere urban the middle or near the middle. The larvae Culex pipiens develop thebasement, sub-stations, wastewater rich in organic matter, water tanks, barrels withrainwater, septic tanks, waste tires, cars and boats. During the year, has the 5-10generation, the most numerous in July and August. Represents reproducing species,which compared to other mosquito species have a high flying ability. Otherwise, themain source of food for the birds in the absence of the real host, Culex pipens can biteshumans or animals. If the cause of WNV infected, its usually from animals killedhorses, and other animals, although not excluded.Literature1. BorĊoški M, Gligić A, Bošković R. Arboviruses infection in SR Serbia. VojnosanitPregl. 1972; 29 (4): 173-175.2. Šekler M., M. Kolarević, N. Vasković, B. Plavšić : Ispitivanje prisustva virusa WNV(West nile virusa) u populaciji divljih ptica na nekoliko epizotiooloških teritorijaRepublike Srbije, kao i ispitivanje prisustva virusnog antigena u populaciji komaracaprimenom RAMP WNV testa. Zbornik radova i kratkih sadrţaja, Apatin, BanjaJunaković, 2009, 175-181.3. Hrnjaković Cvjetković I, Cvejtoković D, Petrić D, Zgomba M, Jerant Patić V,Milošević V i sar. Infekcija virusom zapadnog nila: znaĉaj i dijagnostika. Zbornikradova i kratkih sadrţaja, Apatin, Banja Junaković, 2009, 172- 175.4. Ĉekanac R, Stajković N, Lazić S. West Nile Virus- a real environmental denger.Proseding 4th International symposium on biocides in public health and enviroment.Belgrade, 2004, 119-123.71

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYS5. Kuljić-Kapulica N, Tasić D, Stajković N, Krstić M: Detection of antibodies to WestNile Virus (WNV) in human sera. Med Rev 2009, 2: 9-12.ВЕКТОРИ WEST NILE ВИРУСА У СРБИЈИСтајковић Н., Ђорђевић М., Пешић Б., Видановић Д., Шеклер М.Кратак садржајВирус West Nile (WNV) је зоонозна, комарцима преносива болест коју изазиваарбовирус, вирус који припада роду Flavivirus, породици Flaviviridae. У природисе WNV одржава у комарцима и птицама, а људи и животиње су случајнидомаћини. Број земаља захваћен овим вирусом у свету је у порасту, а самим тим инозоареал овог вируса и број оболелих од њега. У ширењу вируса примарнизначај се придаје птицама селицама, мада његово ширење са ендемских нанеендемска подручја није искључено и преко животиња и комараца. WNV семоже преносити и преко крвљу, трансплатацијом органа, преко млека на одојче итрансплацетарно са мајке на плод. Последњих година је све већи бројимпортованих случајева преко туриста и службених лица из ендемских подручјаWNV. Генетским анализама одвојене су две лозе, мада све више се подржаваподела на 7 лоза. Линија 1 и 2 су значајне и географски детерминисане, алипостоје подаци у присуству обеју линија на једном простору. У окружењу државау којима се догађале епидемије WNV (Румунија, Мађарска, Грчка и др.) и на путумиграторних птица Србија није могла бити изолована од преливања овог вирусана њену територију. Појава WNV није била изненађење за људе који се баве овомпроблематиком. Давне 1969.године доказана су антитела на WNV од 1,2 до 19,4%у великом броју средина, али овај податак не фигурира у страној стручнојлитератури. Истраживања код комараца и птица у почетку нису дала позитивнерезултате. Код пацијената са територије Војводине је установљено присуствоантетела на WNV како у групи која је прележала менигоенцефалитис, тако и уконтролној групи. На територији Београда установљена су у 4,76% антитела уособа које одржавају зелене површине. Било је упозорења на могућност појавеWNV са епидемиолошког гледишта и на крају, 2012. године дошло је до појавеболести код становника Србије и до једног броја леталних исхода. Исте године натериторији Београда, прикупљани су комарци и методом РТ ПЦР детектован јеWNV у врсти Culex pipens. Ова појава је потврдила да се трансмисија овог вирусау нашој средини успоставила и да треба предузети сва истраживања која пратеову зоонозу.Кључне речи: вектори, West Nile вирус, птице, комарциДр Новица Стајковић, Институт за епидемиологију, Војномедицинска академија Београд; Др МилутинЂорђевић Факултет ветеринарске медицине, Београд; Др Б. Пешић Завод за биоциде и медицинскуекологију, Београд; Др Дејан Видановић, Др Миланко Шеклер, ВСИ, Краљево72

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕSession 3BACTERIAL AND VIRAL INFECTIOUSDISEASES / ЗАРАЗНЕ БОЛЕСТИБАКТЕРИЈСКЕ И ВИРУСНЕ ЕТИОЛОГИЈЕ73

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYS74

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕINFECTIONS IN ANIMALS CAUSED BY THE MYCOPLASMA SPP. ANDTHE RESULTS OBTAINED IN THE TERRITORY OF SIBERIАKrasikov A.P., Rudakov N.V.AbstractInfections caused by Mycoplasma spp. are widespread and represent an importantetiologic factor in the pathology of various animal species.The aim of this paper is to introduce the disease situation, laboratory diagnosis,treatment and prevention of mycoplasmosis in animals on farms in western Siberia.For isolation and identification of Mycoplasma spp. and their differentiation fromUreaplasma spp. were used selective media, which, among other things, contain glucoseand arginine. This method of cultivation is simple, requires no special equipment, andalso serves to confirm the presence of microorganisms, and their differentiation as well.During serological tests which were performed for detection of antibodies againstMycoplasma spp. in blood sera, were used tests of indirect hemagglutination andindirect immunofluorescence.Such a procedure for the isolation and identification of Mycoplasma spp. from collectedmaterial is based on an integrated approach for studying infection caused withMycoplasma spp. Based on the results of epizootic research conducted on farms in theregion of Omsk, mycoplasmosis of cattle and calves are widespread.It was observed that the cows in pregnancy and their newborn calves from farms whichwere tested, were isolated same species of Mycoplasma spp., indicating that thesepathogens can be transmitted from mother to the fetus-intrauterine. The most frequentlyisolated species were M. arginine and M. bovirhinis.Mycoplasmosis in pigs are also a topic in swine industry. Through our researchcommonly were isolated species: M. hyorhinis, M. hyosynoviae and Ureaplasma spp.Simultaneous application of bacteriological and serological tests can help to detectinfected animals and also those who carry Mycoplasma spp. In accordance with thesefindings, it can be implemented treatment and prophylaxis of these infectious disease.The results of susceptibility testing showed that Mycoplasma spp. are sensitive totetracycline PVP, oxytocin and ichtoglucovit. In accordance with these results, it wasmade several protocols for the treatment of urogenital mycoplasmosis: 1) oxytocin +bicillin-3 + + tetracycline ichthoglucovit PVP, 2) levotetrasylfin PEG, 3) + oxytocinbicillin-3 + puncture + levoerytrociclin Logvinov by PEG.Key words: Mycoplasma spp., cattle, pigs, diagnosisDr A.P Krasikov Institute of Veterinary Medicine and Biotechnology of Omsk State Agrarian Universitynamed by P.A. Stolypin of Ministry of Agriculture of the Russian Federation 644080 prospect Mira OmskRussia rickettsia@mail.ru ; Dr Nikolaj V.Rudakov Omsk Research Institute of Natural Focal Infections ofRussian Federal Consumer Rights ServiceMycoplasma infection is widespread and is an important etiologic factor in thepathology of urogenital tract of cattle. To identify glucose-fermentation and arginin-75

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYSfermentation of Mycoplasma spp. and Ureaplasma spp. were used selective nutrientmedia [1]. Such selective media allows differing Mycoplasma spp. based on theirenzymatic activity. Selective capacity of nutrient media is reflected in the inhibition ofgrowth of Staphylococcus spp., Proteus spp., Escherichia spp., while the growth ofMycoplasma spp. and Ureaplasma spp. are not affected, because they are very sensitiveto growth of microorganisms from the class Mollicutes.Analysis of the results of our research showed that the selective nutrient media issensitive and specific and also can be used for indication and identification ofMycoplasma allocated from the urogenital tract of cattle. This method of cultivation issimple, requires no special equipment and serves to confirm the presence ofmicroorganisms and their differentiation as well.The reaction of immune fluorescence allows you to quickly detect and differentiateclearly between the disease-causing agents, using the species-specific serum. With aview to obtaining such sera in a short time with a sufficiently high level of antibodies,we selected a scheme for making a hyper immune sera intended to confirm the wildstrains of Mycoplasma. Sera were obtained by hyperimunisation of rabbits. Ourmodification of the procedure to obtain sera included additional, subcutaneousapplication of levamisole, because it is a strong immune stimulator. We used itsimultaneously with the first two doses of antigen. This method for immunization ofrabbits allows us to obtain antibodies specific to cattle and pigs mycoplasmosis, and atthe same time they are very suitable for carrying out the indirect immunofluorescence[2].Our results shows that indirect immunofluorescence method is not inferior in the viewof sensitivity in compare with bacteriological research method, and in some cases issuperior. With this method, you can study the pathogenesis of the disease and pursue alifetime of research methods, detect and identify antigenic structure from selectedMycoplasma spp. Using Mycoplasma antigens, you can examine blood sera for thepresence of Mycoplasma antibodies which gives the advantage of this method over thebacteriological method which is using nutrient medium as an indicator.To identify anti-Mycoplasma antibodies in blood sera some researchers have used thereaction of the indirect hemagglutination, because this method is sensitive, specific andcan serve as a simple and fast diagnostic method [3].Related to this, we also were designed persistent, specific and highly sensitiveerythrocytes‘ antigen for serological diagnostics of cattle and pigs mycoplasmoses withthe help of indirect hemagglutination [4]. When comparing bacteriological andserological methods established on the results of this research, they are matching.The offered scheme for detection and identification of Mycoplasma spp. from collectedbiomaterial is based on an integrated approach to detect the associative forms ofMycoplasma infection, which is easily done in the field and laboratory conditions, aswell. With the help of serologic express-method (indirect immunofluorescence), totaltime for antigen identification and making a diagnosis is reduced to 60 min. Using amethod of indirect hemagglutination also can be found the presence of antibodies inblood sera, through 60 minutes after the reaction. Bacteriological analysis, feasiblewithin 1 - 3 days, which includes not only the cultivation of Mycoplasma spp. in thespecial nutrient mediums, as well as associated micro flora for the examination of themix-forms of the infection process. This method allows to obtain diagnosis of76

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕmycoplasmosis, precisely and timely. It is necessary for the training of specialistveterinarians, as well as to develop effective methods of combating infection andimplementation of prophylactic measures. The proposed protocol for identification maybe used to determine the species characteristics of selected Mycoplasma types, withtheir further use as an antigens for serological reactions, the manufacture of vaccines orfor the immunization of laboratory animals with the purpose of obtaining hyperimmunesera for the treatment or diagnosis.Testing of samples in order to diagnosis of urogenital mycoplasmosis using theproposed protocol, showed that these methods were effective. On the basis of the resultsof long-term exploring of cervical/vaginal mucus, milk and the blood sera of a cows,prepuce washouts, sperm and blood serum of the bulls-donors as well as pathologicalmaterial from aborted fetuses, it was found that urogenital mycoplasmosis of cattle iswidely distributed in the Omsk region. Of 34 farms examined, only three were negative.In the form of mono-infection, disease manifested itself only in 16% of households,while in other cases, mixed infections were present.Today, mycoplasmosis-associated infections of calves also remains a challenge forlivestock. According to the results of epizootological observation on farms of the Omskregion, we found that the mycoplasmosis of calves has a wide distribution. Out of 17surveyed households with a high level of mortality in calves, mycoplasmosis was absentonly in four farms, while in the form of mono-infection this disease is not reported.Mycoplasma arginini and Ureaplasma spp. found in calves in the farms of the Omskregion, were similar to those isolated from cows during maternity period, indicating thatthese pathogens can be transmitted from mother to the fetus. Additionally, the calveswere registered with M. bovirhinis. Isolated Mycoplasma had high pathogenicity and100% of mortality. The index of the M. bovirhinis incidence of bodies of white miceamounted to 96, M. arginini - 92, Ureaplasma spp. - 100.Mycoplasmosis of pigs are also topical issue in pig breeding. Based on the results ofresearch conducted on the farms of the Omsk and Tyumen regions, we found thatmycoplasmosis of pigs is widespread as well, and this infection dominate over otherinfections. Of the 15 surveyed farms, mycoplasmosis was detected in all of them. Onlytwo farms had cases with mono-infection (13%), while the rest of them had infectionscaused by several causative agents. According to the results of biochemical studies,isolated strains are referred as Mycoplasmataceae: M. hyorhinis, M. hyosynoviae andUreaplasma spp.Our research showed that the selective nutrient media is also susceptible to determinecausative agents of swine mycoplasmosis. Also, they are suitable to indicate:ureaplasmas isolated from cervico-vaginal mucus, microorganisms from nasal mucusand the other pathological material taken from pigs. Thus, they can be used also for thediagnosis of a mycoplasmosis in pigs.When comparing a diagnostic value of microbiological and serological methods ofdiagnostics of a mycoplasmosis of pigs, we have specified that indirectimmunofluorescence and indirect hemagglutination test are of equal sensitivity.Complex application of these methods for examination of blood serum and cervicovaginalmucus allows to 5-20% (average 9%) more to identify diseased pigs andMycoplasma-carriers. The positive results of indirect immunofluorescence and indirect77

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYShemagglutination test were confirmed using PCR method which points to their highdiagnostic value [5].Simultaneous use of bacteriological and serological testing allows us timely detection ofdiseased and infected animals, and also allows us to implement appropriate treatmentand prophylactic measures.In order to achieve maximum efficiency treatment of mycoplasmosis, it is necessary tomake an appropriate choice of drugs that have a wide range of effects and act againstpathogens that exist in the field. In the world's veterinary practice for the treatment ofmycoplasmosis in domestic animals, most commonly used antibiotics are from thegroup of fluorochinolones: enrofloxacin, difloxacin, sarafloxacin, danofloxacin,marbofloxacin, norfloxacin, ciprofloxacin and tetracyclines.Mycoplasma spp. which we isolated from the urogenital tract of cattle were the mostsensitive to norfloxacin and ciprofloxacin, as well as tetracycline and levomicetin, Theyshowed less sensitive to sulfadimezin, thylanik, thylosin, trimethoprim, tetra-trimetosuland erythromycin.The most effective protocol for the treatment of urogenital mycoplasmosis includestetracycline PVP, oxytocin and ichthoglucovit, and when mixed urogenital infectionsare present, the most efficient are three regimens: 1) oxytocin+bicillin-3+ ichthoglucovit+tetracycline PVP; 2) levotetrasylfin PEG; 3) oxytocin + bicillin-3 + puncture byLogvinov + levoerytrociclin PEG.Numerous anti-microbial drugs (levotetrasylfin PEG, tetracycline - PVP,levoerytrociclin PEG), included in the designed protocol, have a wide range of effectsand against Mycoplasma spp. and the other pathogens who are making mixed infectionswith them.Mycoplasmosis of calves is characterized by the appearance of pneumonia, rhinitis,ceratoconjunctivitis, arthritis.Quite often there is a simultaneous occurrence of someother infection, usually that are infections of gastrointestinal tract caused by E. coli andSalmonella spp. All together it could cause a great financial loss for farmers, so themain task for vets is promptly detection and treatment of ill animals.In the case of mixed infections in calves, the best results in the treatment gave thecombined use of broad-spectrum antibiotic (PAK) and probiotic Vet 1.1 [6].According to the results of our research, Mycoplasma allocated from the calves have thegreatest sensitivity to tetracycline and enrofloxacin, but less sensitivity toerytromycinum, sulfadimezinum and thylanikum. Also, high efficiency in the treatmenthas amoxicillin in combination with levotetraculfin, as well as aenroflox withstreptomycin.The strains of Mycoplasma, isolated from pigs, were the most sensitive to enrofloxacin,norfofloxacin, tetracycline, oxytetracyclin, macrolides (thylan, thylanikum, thylosinum,tilozin tartrate), linkomycin, gentamycin, less sensitive to ciprofloxacin, levomycetin,sulfadimezin. The protocol for the treatment of mycoplasmosis in sows that gave thebest results is application aenroflos 5%, and when mycoplasmosis is in combinationwith Salmonella spp. then you should use PVP tetracycline. For the treatment of swinemycoplasmosis and/or ureaplazmosis it`s the best to use lincomicin, and whenmycoplasmosis is associated with pasteurelosis, the best effects in the treatment gaveenroflos 5% and nitox.78

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕLiterature1. Rudakov, N.V., I.E. Samoylenko, O.B.. Kalmin, et al, New selective nutrient media forthe diagnosis of urogenital infections // Natural focal infections in Russia: modernepidemiology, diagnostics, and the tactics of protection of the population /. - Omsk,1998. - p. 201 - 203.2. Krasikov A.P., Gongolovich A.E. The method of obtaining of Mycoplasma diagnosticsera for the reaction of indirect immune fluorescence by hyperimmunization of rabbits.The patent for the invention № 2355422. Bulletin № 20. Inventions. Useful models of2009.3. Yu. V. Vulfovich, Laboratory diagnosis of a mycoplasmosis, ureaplasmosis theurological and gynecological patients // Journal of microbiol., epidemiol., immunobiol.-1995.-№ 5.-.p. 97-100.4. Krasikov A.P., Vologdskaya O.V., A. N. Sviridova. The method of obtaining a specificred blood cell diagnosticum for the reaction of indirect hemagglutination (IDHA) formycoplasmosis of cattle. The patent for the invention № 2342155. Bulletin № 36.Inventions Useful models of 2009.5. Krasikov A.P., Gongolovich A.E. The method of obtaining a specific red blood celldiagnosticum for the reaction of indirect hemagglutination (IDHA) for mycoplasmosisof pigs. The patent for the invention № 2361218. Bulletin № 19. Inventions. Usefulmodels. 2009.6. Krasikov A.P., Afanasenko VI. Associative infectious diseases of calves. - Omsk,«Option-Omsk», 2008. –p 230.ИНФЕКЦИЈЕ ЖИВОТИЊА ПРОУЗРОКОВАНЕ СА MYCOPLASMA SPP. ИРЕЗУЛТАТИ ЊИХОВОГ ИСПИТИВАЊА НА ТЕРИТОРИЈИ СИБИРАКрасиков А.П,. Рудаков Н.В .Кратак садржајИнфекције проузроковане sa Mycoplasma spp. су широко распрострањене ипретстављају важан етиолошки фактор у патологији различитих врста животиња.Циљ овог рада је упознавање са епизоотиолошком ситуацијом, лабораторијскадијагностика, лечење и превенција микоплазмоза код животиња на фармама уобласти западног Сибира.За изолацију и идентификацију врста Mycoplasma spp. као и њиховудиференцијацију од Ureaplasma spp. коришћене су селективне хранљиве подлогекоје поред осталог, садрже глукозу и аргинин. Овај метод за култивисање јеједноставан, не захтева посебну опрему, а истовремено служи како за доказивањеприсуства тако и за диференцијацију микроорганизама.Током серолошких испитивања која су спроведена ради откривања специфичнихантитела против Mycoplasma spp.у крвном серуму, рађени су тестови индиректнехемаглутинације и индиректне имунофлуоресценције. Овакав поступак заизолацију и идентификацију Mycoplasma spp. из узоркованог материјала јебазиран на интегрисаном приступу проучавања инфекција проузрокованих саMycoplasma spp. Судећи према резултатима спроведених епизоотиолошких79

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYSистраживања на фармама у региону Омска, микоплазмозе говеда и телади сушироко распрострањене.Запажено је да су од крава у гравидитету и њихове новорођене телади саиспитиваних фарми изоловане исте врсте Mycoplasma spp., што сведочи да се овипатогени могу пренети са мајке на плод интраутерино. Најчешће изоловане врстесу M. arginini и M. bovirhinis. Микоплазмозе свиња су такође веома актуелна темау свињарству. Током наших истраживања најчешће изоловане врсте су M.hyorhinis, M. hyosynoviae и Ureaplasma spp.Симултаном применом бактериолошких и серолошких испитивања се откривајуоболеле а такође и животиње које су носиоци Mycoplasma spp., па у складу са тимналазима се могу спровести лечење и профилакса овог инфективног обољења.Резултати антибиограма показују да су Mycoplasma spp. најосетљивије натетрациклин ПВП, окситоцин и ихтоглуковит. У складу са овим резултатима,направљено је неколико протокола за лечење урогениталне микоплазмозе: 1)oxytocin + bicillin-3 + ichthoglucovit + tetracycline PVP; 2) levotetrasylfin PEG; 3)oxytocin + bicillin-3 + puncture by Logvinov + levoerytrociclin PEG.Кључне речи: Mycoplasma spp., говеда, свиње, дијагностикаДр А.П Красиков,.Институт ветеринарске медицине и биотехнологије Државног пољопривредногуниверзитета у Омску П.А.Столyпин, Министарства Пољопривреде Руске Федерације,rickettsia@mail.ru; др Николај .В . Рудаков 2 Истраживачки институт природножаришних инфекцијаРуске Федералне Агенције за права потрошача у Омску80

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕLEPTOSPIROSIS IN PIGSDošen R., Prodanov-Radulović Jasna, Pušić I., Grgić Ţ., Petrović T.AbstractThe term "abortion" actually refers to the termination of gestation during the fetal phase(between days 35 and 110 of gestation) and is characterized by premature expulsion of aliving or dead fetus. Most commonly, the abortions are due to non-infectious causes. Itis believed that some 2% of porcine pregnancies result in abortion; however, abortionrates exceeding 2% within a larger sow population deserve particular attention andfurther investigation. Primary reproductive tract infections can be responsible for some30-40% abortion cases. They may result from bacterial (brucellosis, leptospirosis,listeriosis, etc.) or viral (Aujeszky's disease, parvovirosis, enterovirus, CSF,encephalomyocarditis virus) infections. Potential abortion etiologies may includeconcomitant action of several infectious agents. The objective of this study was toestablish etiological diagnosis of the abortion in sows and to draft an effective controlprogram.Control of the records on reproductive performance on two pig farms revealed an increase inabortion rate. Blood samples were collected from breeding sows with history of abortion, smalllitter and mummified piglets as well as from boars that inseminated animals with aforementionedproblems. Also, the organs, blood and abdominal cavity contents of live aborted piglets werecollected. Laboratory diagnostic methods applied in this research encompassed serology testingfor presence of specific antibodies against L.pomona: microscopic agglutination test,hemagglutination inhibition test (HI) for detection of PPV antibodies and enzyme-linked immunosorbent assay (ELISA) for detection of PRRS and influenza virus (H1N1) antibodies. To confirmthe presence of the virus in aborted fetuses, molecular diagnostic techniques (RT-PCR) wereapplied.On the first pig farm, control of 22 blood sera samples revealed a Leptospira pomona specificantibody titer of 1:1000 in seven samples, two samples were PRRS-positive and 16 blood serawere positive to swine influenza virus H1N1. Blood and abdominal cavity contents were negativefor all investigated agents, except PPV (titer values 1:512 and 1: 64). On the second pig farm, fiveblood samples were obtained from sows who aborted and from three aborted fetuses. Presence ofL.pomona specific antibodies was confirmed in blood samples of three sows with titer valuesbeing 1:2000, 1:1000 and 1:500. All investigated serum samples were negative for MA, PRRSand swine influenza (H1N1). Presence of PPV specific antibodies (titer values 1:128 and 1:256)was confirmed in all serum samples examined. Pathogenic viruses were not detected in the organsof aborted fetuses. After applying the appropriate measures aimed at infection control, the rate ofabortions was reduced to the technologically acceptable levels; however, control of the sera ofsows who aborted revealed new infection caused by leptospiras and a new episode associatedwith higher incidence of abortions.Key words: pigs, abortion, leptospirosis, control programsmr. sci. polj. Radoslav Došen, consultant specialist, mr sci. vet med. Jasna Prodanov –Radulović, researchassistant; mr sci. vet. Med. Ivan Pušić, senior consultant; dr sci. vet. med Ţivoslav Grgić, research associate;dr sci vet. med. Tamaš Petrović, senior research associate, Scientific Veterinary Institute ―Novi Sad‖,Rumenaĉki put 20, Novi Sad81

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYSЛЕПТОСПИРОЗА СВИЊАДошен Р., Проданов-Радуловић Јасна, Пушић И., Гргић Ж., Петровић Т. *Кратак садржајАбортус је по дефиницији прекид гестације током феталне фазе (између 35 и 110дана гестације), а карактерише се истискивањем живог или мртвог фетуса. Увећини случајева узроци абортуса су неинфективне природе. Сматра се да се око2% случајева гравидитета свиња оконча абортусом, али ако је инциденца преко2% у већој групи крмача, треба предузети неопходна испитивања. Примарнеинфекције репродуктивног тракта у око 30-40% случајева могу бити узрокпобачаја. Оне могу бити последица бактеријске (бруцелоза, лептоспироза,листериоза итд. ) или вирусне инфекције (Аујескијева болест, парвовироза,инфекција ентеровирусом, вирусом класичне куге свиња, вирусенцефаломиокардитиса). У етиологију абортуса може бити укључено истовременоделовање већег број инфективних узрочника. Циљ рада је био да се установиетиолошка дијагноза побачаја крмача и конципира ефикасан програм контроле.Контролом репродуктивних података на две фарме свиња утврђен је пораст броја абортуса.Извршено је узорковање крви плоткиња које су имале абортус, мало легло илимумифицирану прасад, крв нерастова који су осеменили грла са горе наведеним проблемоми органе, крв и садржај из трбушне дупље од живе, побачене прасади. Од лабораторијскихметода дијагностике примењена су испитивања: серолошка испитивањана на присуствоспецифичних антитела за L.pomona (метода микроскопске аглутинације, тест инхибицијехемаглутинације (ХИ тест) за утврђивање присуства антитела против ППВ, иимуноензимски (ЕЛИСА тест) за утврђивање антитела против вируса ПРРС и вирусаинфлуенце (Х1Н1). У циљу утврђивања присуства вируса у побаченим фетусима,примењене су молекуларне технике дијагностике (РТ-ПЦР). На првој фарми свињаконтролом 22 узорка крвних серума у 7 узорака утврђен је титар специфичних антитела наL. pomona (1:1000), 2 узорка су била позитивна на ПРРС, и 16 на вирус инфлуенце свиња(Х1Н1). Крв и садржај трбушне дупље су били негативни на све испитиване узрочникеизузев на ППВ (титар 1:512 и 1: 64). На другој испитиваној фарми свиња извршена јеконтрола 5 крви кмача које су побациле као и три побачена фетуса. У крвним серумима 3крмаче установљено је присуство специфичаних антитела за L.pomona (1:2000; 1:1000; и1:500). Испитани узорци серума су били негативни на МА, ПРРС и инфлуенцу свиња(Х1Н1). У свим узорцима серума је утврђено присуство специфичних антитела на ППВ(титар 1:128 и 1:256). У органима побачених фетуса није утврђено присуство патогенихвируса. После примене одговарајућег програма у циљу контроле инфекције, абортуси сусведени на очекиване технолошке вредности, али је контролом серума побачених крмачаутврђена нова инфекција узрочником лептоспире, и поновна епизода са већим процентомпобачаја крмача.Кључне речи: свиње, абортус, лептосипироза, програм контроле* мр сци.пољ. Радослав Дошен, стручни саветник; мр сци. вет. мед. Јасна Проданов Радуловић,истраживач-сарадник; мр сци. вет. мед. Иван Пушић, виши стручни сарадник; др сци. Вет. медЖивослав Гргић, научни сарадник; др. сци. вет. мед. Тамаш Петровић, виши научни сарадник, Научниветеринарски институт, Руменачки пут 20, Нови Сад82

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕRESULTS OF REPRESENTATION Leptospira spp. WITH SPECIALREFERENCE TO L bratislava IN POPULATION STREET DOGS IN CERTAINREGIONS OF THE REPUBLIC SERBIA*Vojinović Dragica, Samokovlija Ana, Elezović Milica, Manić Marija, Nataša Prokić,Maric J., Smiljanić Jelena, Grgić Ţ.AbstractLeptospirosis is a bacterial infectious disease affecting animals and people which ismaintained in natural cycle among susceptible species, reservoir species andenvironment. In urban life conditions stray dogs are significant species which activlyparticipate in disease transmission. Presence of Leptospira spp. in population of straydogs can be discussed from several different points of view: health protection of people,health protection and welfare of animals, economical and political aspect. In this paperwe present the results of investigation of 915 samples of blood sera of stray dogs on thepresence of specific antibodies to Leptospira spp. Throughout Europe L. bratislava isrecognised as serotype which is increasing its presence in comparison to otherserotypes. In this paper we present the first results of investigation on L.bratislavapresence in population of stray dogs in the territory of the Republic of Serbia.Microscopic agglutination test, a „gold standard― method in serological diagnostics ofLeptospirosis, was used in our research. From total of 915 dog blood sera 40 (4.37%)were tested positive to Leptospira spp.*This study was supported by grant TR37015 from Serbian Ministry of Education,Science andTechnological DevelopmentKey words: Leptospira bratislava, stray dogs, the Republic of SrbijaDragica Vojinović, DVM, PhD, research associate, Scientific Veterinary Institute of Serbia „Belgrade―,V.Toze 11, 11000 Belgrade; Ana Samokovlija, DVM research assistant, Milica Elezović, DVM researchassistant, Marija Manić, DVM research assistant, Nataša Prokić, DVM, research assistant, Maric Jovan, DVMresearch assistant Department of infectious diseases of animals and bee diseases, Faculty of VeterinaryMedicine, University of Belgrade,Bul.oslobodjenja 18, Belgrade, Serbia; DVM Jelena Smiljanić, Veterinarystation ―Šabac―, Vojvode putnika 52, 15000 Šabac; Ţivoslav Grgić, DVM, PhD, research associate, ScientificVeterinary Institute „Novi Sad―, Novi Sad, SerbiaIntroduction - Leptospirosis is a wordlwide spread bacterial infectious disease ofanimals and human caused by pathogenic microorganisms of genus Leptospira spp.There has been an increase in the prevalence of leptospirosis in recent years such that itis now referred to as a re-emerging disease (Levett, 1999). Leptospirosis is maintainedin nature in cycle between susceptable species of mammals, carriers like rodents andwet land where these bacteria can survive for long time periods. In urban areas, straydogs are especially wounerable to infection with Leptospira spp. They share the sameecological niche together with rodents (rats, mouse) and on the other hand they get in83

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYSclose everyday contact with human population especially children. Stray dogs infectedwith Leptospira spp. can shed bacteria through urine for months and pose a significanthealth risk for human population and other animals.Canine leptospirosis was recognized for the first time as a disease of dogs in 1899before in any other animal species and humans (Andre-Fontaine, 2006). The Leptospirainterrogans serovars Canicola and Icterrohaemorrhagiae are traditionally responsiblefor most cases of canine leptospirosis (Faine et al., 1999). Nevertheless, in the pastdecade a significant change in epizootiology has been noticed and other serovars(Grippotyphosa, Pomona, Sejroe, Australis) became the causative agents of most of thecases of canine leptospirosis. Infection occures via skin lesion or through direct contactwith infected urine, by venereal route, through placenta, bites. In dogs, the incubationperiod is usually 4–12 days. There are relatively minor clinically relevant differences indisease produced by the common serovars. Early clinical signs are nonspecific and mayinclude depression, lethargy, anorexia, vomiting, diarrhea, conjunctivitis, fever, andarthralgia or myalgia. Hours to days later, specific signs of renal and/or hepatic diseaseare observed, with mild to moderate elevations in BUN, creatinine, and bilirubin toprofound jaundice, oliguric renal failure, hyperphosphatemia, thrombocytopenia, anddeath. Less commonly, uveitis, pancreatitis, pulmonary hemorrhage, and chronichepatitis are recognized (The Merck Veterinary Manuel, 2012). The animals whichdevelop chronic form of the disease become long term carriers. Diagnosis of canineleptospirosis is based upon epizootioogical anamnesis, clinical signs, pathologicalfindings and laboratory diagnostics. In laboratory, serological tests are useful tool indiagnostics, but also in epizootiology studies. The microscopic agglutination test(MAT) is the standard serological test recognized as a „gold standard―. Antigensselected for use in the MAT should include representative strains of the serogroupsknown to exist in the particular region plus those known to be maintained elsewhere bythe host species under test (OIE Terrestrial Manuel, 2008).The aim of this paper is to present the results of seroprevalence to Leptospira spp. inpopulation of stray dogs in some regions of the Republic of Serbia in order to determinethe level of risk for other animals and human population.Material and Method - Total of 915 stray dogs were examined in this study. All dogswere stray dogs from shelters for animals of different towns in the Republic of Serbia(Belgrade, Novi Pazar, Poţarevac, Ub,Loznica,Vršac, Šabac, Sremska Mitrovica,Smederevska Palanka, Bujanovac).The samples were collected in period 2010-2013.Venepunction with sterile material was used in order to obtain full blood samplewhich was later centrifuged in laboratory and blood sera was separated. In further workblood sera was used for the microscopic agglutination test (MAT). There was noprevious data of vaccination procedure. Microscopic agglutination test (MAT) isrecognized as a gold standard test. In this study we used MAT as described in OIETerrestrial Manuel. The antigens used in this study were 7-14 days old culture offollowing Leptospira serovars: Icterohaemorrhagiae, Canicola, Pomona, Australis,Grippotyphosa, Bataviae, Sejroe, Bratislava.84

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕResults - From total of 915 dog blood sera 40 (4.37%) were tested positive toLeptospira spp. The geografic distribution of samples and positive results are given inTable 1.Table 1. Geografic distribution of total and positive stray dog samplesGeografic region Total N° of samples N° of positive samples Precentage (%)Beograd 470 23 4.89Vršac 47 2 4.25Šabac 22 2 9.09Loznica 70 7 10.0Ub 51 1 1.96Sremska Mitrovica 91 1 1.1Smederevska Palanka 11 0 0Požarevac 45 2 4.44Bujanovac 77 0 0Novi Pazar 31 2 6.45Total 915 40 4.37Among the positive results, L.Icterohaemorragiae, L.canicola, L.pomona were the mostprevalent serovars. Titers varried between 1:100 to 1:30000 (Belgrade).For the first time in the Republic of Serbia seroprevalence of L.bratislava in stray dogswas established. There were no positive results in studied population.Discussion - Of the total of 915 samples 40 (4.37%) were tested positive to the presenceof specific antibodies for Leptospira spp. Results shown in this paper represent the firstlarge scale study of seroprevalence for Leptospira spp. among stray dogs. Especially,for the first time the results for L.bratislava seroprevalence were obtained.In comparison to previously published data (Vojinović et al., 2012) we can suggest thatthe epizootiologic picture of leptospirosis in stray dogs in the Republic of Serbia has notchange. The seroprevalence of Leptospira spp. studies has been conducted throughoutEurope, but only a few of them have stray dogs as a target population. This can beexplained by the fact that many european countries have strict ownership policies andthey managed to decrease the numbers of stray dogs to minimum so they do notrepresent significant health problem. Unfortunately this is still not a case with theRepublic of Serbia and many neighbournig countries.The results from Romania done on103 stray dogs showed that 36,89% of dogs represent a potential reservoir ofinfection.The L. Canicola serovar was identified in 81,57% of the positive cases and theL. Icterohaemorrhagiae serovar in 18,43% of the positive cases (Simona et al., 2010).Also in our study L.icterohaemorrhagiae and L.canicola are the most aboudantserovars. One study from Croatia (Stritof Majetić et al., 2012) of owner dogs shows theprevalence of certain serovars given in decreasing order: Pomona,Grippotyphosa,Icterohaemorrhagiae, Australis, Saxkoebing and Hardjo. Although the study does notinclude stray dogs, this data are in correlation of our findings for the distance betweenCroatia and Serbia is too small and it can be considered as the similar epizootiologicalarea.85

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYSConclusion - Leptospirosis of stray dogs in the Republic of Serbia is a significanthealth factor since stray dogs get in close contacts with human population in cities. Theprevalence of Leptospira spp. is high and the problem should be approched from health,ecological and economical point of view. The decrease in population of stray dogs is theonly possible solution since the large amounts of money are needed for vaccination andtherapy of affected stray dogs. Further investigation of seroprevalence is needed inorder to make efficient strategy of health protection.References1. Levett P.N. (1999), Leptospirosis: Re-emerging or re-discovered disease?Journal of Medical Microbiology, 48 (1999), pp. 417–4182. Andre-Fontaine G. (2006) Canine leptospirosis – do we have a problem ? VeterinaryMicrobiology 2006; 117: 19–24.3. Faine, S., B. Adler, C. Bolin, P. Perolat (1999): Leptospira and Leptospirosis, Second4. Edition, MediSci, Melbourne, Australia5. The Merck Veterinary Manuel (Carole Bolin), Leptospirosis in dogs, 2012http://www.merckmanuals.com6. OIE Terrestrial Manuel, Chapter 2.1.9 Leptospirosis, 2008http://www.oie.int/fileadmin/Home/eng/Health_standards/tahm/2.01.09_LEPTO.pdf7. Vojinović D., Samokovlija A., Elezović M., Rogoţarski D., Đuriĉić B:Determination ofspecific antibodies to Leptospira spp in population of stray dogs in the Republic ofSerbia, Book of abstracts, Eurolepto 2012, Dubrovnik Croatia.8. Simona I., Bogdan A.T., Ipate J, Andreescu N., Chiurciu C., Chiurciu V.,Caplan D.M.,Baraitarean S., Togoe I., Popescu A.N. Biodiversity of the Germs Involved in theHuman and Animal Leptospirosis in Stray Dog of Bucharest Temporally Adopted bythe Community Bulletin UASVM, Veterinary Medicine 67(1)/2010 ISSN 1843-5270;Electronic ISSN 1843-53789. Štritof Majetić, Z., J. Habuš, Z. Milas, V. Mojĉec Perko, V. Starešina, N. Turk (2012) Aserological survey of canine leptospirosis in Croatia serological survey of canineleptospirosis in Croatia - the changing epizootiology of the disease. the changingepizootiology of the disease. Vet. arhiv 82, 183-191, 2012.86

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕРЕЗУЛТАТИ ИСПИТИВАЊА ЗАСТУПЉЕНОСТИ Leptospira spp. САПОСЕБНИМ ОСВРТОМ НА L.bratislava У ПОПУЛАЦИЈИ УЛИЧНИХПАСА У ПОЈЕДНИМ РЕГИОНИМА РЕПУБЛИКЕ СРБИЈЕ*Војиновић Драгица, Самоковлија Ана, Елезовић Милица, Манић Марија,Марић Ј., Прокић Наташа, Смиљанић Јелена, Гргић Ж.Кратак садржајЛептоспироза је заразна бактеријска болест животиња и људи која се уприроди одржава у циклусу између пријемчивих врста, резервоара и животнесредине. У условима живота у градовима улични пси су значајна врста којаактивно учествује у преношењу инфекције. Присуство Leptospira spp. упопулацији уличних паса може се посматрати са више аспеката: здравственезаштите људи, здравствене заштите и добробити животиња, као и саекономског и политичког аспекта. У раду су приказани резултати испитивања915 крвних серума уличних паса на присуство специфичних антитела наLeptospira spp. Широм Европе L. bratislava је препозната као значајан серотипкоји изазива обољења паса са све већом заступљеношћу у односу на другесеротипове. У раду су приказани први резултати испитивања заступљеностиЛ. братислава у популацији уличних паса на територији Републике Србије.Коришћена је метода микроскопске аглутинације (МАТ) која је „златнистандард― у испитивању серопреваленце Leptospira spp. Од укупно 915узорака крвних серума паса који су прегледани, 40 (4.37%) је било позитивнона присуство антитела за Leptospira spp.*Рад је реализован по пројекту ТР 37015 финансираном од стране Министарствапросвете, науке и технолошког развоја Републике СрбијеКључне речи: Leptospira bratislava, улични пси, Република СрбијаДр Драгица Војиновић, истраживач сарадник, Научни институт за ветеринарство Србије„Београд―, В.Тозе 11, 11000 Београд; Ана Самоковлија, ДВМ истраживач приправник, МилицаЕлезовић, ДВМ истраживач приправник, Марија Манић, ДВМ истраживач приправник, НаташаПрокић, ДВМ, истраживач приправник, Марић Јован, ДВМ истраживач приправник, Катедра зазаразне болести животиња и болести пчела, Факултет ветеринарске медицине, Универзитет уБеограду; Смиљанић Јелена, Ветеринарска станица ~Шабац~ ad, Војводе Путника 52, 15000Шабац; Др Живослав Гргић, научни сарадник, Научни институт за ветеринарство „Нови Сад―,21000, Нови Сад87

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYSLISTERIA MONOCYTOGENES IN SILAGE FOR FEEDING DAIRY COWSLazić Milica, Spasić Bolbotinović Dragica, Rogoţarski D., Stojiljković Lj., ŢivojinovićMilena, Matović K.AbstractBacteria from species Listeria are widely distributed in nature.They found in soil, silage,decaying vegetation, sewage water, animal feces and other environmentalsources.Consider that the domestic animals, ruminants, keeping cycle of circulationlisteria in nature with faecal-oral contamination of soil.Listeria get to environmentalwith excrete not only from sick animals and humans but from clinical health, becausethat the healthy animals are carrier of listeria and potential source of environmentalcontamination.Todays belives the main source for infection of animals is no goodprepared animal feeding stuffs.Several examinations confirm relation between excretingthis microorganism with feces and found in bad prepared silage for feeding dairyanimals.The movement of listeria, folowing cycle of food: plants- animal feed - digestivtrackt – feces – manure – plants.Aim: Object of this work is detection of listeria in dairy cows feeding with silage.Material and methods: Material wich we use are samples of animal feed (silage),samples of milk taken from dairy cows feeding with silage, samples of feces and swabsamples taken from stable.All samples are test according to metod describe in ISO11290-1:2010 Microbiology of food and animal feeding stuffs - Horizontal method forthe detection and enumeration of Listeria monocytogenes - Part 1: Detection method.Results:Examinated samples of milk were negative. L. monocytogenes was found infecal samples and swab saples from stable.Conclusions: L. monocytogenes was found in samples (feces and swab from stable)from dairy cows, feeded with silage with L. monocytogenes.Key words: Listeria monocytogenes, silage, dairy cowsDVM sc. Milica Lazić, DVM sc. Dragica Spasić Bolbotinović, Dr sci Dragan Rogoţarski, Mr LjubomirStojiljković, Mr Milena Ţivojinović – Veterinary Institut Poţarevac, Dunavska 89, 12000 Poţarevac; MrKazimir Matović Veterinary specialized Institut Kraljevo, Ţiĉka 34, 36000 Kraljevo88

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕLISTERIA MONOCYTOGENES У СИЛАЖИ НАМЕЊЕНОЈ ЗА ИСХРАНУМЛЕЧНИХ КРАВАЛазић Милица, Спасић Болботиновић Драгица, Рогожарски Д., СтојиљковићЉ., Милена Живојиновић, Матовић К.Кратак садржајБактерије из рода Listeria spp. широко су распрострањене у природи.Откривене суу земљишту, силажи,биљу које трули, отпадним водама, фецесу животиња идругим узорцима из спољне средине.Сматра се да домаће животиње, односнопреживари, одржавају циклус кружења листерије у природи, фекално – оралномконтаминацијом тла.Листерије могу доспети у спољну средину излучевинама несамо оболелих животиња и људи већ и клинички здравих, зато су често здравеживотиње носиоци листерије и потенцијални извор загађења средине.Данас северује да је основни извор заражавања животиња лоше припремљенахрана.Неколико испитивања потврђује везу између излучивања микроорганизмафекалним путем и њеног налаза у лоше припремљеној храни (силажи) за исхранумузних животиња. Анализа кретања листерије, праћењем ланца исхране: биљке –сточна храна-дигестивни тракт-столица-стајњак- биљке.Циљ рада: Циљ овог рада је утврђивање присуства листерије код музних кравахрањених силажом.Материјал и методе: Као материјал у овом испитивању коришћени су узорцихране за животиње (силаже), узорци млека узоркованих од музних кравахрањених силажом, узорци фецеса и узорци брисева из објекта за смештајживотиња, узорковани из једног запата музних крава.Сви узорци су засејавани ускладу са методом SRPS EN ISO 11290-1:2010 Микробиологија хране и хране заживотиње – Хоризонтална метода за откривање и одређивање броја Listeriamonocytogenes – Део 1: Метода откривања.Резултати: У испитиваним узорцима млека није утврђено присуство Л.моноцyтогенес док је у узорцима фецеса животиња и брисева из објеката засмештај животиња утврђена L. monocytogenes.Закључак: Утврђено је присуство L. monocitogenes у узорцима (фецес и брисевииз објекта ), пореклом од млечних крава, које су храњене силажом из које јеизолована L. monocytogenes.Кључне речи: Listeria monocytogenes, силажа, млечне кравеВет спец. Милица Лазић, Вет. спец. Драгица Спасић Болботиновић, Др сци вет. Драган Рогожарски,Мр Љубомир Стојиљковић, Мр Милена Живојиновић - Ветеринарски специјалистички институтПожаревац, Дунавска 89, 12000 Пожаревац; Мр Казимир Матовић Ветеринарски специјалистичкиинститут Краљево, Жичка 34, 36000 Краљево89

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYS90AVIAN CHLAMYDIOSIS – CASE REPORTRaiĉević Z., Petrović M., Mitić Melanija, Vidanović D., M Šekler., Kostić M.IntroductionChlamydiosis - Ornitosis is a disease of birds and humans. The causative agent isChlamydiophila psittaci, intracelular coccoid bacteria, which has 8 serotypes (6 arepathogenic for birds) or 15 genotypes (2). Primarily is transmitted from bird to bird,through inhalation of contaminated air or through contaminated food and equipment.Entry into the bevy is possible via wild birds. Symptoms in infected birds weremucopurulent nasal discharge, diarrhea, polyuria, weakness and the presence of yellow -greenish - gelatinous droppings. When humans are concerned, this disease is consideredto be professional and manifested symptoms are cold and flu. Complications occurrarely as pneumonia and encephalitis. Disease is treated by antibiotic, but the treatedbirds remains carriers.Aim - Show suppression of avian chlamydiosis on the basis of the specific case.Materials and methods - Republic veterinary inspection of Pirot district responded torequest to react at the Gradina border crossing, on 21.05.2012 when they temporarilytook away from one person 583 birds of various species because of illegal trade. Birdswas seized because lack of veterinary documentation. Thirty nine birds were ofprotected species (Rosella and singing parrots) and 544 individuals of other species(278 Nymphs, 213 Tigress, 34 Australian Finches and 19 African finches that. SocialFinches).The birds were transported at the same day and placed in a temporary shelterof ZOO Planet associations from D.Vreţina, municipality Pantelej, Niš where thequarantine was formed. Mortalities of birds started at the border crossing and continuedin the course of transportation.On 23.05.2012. veterinarian inspector was addressed to epizootic service of the VSI Niswith a request to determine which. types of diagnostic tests in will be proceeded inquarantine. This professional service determined to perform diagnostic tests on theNewcastle disease, avian influenza and chlamydia from cloacal and tracheal swabs.Taking swabs was conducted by epizootiologist from the VSI Nis, in the presence of theNational Veterinary Inspector of Pirot district who led the entire procedure.The sampleswere forwarded to the reference laboratory for listed diseases in the VSI Kraljevo (birdmortalities were daily). VSI Kraljevo tested samples for the presence of Chlamydiophilapsittaci genomic using Real Time PCR method.Preparation of samples and DNA extraction: Tracheal and cloacal swabs wereimmersed in 1 ml of sterile PBS. After vortexing for 1 minute, 0.8 ml of PBS weretransferred in 1.5 ml PCR tubes which were then centrifuged at 14,000 g for 15 minutes.The supernatant was rejected and from pellet that remained on the bottom of the testtube DNA was extracted using the commercial QIAamp DNA mini kit (Qiagen,Germany).

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕReal Time PCR reaction:Five microliters of the extracted DNA was used as a template for real time PCRChlamydophila sp. (protocol is described in the paper of Ehrichta et al.) (1).Ch23S-F CTG AAA CCA GTA GCT TAT AAG CGG T (25 nt)Ch23S-R ACC TCG CCG TTT AAC TTA ACT CC (23 nt)Ch23S-p FAM-CTC ATC ATG CAA AAG GCA CGC CG-TAMRAReaction for Real Time PCR consisted 12.5 µl 2x Maxima mastermix probe, 0,2µl permicroliter of specific forward and reverse primers (50 μM), 0,1 µl (50 μM) probe, 5µlof the extracted DNA and water up to 25μl. The temperature regime of Real Time PCRdevice (MX3000P, Stratagene, USA) was: initial denaturation at 95 o C for 10 min., then45 cycles of 15 seconds at 95 o C, 60 seconds at 600C. Positive samples were the onessamples whose Ct value does not exceed 38.Results - VSI Nis in a report No.1175 on the 11.06.2012. presented the results of theVSI Kraljevo No.3054 received on the day 09.06.2012. Results presented presence ofChlamydiophila psittaci genome in samples of tracheal and cloacal swabs taken from aTigress while in other samples of tracheal and cloacal swabs taken from Nymphs andfinches, presence of genome was not determined. Considering that there was illegaltrade of birds and that the conditions in the quarantine were inappropriate, beforegetting results died 104 individuals (68 Tigress, 26 Nymphs, 10 finches and 6 Rosella).Biohazard analysis taken into account all the circumstances: all individuals were indirect contact, surviving of pathogens in faeces and the mat is up to 30 days, incubationperiod lasts from 40 to 106 days, possibly treatment must be exercised during 4 to 6weeks of antibiotic therapy (oxytetracycline, tetracycline, enrofloxacin, etc.), the factthat after undertaken therapy, birds remain carriers of this zoonosis. Bearing all this inmind epizootic service from VSI Nis were proposed following measures to be done inquarantine:- Euthanasia of birds- Disposal scatheless of carcasses- Disinfection of quarantine premises.Ministry of Agriculture, Trade, Forestry and Water Management - VeterinaryDepartment, has approved the proposed measures, Republic veterinarian inspectorissued a decision to declare the bavies of birds infected with chlamydia and designatedmeasures for its suppression.Ordered measures for the suppression of chlamydiosis were undertaken on 27.06.2012.by epizootic service of VSI Nis (euthanasia of birds, disposal scatheless of carcasses,disinfection premises of quarantine). Prior to implementation of this measures, damagewas estimated based on market value of birds, declared by the commission choosen bythe Ministry. On that occasion was performed euthanasia of: 164 Nymphs, 82 Tigress,24 Austrian finches, 11 African finches (Social Finches), 23 Rosella and 1 singingparrots. Until the moment of taking the measures (from the time control at bordercrossing points and in progress quarantine) died a total of 114 Nymphs, 131 Tigress, 18finches (Australian and African), 10 Rosella and 5 singing parrots.After everything, the party approached the Ministry with a request for compensation forbirds killed in quarantine by order of the Republic of veterinary inspection. Ministry91

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYSrejected the request, and the party was punished by the Magistrate's Court in Pirot afterrequesting a misdemeanor proceedings, by national veterinary inspector.Conclusion - Only the timely implementation of veterinary and sanitary measures inquarantine and cooperation of all factors of veterinary service can eradicate infectiousdiseases (which is in this case chlamydiosis) can be effectively combated.Key words: chlamydiosis, parrot, RT-PCRDr. vet. med. spec. Zoran Raiĉević, dr Miloš Petrović, Veterinary Institute ''Niš''; Dr. vet. med MelanijaMitić, Republican veterinary inspection, District Pirot; Dr Dejan Vidanović, Dr Milanko Šekler, VeterinaryInstitute ''Kraljevo''; Dr. vet. med Momir Kostić, Veterinary Station ''Magna'' MerošinaХЛАМИДИОЗА ПТИЦА-ПРИКАЗ СЛУЧАЈАРаичевић З., Петровић М., Митић Меланија, Видановић Д. , Шеклер М.,Костић М.Увод - Хламидиоза - орнитоза је обољење птица и човека. Проузроковач јеChlamydiophila psittaci, интрацелуларана кокоидна бактерија, која се може даљеподелити на 8 сероваријетета (6 су патогени за птице) или 15 генотипова (2).Преноси се примарно са птице на птицу, инхалацијом контаминираног ваздухаили преко контаминиране хране и опреме. Улазак у јато је могућ и преко дивљихптица. Симптоми код оболелих птица су појава мукопурулентног носног исцедка,дијареје, полиурије, слабости уз присуство жуто – зеленкастог - желатинозногизмета. Када су у питању људи болест се сматра професионалном а испољава сесимптомима прехладе и грипа, ређе се јављају компликације у виду пнеумонија иенцефалитиса. Терапија болести је антибиотска, али лечене птице остајуклицоноше.Циљ рада - Приказати на основу конкретног случаја сузбијање хламидиозептица.Мaтеријал и методе рада - Републичка ветеринарска инспекција Пиротскогокруга, реагујући по пријави на граничном прелазу Градина, дана 21.05.2012 је одједног лица због нелегалног промета привремено одузела 583 јединки различитихврста птица (непостојање ветеринарске документације) и то 39 јединкизаштићених врста (розеле и певајући папагаји) и 544 јединки осталих врста (278нимфи, 213 тигрица, 34 аустралијских зеба и 19 афричких зеба тј. јапанскихгалебића). Птице су истог дана превежене и смештене у привременоприхватилиште удружења ЗОО Планет-Д.Врежина,општина Пантелеј, Ниш где јеоформљен карантин. Угинућа птица су почела на самом граничном прелазу анаставила су се и у току транспорта.92

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕДана 23.05.2012.ветеринарски инспектор се обратио епизоотиолошкој службиВСИ Ниш са захтевом да се одреде мере тј. врста дијагностичких испитивања укарантину .Ова стручна служба је одредила да се изврше дијагностичкаиспитивања на АКЖ, инфлуенцу птица и хламидиозу путем узимања клоакалнихи трахеалних брисева. У складу са датим мишљењем, узимање брисева јеобављено од стране епизоотиолога ВСИ Ниш , у присуству Републичкогветеринарског инспектора Пиротског округа који је водио цео поступак. Узетиузорци су прослеђени референтној лабораторији за наведене болести ВСИКраљево (угинућа птица у карантину и даље су свакодневна). ВСИ Краљево јеиспитивања узорака на присуство генома Chlamydiophila psittaci радио методомReal Time PCR.Припрема узорака и екстракција DNK:Клоакални и трахеални брисеви птица су потапани у 1мл стерилног ПБС-а. Наконвортексовања у трајању од 1 минута 0,8 мл ПБС-а је пребацивано у 1,5 мл PCRтубе које су затим центрифуговане на 14000 г 15 минута. Супернатант јеодбациван а из пелете која је остала на дну епрувете ДНК је екстрахованаупотребом комерцијалног QIAamp DNA mini kita (Qiagen, Germany).Real Time PCR reakcija:По 5 микролитара екстраховане DNK је коришћено као темплат за Real Time PCRChlamydophila sp. (протокол је описан у раду Ehrichta и сар.) (1).Ch23S-F CTG AAA CCA GTA GCT TAT AAG CGG T (25 nt)Ch23S-R ACC TCG CCG TTT AAC TTA ACT CC (23 nt)Ch23S-p FAM-CTC ATC ATG CAA AAG GCA CGC CG-TAMRAРеакција за Real Time PCR се састојала од 12,5µl 2x Maxima пробе мастермикса,по 0,2µl микролитра специфичних forward и reverse прајмера (50µM), 0,1µl(50µM) пробе, 5µl екстраховане DNK и воде до 25µl. Температурни режим RealTime PCR уређаја (MX3000P, Stratagene, USA) је био: почетна денатурација на95 0 C 10 мин., 45 циклуса од по 15 секунди на 95 0 C, 60 секунди на 60 0 C.Позитивним узорцима су сматрани они узорци чија Ct вредност није прелазила 38.Резултати - ВСИ Ниш је у извештају Д 1175 од 11.06.2012. приказао резултатеВСИ Краљево бр.3054 од 09.06.2012. о утврђености присуства геномаChlamydiophila psittaci у узорцима трахеалних и клоакалних брисева код тигрицадок код осталих узорака трахеалних и клоакалних брисева нимфи и зебаприсуство генома није утврђено. С обзиром да се радило о илегалном прометуптица и да су услови у карантину неодговарајући до издавања резултата јеугинуло 104. јединки (68 тигрица, 26 нимфи, 10 зеба и 6 розела). За анализубиоризика узете су у обзир све околности: све јединке су биле у непосредномконтакту, преживљавање узрочника у простирци и у фецесу је и до 30 дана,инкубација траје од 40 до 106 дана, евентуално лечење се мора спроводити 4 до 6недеља антибиотском терапијом (окситетрациклини, тетрациклини,енрофлоксацин, итд.), чињеница да и после предузете терапије птице остајуклицоноше и да се ради о зоонози. Имајући све ово у виду епизоотиолошкаслужба ВСИ Ниш је предложила да се у карантину спроведу следеће мере:93

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYS- Еутаназија свих птица- Нешкодљиво уклањање лешева- Дезинфекција карантинских просторија.Министарство пољопривреде, трговине, шумарства и водопривреде - Управа заветерину је дала сагласност на предложене мере, Републички ветеринарскиинспектор је донео решење о проглашењу јата птица зараженим хламидиозом иодредио мере за њено сузбијање.Наређене мере за сузбијање хламидиозе предузете су дана 27.06.2012. од странеепизоотиолошке службе ВСИ Ниш (еутаназија свих врста птица,нешкодљивоуклањање лешева и дезинфекција карантинских просторија), пре истих извршенаје процена штете односно тржишне вредности птица од стране комисије коју јесвојим решењем оформило Министарство. Том приликом је извршена еутаназија:164 нимфи, 82 тигрице, 24 аустријске зебе, 11 афричких зеба (јапанских галебића),23 розеле, 1 певајућег папагаја. До момента предузимања мера (од моментаконтроле на граничном прелазу и у току карантина) угинуло је укупно 114нимфи,131 тигрица,18 зеба ( аустралијских и афричких), 10 розела и 5 певајућихпапагаја.Након свега, странка се обратила Министарству са захтевом за надокнаду штетеза птице убијене у карантину по налогу Републичке ветеринарске инспекције.Министарсво је решењем одбило овај захтев,а странка је кажњена од странеПрекршајног суда у Пироту након подношења захтева за прекршајни поступак одстране Републичког ветеринарског инспектора.Закључак - Само правовременим спровођењем свих ветеринарско санитарнихмера у карантину и сарадњом свих чиниоца ветеринарске службе, заразнеболести, у овом случају хламидиозе, могу се ефикасно сузбијати.Кључне речи: хламидиоза, папагаји, РТ ПЦР,Др вет. мед. спец. Зоран Раичевић, Др Милош Петровић, Ветеринарски специјалистички институт‗‘Ниш‘‘; Др вет. мед Меланија Митић, Републичка ветеринарска инспекција, Пиротски округ; ДрДејан Видановић, Др. Миланко Шеклер, Ветеринарски специјалистички институт ‗‘Краљево‗‘; ДрМомир Костић, Ветеринарска станица ‗‘Магна‘‘ МерошинаЛитература1. Ehricht R., Slickers P., Goellner S., Hotzel H., Sache K. (2006) Optimized DNAmicroarray assay allows detection and genotyping of single PCR-amplifiable targetcopies. Mol. Cell. Probes 20, 60-63.2. OIE Terrestrial Manual 2012, chapter 2.3.1. — Avian chlamydiosis.3. Правилник о утврђивању Програма мера здравствене заштите животиња за 2012.годину4. Закон о ветеринарству94

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕTHE SPREAD OF TUBERCULOSIS IN MONTENEGRO FROM 1999. TO 2012.Bojanić Rašović Mirjana, Bojović Olivera, Hrapović Mevlida, Kaţić D. Kuĉ BojanaAbstractTuberculosis of domestic animals, primarily cattle tuberculosis, not only economic, butprimarily hygiene and health issue, because the fight against tuberculosis animalssignificantly contributes to the prevention of tuberculosis people. The World HealthOrganization 1991 st . declared tuberculosis for a global health problem. The world'sannual tuberculosis affect about 9 million people, and about 3 million die. The globalincidence fastest growing in sub-Saharan Africa, and in the European region in thecountries of the former Soviet Union and Romania. Tuberculosis as an infectiousdisease is the leading cause of death of people, and resistance of M. tuberculosis todrugs is considered to be the most serious problem in tuberculosis control. InMontenegro, according to the Veterinary Administration of Montenegro, in 2001. therewere no reported cases of bovine tuberculosis, in 2002. a total of 3 affected cattle, in2003., 2004., and 2005. two, 2006. six, 2007. one, 2008. three., 2009. four, 2010. twoand in 2011. and 2012. no diagnosed cases of bovine tuberculosis in Montenegro.The total number of people infected with tuberculosis, according to data from theNational Registry of the Hospital for Pulmonary Diseases "Dr.Jovan Bulajic" Brezovikin Niksic in 2002. was 172, 2003. 232, 2004. 178., 2005. 169., 2006. 172., 2007. 162,2008. 134., 2009. 120., 2010. 116 and in 2011. 119. people. The largest number ofpeople infected with tuberculosis is over 60 years. The data indicate the constantpresence of tuberculosis in Montenegro, both in animals and in humans.In order to combat bovine tuberculosis in Montenegro by the Veterinary Administrationeach year in accordance with the Veterinary Law implemented by the Operatingprogram of measures which includes diagnosis and safe removal of positive animals,which significantly contributes to the prevention of this disease in cattle.The rate of tuberculosis infections of people in Montenegro last few years has been indecline as a result of implementation of the National program for tuberculosis control inMontenegro (2005-2012. and 2013- 2017.).Key words: tuberculosis, incidence, MontenegroDr Mirjana Bojanić Rašović, Senior Research Fellow, Dr Danilo Kaţić., University of Montenegro,Biotechnical faculty, Podgorica, Montenegro ; Dr Mr sci. Olivera Bojović, pneumophtisiologist, SpecialHospital for Pulmonary Diseases "Dr.Jovan Bulajic" Brezovik, Nikšić; Dr vet.med Mevlida Hrapović, SeniorAdvisor for Infection disease, Veterinary Administration of Montenegro; Bojana Kuĉ, dipl.ing.agr., Ministryof Agriculture and Rural Development of Montenegro; bojanic.m@t-com.meIntroductionTuberculosis is a significant global health problem. Despite the application of effectivetreatment and preventive measures several decades ago, the number of people sufferingfrom tuberculosis in the world is constantly increasing. It is estimated that eight to ten95

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYSmillion people in the world a year are diagnosed (incidence 136/100000), and 2 milliondied of tuberculosis. More than 90% of the total number of patients and deaths fromtuberculosis is in developing countries, of which 75% in the most productive age (15-50years old). In the last two decades fighting of tuberculosis in Europe has become apriority. In Eastern Europe increase the number of tuberculosis patients, with incidenceare that in some areas exceeding 100 patients per 100 000 population, in addition tobringing the cause of tuberculosis resistant to drugs that cures the disease.The emergence of resistant strains of Mycobacterium tuberculosis is a growing problemin the world. As a result of the application of anti-tuberculosis measures of protection inthe country, over the years there was a constant decrease in the number of tuberculosispatients, so that the rate of incidence of the 1990th in Montenegro was 46.1/100,000population (the SFRY 48/100000 population), which is regarded our country as one inthe region with a high risk of developing tuberculosis. At the same time, the averageincidence rate in the Balkans was 45, in Europe 27/100000. Lately tuberculosis (TB)occurs more often in people who suffer from chronic diseases that lead to lowimmunity. From human to human is usually transmitted via droplets from the throat andlungs of people with active tuberculosis of respiratory organs.Bovine tuberculosis is a dangerous, insidious and long-lasting infectious disease thatcan develop other types of animals, including man. It was found that in some countries,around 10% of TB cases in humans caused by the Mycobacterium bovis. In addition tocattle, was bovine tuberculosis found in a large number of other domestic and wildanimals, such as buffalo, bison, sheep, goats, horses, camels, pigs, wild cats, wild boar,deer, antelopes, dogs, cats, foxes, Canadian weasels, badgers, ferrets, rats, Africanantelopes, tapirs, elk, elephants, rhinos, squirrels, otters, rabbits, raccoons, coyotes,lions, tigers, leopards, lynx, etc.. (Bovinetuberculosis, http://www.oie.int).To human health, particularly dangerous form of the disease is tuberculosis of thebovine udder. As in other organs, in the udder tuberculosis usually develops slowly, butthe cause of the disease of the beginning secretes in milk in very large numbers. Milk ofdiseased cows is particularly important in the transmission of tuberculosis on animalsand humans. People, especially children, infected by tuberculosis usually by drinkingunpasteurized milk and products made from unpasteurized milk of sick animals. Peoplecan become infected and by meat of sick animals, if have not been inspected by theveterinary services. Also, people can become infected by inhaling the dusty,contaminated air in stables of cattle with tuberculosis. It was found that tuberculosis inchildren and adolescents up to 16 years in over 40 percent caused by agent of bovinetuberculosis; in later years the number of cases of bovine tuberculosis in humans isreduced. Bovine tuberculosis in humans is manifested as a bowel tuberculosis, whichusually ends with the death of children, then as tuberculosis of bones, joints,tuberculosis of lymph glands, especially in the neck. (Filipčić, 1953).Given the complex significance of tuberculosis at the global level, we set the task toinvestigate the prevalence of tuberculosis at cattle and people in Montenegro.Materials and methods - In order to assess the importance and prevalence oftuberculosis in cattle and humans in Montenegro, we collected data available:Veterinary Administration of Montenegro, the World Health Organization for AnimalInfectious Diseases (WAHID) and the Special Hospital for Pulmonary Diseases96

Ukupnoobolj.govedaBrojoboljelihgovedagodina200120022003200420052006200720082009201020112012ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕ"Dr.Jovan Bulajic" Brezovik in Niksic. For the obtained data were calculated basicstatistical parameters: average, maximum and minimum values, and standard deviation.Results - Number of cattle infected with tuberculosis in Montenegro in the period of2001-2012. shown in the table 1.Table 1: Number of cattle infected with tuberculosis in Montenegro in the period of2001-2012god0 3 2 2 2 6 1 5 4 3 0 029X 2,41Max 6Min 0SD 1,969The data presented in Table 1. show that in 2002. was a total of 3 affected cattle bytuberculosis, in 2003., 2004. and 2005. by 2, 2006. 6, 2007. 1, 2008. 5, 2009. 4, 2010. 3,while in 2011. and 2012. there was not diagnosed cases of bovine tuberculosis inMontenegro. Mean number of diseased cattle in Montenegro in the period since 2001. to2012. was about 2 sick animals and number of sick animals was the highest in 2006.Table 2: Number of patients with tuberculosis in cattle since 2005-2012. inMontenegro, by municipalitiesYear 2005. 2006. 2007. 2008. 2009. 2010. 2011. 2012.Berane - No data 1 1 - -Danilovgrad - 1 2 - -Bijelo Polje 2 2 1 3 - -The results are shown in Table 2. show that the animals were suffering fromtuberculosis in the period since 2005. to 2012. diagnosed in Bijelo Polje, Bar andDanilovgrad.97

1722321781691721621341201161191574157,42002200320042005200620072008200920102011THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYSTable 3: Percentage of tuberculosis in relation to the number of cattle tested in periodof 2005- 2009.YearN о . оf testedcattleN о of cattleinfectedwith tuberculosis2005 33101 2 0,0062006 37030 6 0,0162007 49902 1 0,0022008 65845 5 0,0072009 60446 2 0,003Ukupno 246324 16 0,006X 49264.8 3,2max 65845 6min 33101 1SD 14241.55 2.19The percentageof cattleinfected withtuberculosisThe results are shown in Table 3. show that in the period from 2005. to 2009. the annualaverage of tested cattle were 49.264, and average number of infected cattle was 3.Number of people infected with tuberculosis in Montenegro in the period from 2002-2010. to the National Registry of the Hospital for Pulmonary Diseases "Dr. JovanBulajic" Brezovik-Niksic is shown in Table 5:Table 4. Number of people infected with tuberculosis in Montenegro in the periodfrom 2002-2010. (National Registry of the Hospital for Pulmonary Diseases "Dr. JovanBulajic" Brezovik-Niksic)YearTotalN o ofpatientsX(average)N o ofpeopleinfectedwithTBCThe results presented in Table 4. show that the number of people suffering from TB in2002. amounted to 172, in 2003. 232, in 2004. 178, in 2005. 169, in 2006 . 172, in2007. 162, in 2008. 134, in 2009. 12, in 2010.god. 116 and in 2011 119 sick people.In the period 2002. - 2011. overall in Montenegro affected 1574 people, or an averageof 157 people a yearDiscussion - At the beginning of the 21st century, tuberculosis is a major social andmedical problem in the world. The current incidence of 128/100 000 globally showstrend a very slow decrease in comparison with 2002. when it was 141/100 000population.98

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕIn Montenegro, the past one decade in the control of tuberculosis applied standards andnorms in force in former Yugoslavia, so that was recorded decades continued decline inillness from tuberculosis in this region. However, in the last ten years, because ofdifficulties in the supply of essential anti-tuberculosis treatment and interruption,procurement of materials for diagnostic, lack of financial support to improve the qualityof work, etc.. instead decreasing, there was a stagnation of the number patients, and inperiod 1999. to 2004. increasing of the number new cases (National TuberculosisControl Program in Montenegro 2005-2012). In 1999. and 2007. tuberculosis inMontenegro was in the top 10 most commonly diagnosed infectious diseases (Statisticalyearbooks, Institute of Public Health of Montenegro). This indicates a constant threatand the additional measures and efforts to combat the disease. This is indicated by theannual incidence of infected people per 100,000, which is down until the last few years.The rate of patients in 1999. was 37, in 2003. was 34/100000 inhabitants. The averageincidence rate for this period is 30/100000 inhabitants, which represents a moderate rateof incidence in Europe. The incidence rate in 2005. was 27.3 / 100,000. However, it isbelieved that the incidence rate in 2005. not reflects the real situation in the country,because is a result of incomplete records and irregular reporting ill people. Thedisintegration of the former Yugoslavia, the wars, the economic crisis are part ofunfavorable influences that have left consequences on the health status of thepopulation.During the crisis years, from about 620.000 inhabitants in Montenegro as determinedfrom census 2012., about 25.000 are refugees(National Strategy for EmergencySituations, Government of Montenegro). All these developments in the country over thepast fifteen years have had a major impact on the spread of tuberculosis in the country.In the past ten years, an average of respiratory tuberculosis included 96% of all cases oftuberculosis, including specific pleuritis. The largest number of patients of both sexesover the age of 50. Relationship affected females and males is less than one in all agegroups, except those aged 25-34. So, affects more men than women. Bacteriologicalconfirmation of pulmonary tuberculosis was obtained in 63% of cases (NationalTuberculosis Control Program in Montenegro 2005-2012).Regional distribution of tuberculosis patients varies in municipalities and the highestrate was recorded in Rozaje 40/100000, Bijelo Polje 33/100000 and Herceg Novi33/100000 inhabitants (National Tuberculosis Control Programme in Montenegro20013-2017).The incidence of tuberculosis in 1997. was 32.9, in 1998. 34,1, in 1999. 37,7, in 2000.30,5, in 2001. 24,8, in 2002. 25,8, in 2003. 34,8, in 2004. 26,7, in 2005. 27,4, in 2006.27,3, in 2007. 24,5, in 2008. 20,7 and in 2009. 19,1 patients at 100.00 inhabitants(Statistical Yearbooks, Institute of Public Health of Montenegro).The spread of tuberculosis contribute poverty, lack of work on the detection of disease,weakness in the diagnosis and treatment, inadequate health infrastructure in countrieswith severe economic crises, etc.. Montenegro partially implemented the DOTS strategysince 1998. when the Federal Republic of Yugoslavia adopted the first national programof protection against tuberculosis, based on WHO recommendations. Since then areuniform criteria in the therapeutic treatment of TB patients with those recommended byWHO. The program was amended in 2003. and all elements complies with therecommendations of the World Health Organization, but not implemented in99

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYSMontenegro. Standardization of the diagnostic was established, but registration andreporting system not standardized. The World Health Organization requires that foreffective tuberculosis control must fully accept all five components of DOTS strategy:Government's commitment to support TB control activities, detection of tuberculosiscases by direct microscopy and culture of sputum, application of standardized shorttermdirect opserved regimens, regular supply of all basic anti-tuberculosis drugs,standardized monitoring system, monitoring and reporting. Other measures proposed bythe WHO for the consistent implementation of the DOTS strategy, include: informingthe population about tuberculosis, educating patients and families, education in schools,communication with other types of health services, social mobilization, includingvolunteers, economic analysis, financial planning and research.Control of tuberculosis is one of the Millennium Development Goals in the globalaction to combat infectious diseases, whose implementation is anticipated by the end of2015. (National Tuberculosis Control Program in Montenegro 2013-2017).Thanks to the National Tuberculosis Control Programme in Montenegro for the periodof 2005-20012.godine, which is based on the goals of the World Health Organization,there has been a reduction in the number of cases, but this disease is still present, andthe current. The most effective way to combat the spread of TB is early diagnosis andappropriate treatment of people with active and latent TB, and actively explore and testpersons with ill persons contact. The aim of the National Programme againsttuberculosis of Montenegro is to 2015. to reduce the prevalence of tuberculosis under20/100000, incidence under the 15/100000 and mortality under 0.5/100000, and that by2050. tuberculosis is reduced below 1 case per 100,000 population.In the last 10 years were registered in Croatia reduction of tuberculosis patients.Although the incidence of tuberculosis in Zagreb is lower than the incidence in Croatia,it is still more than 10 new cases per 100 000 inhabitants. Ten procent with newlydiagnosed tuberculosis suffered from malignant disease, 10% of chronic obstructivebronchitis and 5.8% with diabetes. In Croatia there is also the problem of the migrationof tuberculosis. The goal of health care in Croatia is to reduce the number of cases toless than 10 per 100 000 inhabitants. In Zagreb, 86.4% of patients bacteriologicallyproven pulmonary tuberculosis and 53.4% of them were positive by direct microscopy.These people have major epidemiological significance because of the spread andtransmission of infection to their environment. The emergence of resistant strains ofMycobacterium tuberculosis is a growing problem in the worldhttp://www.stampar.hr/SvjetskiDanBorbeProtivTuberkuloze).In Montenegro, there was a low rate of resistance of Mycobacteriumtuberculosis(1.5%).Since TB is zoonose, its successful suppression in humans contributes significantly thesuccessful eradication of the disease in animals. Exposure to aerosols containingMycobacterium bovis is the most common route of infection in cattle, and ingestion ofcontaminated materials. Typical tuberculous nodules occur most frequently in the lungsand retropharyngeal, bronchial and mediastinal lymph nodes, spleen, liver and otherorgans. According to the Regulation on the classification of animal diseases, how toapply, and notification of infectious diseases, Off. Gazette of Montenegro 5/08,tuberculosis is classified as a dangerous contagious disease. Dangerous contagiousdisease causes the negative socio-economic consequences, negative consequences for100

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕpublic health in the state, as well as in the international trade in animals and animalproducts. Since tuberculosis is a chronic disease, for years can weaken the animal,before the appearance of visible signs of the disease (Kuč Bojana, 2011.)The prevalence of pulmonary tuberculosis caused by humans with Mycobacterium boviswas higher among workers at farms and slaughterhouses, then the people in the cities.Bovine tuberculosis is most prevalent in Africa, parts of Asia and America. Manycountries have reduced the number of cases of bovine tuberculosis or completelyeradicate. However, a significant reservoir of infection among wild animals are locatedin Canada, the UK, USA and New Zealand.According to the Program of health care of animals, a year in the territory ofMontenegro examine 60,000 of cattle on bovine tuberculosis. The Program of healthprotection of animals is carried out in accordance with the Law on Veterinary Medicine(Off. Gazette of Montenegro 11/04 and 27/07) and the Regulation on measures for theidentification, control and eradication of bovine tuberculosis (Off. Gazette ofMontenegro 64/08), whose implementation is responsible Veterinary administration.According to the prescribed Program of health protection of animals shall be timelydetection and treatment of tuberculosis of all cattle over six weeks using the tuberculin.All cattle slaughtered or euthanized must be examined for the presence of characteristiclesions pathoanatomical for tuberculosis. If you detect the presence of such changes, thesamples are sent to the bacteriological examination. Bovine tuberculosis has beenofficially confirmed if is isolated Mycobacterium bovis.Meat and organs of slaughtered animals at the findings of tuberculous changes areevaluated in several ways, depending on the intensity and localization of tuberculouschanges, as: unusable for human consumption, conditionally usable for humanconsumption and hygienic for public consumption without restrictions. (Regulations onthe manner of veterinary-sanitary inspection and control animals before slaughter andproducts of animal origin, (Off. Gazette of SFRY 68/89 and Off. Gazette of SCG10/2003). According to the records of reported cases of bovine tuberculosis since 2005.to 2012., all positive cases were found in the municipalities of Bijelo Polje, Bar andDanilovgrad, which is largely consistent with the common finding of tuberculosis inhumans by municipalities. The sporadic occurrence of tuberculosis in cattle indicatesthe existence of reservoirs of causes tuberculosis in wild animals. These reservoirsprovide a steady source of infection for cattle and other animals. Detection of infectionin wild animals require bacteriological testing, the use of the tuberculin test (only forsome because is not effective for all), and epidemiological analysis ( Bovinetuberculosis,http://www.oie.int/fileadmin/Home/eng/Media_Center/docs/pdf/Disease_cards/BOVINE-TB-EN.pdf ). Since the control of tuberculosis transmission from wild todomestic animals is very complex, based on the reduction and eradication of infection inwild animal populations. The use of vaccination does not yet have priority over theapplication of the tuberculin test in the testing phase. In humans, vaccination is applied.( Terrestrial animal health code, OIE, Bovine tuberculosis Chapter 2.4.7., ).Conclusion - Tuberculosis of human and animals is still present and current problem inMontenegro. Veterinary Service conducts timely detection and treatment of tuberculosisof all cattle over six weeks using the tuberculin. National Tuberculosis ControlProgramme in Montenegro is a framework for tuberculosis control people inMontenegro, in accordance with the guidelines of the World Health Organization. In the101

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYSperiod since 2002. to 2011. overall in Montenegro affected 1574 people, or an average ayear 157 people. Mean number of diseased cattle in Montenegro in the period since2001. to 2012. was about 2 sick animals and number of sick animals was the highest in2006. The sporadic occurrence of tuberculosis in cattle indicates the existence ofreservoirs of causes tuberculosis in wild animals, which points to the need fordiagnostic and prevention of tuberculosis in wild animals.References1. Bovine tuberculosis,http://www.oie.int/fileadmin/Home/eng/Media_Center/docs/pdf/Disease_cards/BOVINE-TB-EN.pdf (23 mart 2013.god.)2. Filipĉić K (1953): Kako ćemo suzbiti goveĊu tuberkulozu? Mljekrstvo, p 175-1773. Kuĉ Bojana (2011): Raširenost tuberkuloze u Crnoj Gori, završni rad, Biotehniĉkifakultet, Podgorica4. Mjeseĉni izvještaji Veterinarske uprave Crne Gore, www.vet.uprava.gov.me/uprava(februar 2013.god.)5. Nacionalni program kontrole tuberkuloze u Crnoj Gori 2005-2012, Ministarstvozdravlja Crne Gore6. Nacionalni program kontrole tuberkuloze u Crnoj Gori 2013-2017., Ministarstvozdravlja Crne Gore.7. Nacionalni registar oboljelih ljudi od tuberkuloze, Specijalna bolnica za plućne bolesti,Nikšić8. Nacionalna strategija za vanredne situacije, Vlada Republike Crne Gore, Ministarstvounutrašnjih poslova, Sektor za vanredne situacije i civilnu bezbjednost,9. Pravilnik o naĉinu vršenja veterinarsko-sanitarnog pregleda i kontrole ţivotinja preklanja i proizvoda ţivotinjskog porekla, Sl. List SFRJ 68/89 i SL. list SCG 10/2003). 110. Pravilnik o mjerama za utvrĊivanje, suzbijanje i iskorenjivanje tuberkuloze goveda, Sl.list CG,. 64/0811. Pravilnik o klasifikaciji bolesti ţivotinja, naĉinu prijavljivanja i obavještavanja ozaraznim bolestima ţivotinja, Sl. list Crne Gore 5/0812. Statistiĉki godišnjaci Instituta za javno zdravlje Crne Gore (period od 1999-2009),dostupni na Internetu za 2006, 2007, 2008 i 2009 god: www.ijzcg.me (23. Mart2013.god)13. Terrestrial animal health code, Bovine tuberculosis, Chapter 2.4.7.,http://www.oie.int/fileadmin/Home/eng/Health_standards/tahm/2.04.07_BOVINE_TB.pdf (23.mart 2013.god)14. Zakon o veterinarstvu Crne Gore, Sl. List RCG, 30/201215. World animal health information database (Wahid),http://www.oie.int/wahis_2/public/wahid.php/Wahidhome/Home ( februar 2013.god.)16. http://www.stampar.hr/SvjetskiDanBorbeProtivTuberkuloze, Svjetski dan borbe protivtuberkuloze, 24. oţujka 2011, (23 mart 2013.god)102

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕРАШИРЕНОСТ ТУБЕРКУЛОЗЕ У ЦРНОЈ ГОРИ У ПЕРИОДУ ОД 1999. ДО2012.ГОДИНЕБојанић Рашовић Мирјана, Бојовић Оливера, , Храповић Мевлида, Кажић Д.,Бојана КучКратак садржајТуберкулоза домаћих животиња, у првом реду туберкулоза говеда, није самоекономски, већ првенствено хигијенско-здравствени проблем, јер сузбијањетуберкулозе животиња знатно доприноси сузбијању туберкулозе људи. Свјетсказдравствена организација 1991. године прогласила је туберкулозу за глобалниздравствени проблем. У свијету годишње од туберкулозе оболи око 9 милионаљуди, а око 3 милиона умре. Глобална инциденца најбрже расте у суб-СахарскојАфрици, а у европском региону, у земљама бившег Совјетског Савеза иРумунији. Туберкулоза као заразна болест је водећи узрок смрти људи, арезистенција M. tuberculosis на љекове се сматра најозбиљнијим проблемом уконтроли епидемије туберкулозе.У Црној Гори, према подацима Ветеринарске управе Црне Горе, у 2001. год. нијебило регистрованих случајева туберкулозе говеда, у 2002.год. укупно је одтуберкулозе обољело 3 говеда, у 2003., 2004. и 2005.год. по 2, 2006 год. 6,2007.год. 1, 2008.год. 3, 2009. год. 4, 2010. 2, док у 2011 и 2012. год није билодијагностикованих случајева туберкулозе говеда у Црној Гори.Укупан број обољелих људи од туберкулозе, према подацима Националногрегистра Специјалне болнице за плућне болести „Др.Јован Булајић― Брезовик уНикшићу, у 2002. год. је био 172, у 2003. год. 232, у 2004.год. 178, у 2005. год.169, у 2006. год. 172, у 2007.год. 162, у 2008. год. 134, у 2009.год. 120, у 2010. год.116 и у 2011.год. 119 људи. Највећи број обољелих људи од туберкулозе јестарији од 60 година. Добијени подаци указују на константно присуствотуберкулозе у Црној Гори, како код животиња, тако и код људи.У циљу сузбијања туберкулозе говеда у Црној Гори од стране Ветеринарскеуправе се сваке године у складу са Законом о ветеринарству спроводиОперативни програм мјера који обухвата дијагностику и нешкодљиво уклањањепозитивних грла, што значајно доприноси сузбијању ове болести код говеда.Стопа оболијевања људи од туберкулозе у Црној Гори неколико последњихгодина је у опадању, што је посљедица спровођења Националног програма законтролу туберкулозе у Црној Гори (2005-2012. и 2013- 2017год.).Кључне ријечи: туберкулоза, инциденца, Црна ГораДр Мирјана Бојанић Рашовић, виши научни сарадник, Др Данило Кажић, научни савјетник у пензији,Универзитет Црне Горе, Биотехнички факултет, Подгорица; Др мр сци Оливера Бојовић,пнеумофтизиолог, Специјална болница за плућне болести „Др.Јован Булајић― Брезовик, Никшић; Дрвет.мед Мевлида Храповић, самостални савјетник за заразне болести, Ветеринарска управа Црне Горе;Бојана Куч, дипл.инж. агр., Министарство пољопривреде и руралног развоја Црне Горе;103

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYSSTUDY ON PREVALENCE OF SALMONELLA SPP. IN THE POPULATIONOF PIGSIN INTENSIVE FARMINGGrgić Ţ., Vidić Branka, Došen R., Savić Sara, Prodanov-Radulović Jasna,Milanov Dubravka, Pušić I. *AbstractControl and reduction of the presence of zoonozes, especially salmonelosis, in pigbreeding, represents the most important factor of all programs for the production ofhealthy pork meat in swine herds. The aim of this study is a preliminary check of theprevalence level for Salmonella spp. In swine herds. On the basis of these results anaction plan for determination and control of health status of the herd (ZAP) would bemade. Based on the experiance from Danmark and Great Britain, four levels of healthstatus in swine herds are recomended: ZAP 0 (herd free from salmonelosis), ZAP 1(herd with less then 65 % of tested samples positive to salmonelosis), ZAP 2 (herd with65-86% of tested samples positive to salmonelosis) and ZAP 3 (herd with more then85% of tested samples positive to salmonelosis).During the study, 75 samples of swine blood serum were taken, 75 samples of meatjuice samples from the same animals and also 75 samples of swine feces, collected onthe sloughter line. Samples originated from 5 farms, settled in the region of SouthBaĉka. Blood serim samples and meat juice samples were analysed with ELISA test andsamples of faeces were analysed by cultivation. From swine blood serum samples,collected from 4 farms, a high level of prevalence was found, by ELISA test forSalnonella spp. (33,33-46,66%). On one farm no positive samples were found. Asignificant difference was found in the number of seropositive samples p = 0,018989.After the analysis of resuts obtained from meat juice samples with ELISA test, asomewhat higher level of prevalence was found for Salnonella spp. (33,33-66,66%), in4 farms where previously blood samples with seropositive findings were detected. Onlyone positive sample was found in the farm where no positive samples were found withserological analysis. A significant difference in the number of positive results was foundp= 0,015518. After the comparison of the results obtained with ELISA test from bloodserum samples and meat juice samples, a high level of correlation was found r = 0.87.Salmonella typhimurium was isolated from two samples of feces originateing from farmA. On the basis of obtained results it can be concluded that there is a need for theassessment of swine herd status and determination of control program for salmonelosisin pigs.Key words: salmonelosis, pigsDr Ţivoslav Grgić, dr Branka Vidić, mr.Radoslav Došen., dr Sara Savić, dr Jasna Prodanov-Radulović,DrDubravka Milanov, mr Ivan Pušić, Scientific veterinary Institute „Novi Sad―, Rumenaĉki put 20; 2100 NoviSad104

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕИСПИТИВАЊЕ ПРЕВАЛЕНЦЕ ЗА Salmonella spp. У ПОПУЛАЦИЈИИНТЕНЗИВНО УЗГАЈАНИХ СВИЊАГргић Ж., Видић Бранка, Дошен Р., Савић Сара, Проданов-Радуловић Јасна,Миланов Дубравка, Пушић И. *Кратак садржајКонтрола и редукција присуства зооноза, првенствено салмонелозе у узгоју свињапредставља најзначајнији фактор свих програма за обезбеђење услова запроизводњу здравствено исправног свињског меса у запатима свиња. Циљ овихиспитивања је прелиминарна провера нивоа преваленце за Salmonella spp. узапаима свиња, на основу чега би се израдио план активности за одређивање иконтролу здравственог статуса запата (ЗАП). На основу искустава у Данској иВеликој Британији предлажу се 4 нивоа здравственог статуса запата свиња: ЗАП 0(запат слободан од салмонеле), ЗАП 1 (запат са мајне од 65 % тестираних узоракапозитивних на салмонеле), ЗАП 2 (запат са 65-86% тестираних узоракапозитивних на салмонеле) и ЗАП 3 (са више од 85% тестираних узоракапозитивних на салмонеле).Током испитивања узорковано је 75 узорака крвних серума свиња и 75 узоракамесног сока истих свиња, као и 75 узорака фецеса свиња, добијених на линијиклања. Узорци су пореклом са 5 фарми на подручју Јужне Бачке. Добијениузорци крвног серума и месног сока су испитани методом ЕЛИСА, а узорцифецеса методом култивације. Из узорака крвних серума свиња са 4 фарме,методом ЕЛИСА, дијагноатикован је висок ниво преваленце за Salnonella spp.(33,33-46,66%). На једној фарми нису дијагноатиковани серопозитивни узорци.Установљена је значајна разлика у броју серопиозитивних узорака, *п = 0,018989.Анализом резултата добијених из узорака месног сока, ЕЛИСА методом, запажасе нешто виши ниво преваленце за Salnonella spp. (33,33-66,66%) из узорака са 4фарме на којима су претходно утврђени узорци са позитивним налазомсеролошком методом. Такође је забележен само један позитиван налаз на фармина којој у претходном серолошком испитивању није било позитивних узорака.Забележена је значајна разлика у броју позитивних налаза на посматранимфармама * п= 0,015518. Поређењем резултата добијених методом ЕЛИСА изузорака крвног серума и месног сока запажа се висок ниво корелације р = 0.87.Методом изолације изолована је Salmonella typhimurium из два узорака порекломса фарме А. На основу добијених резултата може се закључити да постој потребаза утврђивање статуса запата свиња и одређивања програма контролесалмонелозе.Кључне речи: Салмонелоза, свињеДр Живослав Гргић, др Бранка Видић, мр.Радослав Дошен., др Сара Савић, др Јасна Проданов-Радуловић,Др Дубравка Миланов, мр Иван Пушић, Научни институт за ветеринарстви „Нови Сад―,Руменачки пут 20; 2100 Нови Сад105

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYSISOLATION AND CHARACTERIZATION OF AN AVIAN PARAMYXOVIRUS- 1 (APMV-1) FROM WILD PIGEONS IN BULGARIA IN 2011Tumbarski Y., Goujgoulova GabrielaAbstactIn September 2011. the National Reference Laboratory for Influenza A and Newcastledisease of birds in Sofia have received two dead bodies of wild pigeons (Columbalivia). The birds were found dead together with other 50 pigeons near to the marketplace in town of Haskovo, Southern Bulgaria. Samples from brain, lungs and intestineswere prepared and material was inoculated into the allantoic cavity of embryonated 10-days-old chicken eggs. Isolated agent gave a positive haemagglutination reaction. Hisdetermination as APMV-1 (NDV) was implemented through haemagglutinationinhibition assay with specific APMV-1 (NDV) antiserum. Further investigations andpathotype was determined by method of real time reverse transcription polymerasechain reaction (RT-PCR). Nucleotide sequencing of the fusion protein gene (F-gene)and amino-acid sequence of the cleavage site of the F0 showed sequence of RRQKRF,which confirms that the isolate belongs to the virulent NDV. The phylogenetic analysisplaced this isolate into the sublineage 4b.Кеy words: avian paramixovirus – 1, pigeon, isolation, RT-PCRDr. Yulian Tumbarski, Assistant professor, Head National Reference Laboratory for Blue tongue, Dept. ofExotic and emerging diseases, National Diagnostic and Research Veterinary Medical Institute, 190 LomskoShose Blvd. Sofia, Bulgaria, tumbarski@abv.bgIntroductionAvian paramyxoviruses (APMV) are negative-strand RNA viruses of the genusAvulavirus, sub-family Paramyxovirinae, family Paramyxoviridae, orderMononegavirales (Mayo, 2002a, b). The genus includes nine serotypes that have beendocumented in a variety of wild, domestic and pet birds worldwide. The mosteconomically important serotype is APMV-1 (NDV), which causes the Newcastledisease, but other APMV serotypes have been isolated from domestic poultry wherethey occasionally cause respiratory and reproductive disease (Coffee et al., 2010).Antigenic variation of APMV-1 detectable by conventional haemagglutinationinhibition tests has been reported, although such reports are rare and represent relativelyminor variations. One of the most noted variations of this kind has been the virusresponsible for the panzootic Newcastle disease in racing pigeons. This NDV, oftenreferred to as pigeon APMV-1 or PPMV-1, was demonstrably different from standardstrains in haemagglutination inhibition tests, but not sufficiently different antigenicallythat convencional ND vaccines were not protective (Alexander, 2009).Newcastle disease (ND) is a highly contagious disease of many avian species, whichleads to substantial economic losses in the poultry industry. The severity of diseasedepends on the virus strain and the host species. Based on the occurrence and severity of106

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕclinical manifestations, Beard and Hanson (1984) identified five viral pathotypes:strains of high pathogenicity (velogenic) with two subgroups – neurotropic andviscerotropic; strains of intermediate pathogenicity (mesogenic); strains of lowpathogenicity (lentogenic) and asymptomatic enteric strains. Velogenic NDV causeacute infections with high morbidity and mortality and depending on the tropism of thestrain involved, they could be accompanied by respiratory distress and neurogical signsor diarrhoea and haemorrhagic lesions in the gut. The mesogenic strains causerespiratory disease in young birds and decreased egg production in laying flocks. Incontrast, the lentogenic strains are usually apathogenic in adult birds and they mayproduce mild respiratory signs only in young chickens.In pigeons (Columba livia) the clinical manifestations of ND vary greatly, depending onthe age, immune status of the bird and pathogenicity of the viral strain causing infection.PPMV-1 is currently endemic in the pigeon population throughout the world. Juvenilepigeons are very susceptible to infection; at times the morbidity and mortality mayreach 100%, with greenish diarrhoea and nervous signs as incoordination, abnormalgait, inability to fly and feed, paresis of the legs and/or wings and torticollis beingdominant (Terregino and Capua, 2009).The conventional diagnosis of ND includes virus isolation in fowl embryonated eggs orcell cultures; identification of the virus isolated as NDV by serological methods;evaluation of pathogenicity of the virus; detection of specific antibodies in blood sera.In vivo pathogenicity of a given NDV isolate can be determined by assessing of thepathogenicity indices (intracerebral pathogenicity index - ICPI in 1-day-old specificpathogen free chickens; intravenous pathogenicity index – IVPI; intracloacalinoculation pathogenicity test; mean death time of the minimum lethal doseMDT/MLD), the plaque-forming capacity (PFC) etc. (Alexander, 1998).The molecular diagnosis of ND comprises detection of specific M- and F-genes byreverse transcription polymerase chain reaction (RT-PCR). Molecular assessment of thevirulence includes full or partial nucleotide sequencing of the F-gene and determining ofthe amino acid sequence of its product F0 in the place of its proteolytical cleavage(cleavage site) localized between 113 and 117 amino acid residues (Aldous andAlexander, 2001). In present study we describe the isolation and assessment ofpathogenicity of a virulent strain of an avian paramyxovirus-1 (APMV-1), derivingfrom wild pigeons found dead in September 2011 in town of Haskovo, Bulgaria. Thenew isolate was named NDV/pigeon/BG/Haskovo/2011.Materials and methods - Samples. Two carcasses of wild pigeons, found near to themarket place in town of Haskovo, Bulgaria.Chicken embryos (CE). 10-day-old embryonated eggs obtained from specific pathogenfree hen‘s flocks were used (Kostinbrod, Bulgaria).Chicken erythrocytes. Blood with anticoagulant (Alsever‘s solution) fromseronegative hens was collected. The whole blood was consecutively centrifugated andwashed 3 times with phosphate-buffered saline (PBS) in order to obtain erythrocytemass. From the erythrocyte mass 1% and 10% solutions were prepared.Antisera. Original positive sera against APMV-1 (NDV), Avian influenza virus H5N2,H7N3 and H9N2 subtypes were used (Istituto Zooprofilattico Sperimentale delleVenezie - IZSVe, Italy).107

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYSSample preparation and virus isolation. Sample preparation and virus isolationwere carried out according to the OIE protocol and the European standards (OIE 2009;Directive 92/66/EEC). The virus was isolated by the classical method virus isolation in9-11-day-old CE.Specimens from brain, lungs and intestines were taken, chopped into small pieces andput in sterile tubes. In each tube an antibiotic medium, consisting a modified cell culturemedium 199 and the following antibiotics: Penicillin (2000 UI/ml); Streptomycin(2mg/ml); Gentamicin (50g/ml); Lincomycin (2ml/50ml) and Oxytetracycline (2-3g/50ml) was added and mixed vigorously on vortex for 15-30 seconds. After 1 hourstay at 4ºC, samples were clarified by centrifugation at 1000 x g for 10 minutes. Thesupernatant fluids were used for inoculation of 9-11-day-old CE.Five CE per sample were inoculated with 0.2 ml of supernatant into the allantoic sac.The embryos were incubated for 4 days at 37ºC and 65% relative humidity and candledtwice daily to assess embryo vitality. The allantoic fluid of all dead embryos waschecked for haemagglutination activity. In the end of the observation period, theremaining embryos were chilled at 4ºC for at least 6 hours and than checked forhaemagglutination.Virus identification. Allantoic fluids that were positive for haemagglutination (HA)were used as antigens in Haemagglutination Inhibition test (HI test). Twofold serialdilutions of the allantoic fluids in PBS in a V-bottom 96-well microtiter plate wereprepared. An equal volume of a 1% chicken erythrocyte suspension was added andincubated for 30 minutes at room temperature. After defining the HA titer, fourhaemagglutinating units (4 HAU) of the unknown antigens were initially tested withAPMV-1 (NDV) antiserum, as well as with antisera for avian influenza virus H5N2,H7N3 and H9N2 subtypes (Terregino and Capua, 2009).Mean embryo infective dose (EID 50 ) and mean embryo lethal dose (ELD 50 ) weredetermined in 10-day-old CE according to the method of Reed and Muench (1938).Mean death time of the minimum lethal dose (MDT/MLD) was determined in 10-day-old CE according to the method of Hanson and Brandly (1955).RNA extraction and real time reverse transcription polymerase chain reaction(rRT-PCR). The viral RNA was extracted from 140 l of allantoic fluid of chickenembryos positive for HA. The RNA extraction was completed by QIAamp Viral RNAMini Kit (Qiagen, Germany), following the manufacturer‘s protocol. Detection of thespecific for APMV-1 (NDV) M- and F-genes was implemented by using of KAPAProbe Universal One-Step RT-PCR Kit (Kapa Biosystems, USA) following the protocoland requirements of European Reference Laboratory (AHVLA, Weybridge, UK). Thecomponents of the master mix for rRT-PCR are listed in Table 1. The nucleotidesequences of the forward and reverse primers for M- and F-genes and the nucleotidesequence of the probe are shown in Table 2. The amplification of M- and F-genes wasperformed in AB 7300 thermal cycler (Applied Biosystems) at the following cyclingconditions: 42ºC for 5 min.; 95ºC for 5 min.; 45 cycles in turns of 95ºC for 3 sec. and52ºC for 45 sec.For a positive control (PC), in a parallel with the samples tested the velogenic strainNDV/chicken/BG/Vodniantsi/2006 was used. For a negative control (NC) a RNase-freewater was used.108

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕNucleotide sequencing. The partial nucleotide sequencing of the F-gene was completedin the OIE/FAO Reference Laboratory for Newcastle disease and Avian Influenza,IZSVe, Padova, Italy.Phylogenetic analysis. Based on the result from nucleotide sequencing, the geneticrelationship of the isolate with similar ND viruses from other countries was ascertained.It become possible by using of data-base published in the web page of the NationalCenter for Biotechnology Information (NCBI). MEGA 5.0 software was used forediting the nucleotide sequences and deducing the amino acid sequences. Nucleotideand deduced amino acid sequences were aligned with ClustalW software. Phylogenetictree was constructed by using the neighbor-joining (NJ) method (Saitou and Nei, 1987).Table 1. Master mix components for one-step rRT-PCR for detection of M- and F-genes of APMV-1 (NDV).ComponentFinalConcentration1 X Reaction (l)RNase-free water - 2.4KAPA Probe Fast Master Mix (2x) 1X (1:1) 10Probe (2M) 200 nM 2Primer Forw. (5M) 300 nM 1.2Primer Rev. (5M) 300 nM 1.2dUTP (10mM) 200M 0.4ROX High/Low (50x) 1x 0.4KAPA RT Mix (50x) 1x 0.4Total volume 18Viral RNA 2FINAL REACTION VOLUME 20Table 2. Nucleotide sequences of the primers and probe for detection of M- and F-genes of APMV-1 (NDV) by rRT-PCR (Wise et al., 2004).PrimersProbeМ-geneM+ 5`-AGT GAT GTG CTC GGA CCTTC-3`M- 5`-CCT GAG GAG AGG CAT TTGCTA-3`5`-FAM-TTC TCT AGC AGT GGG ACAGCC TGC-TAMRA-3`F-geneF+ 5`-TCC GGA GGA TAC AAG GGTCT-3`F- 5`-AGC TGT TGC AAC CCC AAG-3`5`-FAM-AAG CGT TTC TGT CTC CTTCCT CCA-TAMRA-3`109

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYSResults and discussionVirus isolation, identification and evaluation of the pathogenicity.After isolation, determining of the HA titer and serological identification with specificantiserum (Table 3), we concluded that the haemagglutinating agent was APMV-1(NDV). We named the new isolate NDV/pigeon/BG/Haskovo/2011.The results from HI test excluded the presence of avian influenza virus (AIV).Table 3. Haemagglutination (HA) titer and inhibition of the haemagglutination fromspecific APMV-1 (NDV) antiserum.Inhibition of HAIsolate HA titer 4 HAU from NDVantiserumNDV/pigeon/BG/Haskovo/2011 1:32 1:8 1:32After the identification of the virus, we defined the basic in vivo pathogenicity indices,which are directly related to the virulence. The general characteristics of the isolateNDV/pigeon/BG/Haskovo/2011 and control velogenic and lentogenic strains we used inparallel for comparison, are shown in Table 4.Table 4. In vivo parameters of the isolate NDV/pigeon/BG/Haskovo/2011 and controlvelogenic and lentogenic strains.ParametersIsolateMDT/MLD,EID 50/0.1ml ELD 50/0.1ml MLDhoursNDV/pigeon/BG/Haskovo/2011 10 -7.42 10 -7.43 10 -5 76NDV/pigeon/BG/Govedartzi/2002(lentogenic strain)10 -8 10 -5.22 10 -1 108NDV/pigeon/BG/Shabla/2007(velogenic strain)10 -7.4 10 -7.4 10 -4 40The results presented in Table 4, show that EID 50 , ELD 50 and MLD for the new isolateinvestigated were almost equal to those in the control velogenic strain NDV/pigeon/BG/Shabla/2007. In this case, the number of dead CE until the end of observationperiod, corresponded to the number of infected CE from the given viral dilution(remaining alive CE were uninfected). Based on these characteristics, we concluded thatisolate NDV/pigeon/ BG/Haskovo/2011 belongs to the virulent pathotype.Mean embryo infective dose (EID 50 ) values, nevertheless of the virus pathotype (velo-,meso- or lentogenic), are relatively high and reach level of 10 -7 - 10 -8 per 0.1 ml. Incontrast, mean embryo lethal dose (ELD 50 ) and minimum lethal dose (MLD) values inthe lentogenic (avirulent) strains are lower than respective in the velogenic (virulent)strains (Hadjiev, 2002).We also determined that mean death time of the minimum lethal dose (MDT/MLD) was76 hours, which confirmed that the isolate NDV/pigeon/BG/Haskovo/2011 belongs tothe group of mesogenic NDV strains.According to Hanson and Brandly (1955), MDT/MLD value correlates negatively withpathogenicity and has been used to classify NDV strains into 3 main groups: velogenic(taking under 60 hours to kill CE); mesogenic (between 60 and 90 hours to kill CE) andlentogenic (more than 90 hours to kill CE).110

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕThe conventional methods for detection and differentiation are perceived as slow,laborious and requiring an undesirable use of in vivo techniques, but they are very exactand widely accepted as ―Golden standards‖ in the virology diagnostics. Thedisadvantages of conventional methods are compensated by the modern moleculartechniques, applying of which guarantees rapid and timely results.Detection of viral RNA and pathogenicity assessment by real time reversetranscription polymerase chain reaction (rRT-PCR).Real time reverse transcription polymerase chain reaction is an express diagnosticmethod for detection and differentiation between the virulent and avirulent NDV strains(Nidzworski et al., 2011).Detection of the virus (respectively viral RNA) includes detection of the matrix gene(M-gene), which is conservative for all the pathotypes of APMV-1 (NDV).Differentiation between the strains is based on the detection of the specific fusion gene(F-gene). The difference between the nucleotide sequences of F-gene in virulent andavirulent NDV, allows the using of primers for a separate F-gene detection of thevirulent strains. As a result, during the rRT-PCR only the F-gene of the virulent strainsis amplifying and getting detectable. Therefore, the presence of F-gene (positive results)in the samples tested, is a certain indication that the strain is virulent (Wise et al., 2004).The positive results we obtained for F-gene clearly demonstrate that the virusinvestigated (NDV/pigeon/BG/Haskovo/2011) belongs to the virulent pathotype (Table5).Table 5. Results from detection of M- and F-gene of NDV/pigeon/BG/Haskovo /2011.Virus dilution*NDV/pigeon/BG/Haskovo /2011 M-gene, Ct F-gene, Ct10 -1 18.82 21.2210 -2 19.82 20.0510 -3 18.38 19.2610 -4 17.99 18.8910 -5 22.12 23.5410 -6 19.76 21.97PC 14.57 16.24NC - -Legend:PC – positive control (NDV/chicken/BG/Vodniantsi/2006)NC – negative control (RNase-free water)Ct – cycle threshold value* - fresh harvested allantoic fluid from CE, inoculated with 10-fold dilutions of a onepassage brain suspensionNucleotide sequencing as a tool for evaluation of the pathogenicity.By performing of a partial nucleotide sequencing of F-gene of NDV/pigeon/BG/Haskovo/2011, we determined the typical for virulent NDV sequence at F0cleavage site: 112 RRQKR↓F 117 . This confirmed the placement of the isolate into thevirulent group.111

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYSIt is well known that the product of the F-gene – F protein is essential for viralreplication. The viral F protein brings about the fusion between the viral and cellmembranes so that the viral genome enters the cell and replication can began. Duringthe replication, NDV particles are produced with a precursor glycoprotein F0, that hasto be cleaved to F1 and F2 polypeptides, which remain bound by disulphide bonds, forthe virus particles to be infectious. The post-translational cleavage is mediated by hostcell proteases.The cleavability of the F0 has shown to be related directly to the virulence of the virusesin vivo. In the virulent NDV a presence of multiple basic amino acids at F0 cleavage sitehas been confirmed. Usually the sequence in virulent viruses is 113 RQK/RR↓F 117 . Someof them have a basic amino acid at position 112 as well. In contrast, viruses of lowvirulence have the sequence 113 K/RQG/ER↓L 117 . Thus, there appears to be therequirement of a basic amino acid at residue 113, a pair of basic amino acids at 115 and116 plus a phenylalanine at residue 117 if the virus to be virulent for birds. Thepresence of these amino acids means that cleavage can be effected by a proteases,present in a wide range of host tissues and organs; but for the avirulent NDV, cleavagecan occur only with proteases recognizing a single arginine, i.e. trypsin-like enzymes.Therefore, the replication of avirulent viruses is restricted to areas with trypsin-likeenzymes (respiratory and intestinal tracts), whereas the virulent NDV can replicate andcause damage in a range of tissues and organs, resulting in a fatal systemic infection(Alexander, 2009).Phylogenetic analysis.Using the NJ method and partial nucleotide sequence of the F-gene consisting of 217base pairs (bp), we constructed linear phylogenetic tree and determined the similarityand relationship between the isolate and other viruses into the clade (Figure 1).We ascertained that the virus NDV/pigeon/BG/Haskovo/2011 belongs to lineage 4,sublineage 4b, according to the nomenclature described by Aldous et al. (2003).Sublineage 4b is comprised solely of viruses associated with the ongoing panzootic inpigeons in Europe and Middle East. The maximum divergence in lineage 4 is 29.3%.Divergence within the lineage (group) is calculated by comparing sequence pairs inrelation to the phylogeny reconstructed by MegAlign (from DNAstar manual).Comparision of the obtained nucleotide sequence of the F-gene with other NDV F-genesequences from NCBI data-base, showed the identity (in %) of NDV/pigeon/BG/Haskovo/2011 with PPMV-1 from Belgium in 2011 (98%); PPMV-1 from China in2011 (98%); PPMV-1 from Slovenia in 2008 (97%); PPMV-1 from Belgium in 1998(97%); NDV from rosella in Belgium in 1998 (97%); NDV from chicken in China in2008 (97%); PPMV-1 from China in 2008 (97%); PPMV-1 from USA in 2008 (96%);PPMV-1 from USA in 2008 (96%); PPMV-1 from USA in 1998 (96%); PPMV-1 fromUSA in 2003 (96%); NDV from duck in China in 2008 (96%); NDV from dove in Italyin 2000 (95%); NDV from dove in USA in 2004 (95%); NDV from dove in Italy in2010 (95%) and PPMV-1 from USA in 2008 (94%).Lineages 3 (sublineages 3a – 3d), 4 (sublineages 4a – 4d) and 5 (sublineages 5a – 5e)unify the virulent (velogenic and mesogenic) isolates. In contrast, lineages 1, 2 and 6unify avirulent (lentogenic and asymptomatic enteric) NDV.112

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕFigure 1. Phylogenetic tree constructed by NJ method of a 217 nucleotide bp of the F-gene. Bootstrap values (%) of the clades are indicated above the nodes. The analysedsamples (intestines, lungs and brain) are labeled with black dots. Numbers to the rightindicate the different lineages.ConclusionsBased on the investigations performed and results obtained, we could make thefollowing substantial conclusions:1. The new isolate NDV/pigeon/BG/Haskovo/2011 was classified as pigeonvariant (PPMV-1) of avian paramyxovirus type 1 (APMV-1).2. The virus belongs to the virulent pathotype of APMV-1 (NDV).3. The virus possess in vivo indices typical for NDV with intermediatepathogenicity (mesogenic strains).4. The phylogenetic analysis placed the strain in lineage 4, sublineage 4b.113

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYS5. Close relationship and identity with PPMV-1 strains from Europe, Asia andUSA were determined.Literature1. Aldous E.W., Alexander D.J., 2001. Detection and differentiation of Newcastle diseasevirus (avian paramyxovirus type 1). Avian Pathology, Apr.; 30 (2): 117 - 128.2. Aldous E.W., Mynn J.K., Banks J., Alexander D.J., 2003. A molecular epidemiologicalstudy of avian paramyxovirus type 1 (Newcastle disease virus) isolates by phylogeneticanalysis of a partial nucleotide sequence of the fusion protein gene. Avian Pathology,Jun.; 32(3): 239 - 256.3. Alexander D.J., 1998. Newcastle Disease and other Avian Paramyxoviruses. In:Swayne, D.E., Glisson J.R., Jackwood M.W., Pearson J.E. and Reed W.M. (Eds.). Alaboratory manual for the isolation and identification of avian pathogens, 4 th ed.;American Association of Avian Pathologists, 156 – 163.4. Alexander D.J., 2009. Еcology and epidemiology of Newcastle disease. In: Capua I.,Alexander D.J. (Eds.). Avian Influenza and Newcastle Disease. A field and laboratoryManual, OIE; 19 – 26.5. Beard, C.W. and Hanson R.P., 1984. Newcastle Disease. In: ―Diseases of poultry‖(Hofstad M.S., Barnes H.J., Calnek B.W., Reid W.M. and Yoder H.W., Eds.). 8 th ed.,Iowa State University Press: Ames, IA: 452 - 470.6. Commission of the European Communities, 1992. Council directive 92/66/EEC of 14July 1992 introducing Community measures for the control of Newcastle disease.Official Journal of European Communities, L260: 1 – 20.7. Coffee L.L., Hanson B.A., Luttrell L.P., Swayne D.E., Senne D.A., Goekjian V.H.,Niles L.J., Stallknecht D.E., 2010. Avian paramyxoviruses in shorebirds and gulls.Jornal of Wildlife Disease; 46(2): 481 - 487.8. Hadjiev G., 2002. Studies upon the basic characteristics of avian paramyxovirus type 1strains, isolated from pigeons in Bulgaria. Bulgarian Journal of Veterinary Medicine,5, No 1, 1 – 18.9. Hanson R.P. and Brandly C.A., 1955. Identification of vaccine strains of Newcastledisease virus. Science, 122: 156 - 157.10. Mayo M.A., 2002а. Virus taxonomy -/Houston. Archives of Virology, 147: 1071 -1076.11. Mayo M.A., 2002b. A summary of taxonomic changes recently approved by ICTV.Archives of Virology, 147: 1655 - 1656.12. Nidzworski D., Rabalski L., Gromadzka B., 2011. Detection and differentiation ofvirulent and avirulent strains of Newcastle disease virus by real-time PCR. J. Virol.Methods., Apr; 173(1): 144 - 149.13. OIE. Office International des Epizooties. World Organization for Animals Health,2009. Manual of diagnostic tests and vaccines for terrestrial animals, chapter 2.3.14.14. Reed L.J., Muench H., 1938. A simple method of estimating fifty per cent endpoints.The American Journal of hygiene, vol. 27, No 3; 493 – 497.15. Saitou N. and Nei M., 1987. The neighbor-joining method: A new method forreconstructing phylogenetic trees. Molecular Biology and Evolution 4: 406 - 425.16. Terregino C., Capua I., 2009. Conventional diagnosis of Newcastle disease virusinfection. In: Capua I., Alexander D.J. (Eds.). Avian Influenza and Newcastle Disease.A field and laboratory Manual, OIE; 123 – 126.17. Wise M.G., Suarez D.L., Seal B.S., Pedersen J.C., Senne D.A., King D.J., KapczynskiD.R., Spackman E., 2004. Development of a Real-Time Reverse-Transcription PCRfor detection of Newcastle disease virus RNA in Clinical Samples. Journal of ClinicalMicrobiology, vol. 42, No 1; 329 – 338.114

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕИЗОЛАЦИЈА И КАРАКТЕРИЗАЦИЈА ПТИЧЈЕГ ПАРАМИКСОВИРУСА –1 (АПМВ – 1) КОД ГОЛУБОВА У БУГАРСКОЈ 2011 ГОДИНЕTumbarski Y., Goujgoulova GabrielaКратак садржајУ септембру 2011. године Националној референтној лабораторији за инфлуенцу Аи Њукастл болест птица у Софији достављена су два леша дивљих голубова(Columba livia). Птице су пронађене мртве, заједно са осталих 50 голубова ублизини пијаце у граду Хасково у јужној Бугарској. Припремљени су узорци одмозга, плућа и црева достављених птица и материјал је инокулисан у алантоиснушупљину пилећих ембрионираних jaja старих 10 дана. Изоловани узрочник је даопозитивну реакцију хемаглутинације. Његова детерминација као вирус Њукастлболести АПМВ-1 (НДВ) одређена је преко теста инхибиције хемаглутинације саспецифичним имуним серумом на АПМВ-1. Даље истраживање и одређивањепатотипа вируса урађено је RT-PCR-ом. Редослед нуклеотида гена фузионогпротеина (Ф-ген) и место цепања Ф0 протеина показао је низ RRQKRF, штопотврђује да изолат припада вирулентном соју НДВ. Филогенетском анализомутврђено је да изолат припада сублинији 4б.Кључне речи: птичји парамиксовирус 1, голубови, изолацијаДр Yulian Tumbarski, доцент, шеф Националне референтне лабораторије за болест плавог језика,Одељење за егзотичне болести, Национални ветеринарско медицински институт за дијагностику иистраживње, Ломско бул.190, Софија, Бугарска, tumbarski@abv.bg115

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYSEPIZOOTIC RESEARCH OF AN AVIAN PARAMYXOVIRUS IN PIGEONS INREPUBLIC OF SERBIADimitrić A., Manić Marija, Petrović T., Đuriĉić BosiljkaIntroductionNewcastle disease (ND) is an infectious disease in large number of birds and man-it‘szoonoses. The causative agent of disease (paramyxovirus) is a virus who belongs tofamily Paramixoviridae-avian (avian paramyxovirus type-1, APMV-1) or Newcastledisease virus (NDV). The disease was first described in the 1926 th year on the island ofJava (Indonesia) and later in Newcastle in England, which is why it got it‘s name"Newcastle disease". Up to date, disease occurs at a large number of birds all over theworld, including our country. During recent years, Newcastle disease is eradicatedamong domestic poultry, but still occurs in pigeons. Pigeon‘s paramixovirosisrepresents the biggest problem for pigeon‘s breeders during last 30 years. In thecontemporary pigeonry this disease makes higher losses than all other diseasescombined. There is a great possibility for spreading this disease during a long and tiringcompetition season due to drop in the body's resistance pigeons, as well as due tomixing with other pigeons of different breeders during training and competition.Clinical picture of Newcastle disease at pigeons differs, depending on age, immunity ofbirds and pathogenicity of virus strains that causes an infection. Pigeons(Columbiformes) are mainly infected with pigeon strain paramyxovirus (pigeonparamyxovirus type-1, PPMV-1).Considering the number of domestic pigeons at breeders and number of wild of pigeonsin the Republic of Serbia, there was a clear need to establish the existence of thisdisease in pigeons and determine its prevalence in the Republic of Serbia.During 2012. in cooperation with associations of pigeons breeders, were performedepizootiological researches of health status at pigeons in the Republic of Serbia. Duringtesting were examined about 5000 birds on 26 locations whereby the emphasis is placedon the areas with the largest number of pigeons (Belgrade, Nis, Subotica, Novi Sad,Sabac, etc.).Aim - The aim of this paper was need to examine the general epizootiological situationof paramixovirosis distribution at pigeons in Serbia and monitoring of the epizooticsituation by using virological and clinical tests.Material and methods - During the study period, 124 samples of dead birds (brains)were collected. All samples were taken from pigeons who had presence of clinicalsymptoms that pointed to ND. Also, were taken blood sera of live, but clinically illbirds. Samples were analyzed virologically and serologically at the Department ofInfectious Diseases and bee diseases on Faculty of veterinarian medicine in Belgrade.Certification of APMV-1 was performed by PCR at the Virology Laboratory ofVeterinary Research Institute in Novi Sad.116

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕWork method for isolation of APMV-1 virus from taken material and blood sera of illbirds, was inoculation of testing material on chicken fibroblasts culture and inoculationof chicken embryos 9-11 days old. To confirm isolation of APMV-1 virus were usedhaemagglutination (HA) and hemagglutination inhibition (HI) test, as recommended bythe OIE (OIE Manual, 2008). As antigen for HA/IHA was used lentogenic strain ofNDV (La Sota, Veterinary Institute Zemun). Presence of APMV-1 viral genome wascertified by using PCR method (NIVS Novi Sad).Results - Based on results, applying virological, serological and molecular techniqueswas proven presence of APMV-1 on localities of Nis, Subotica and Sabac. Based onconducted clinical researches, obtained results shows a significant increas in diseaseoccurrence during autumn and winter months. From the total number of collectedsamples, 4.03% of them was collected in January, 1.61% in February, 7.24% in August,16,12% in September, 37.89% in October, 23.37% in November and 9.65% inDecember. Of the total number of birds with severe clinical symptoms, 85.48% wereyoung birds (up to one year old) and 14.52% were older birds, which indicates that theage is a significant risk factor in the emerging of disease in pigeons. Started researchesof APMV-1 should continue.Conclusion - In epizootiology of APMV-1 pigeons are an important link in the chainof occurrence, expansion and maintenance of this infection in the Republic of Serbia.Research is necessary to continue for the improvment of general perception of epizooticsituation on the field.*The work was done as part of Project 37015 Ministry of Science and Technological DevelopmentKeywords: Newcastle disease, avian paramyxovirus type–1 (APMV-1), pigeons,epizootic researchMr. sci Aleksandar Dimitrić, Veterinary Institute Subotica, Beogradski put 123; DVM Marija Manic, researchassistant, Dr. Sci. vet. med Bosiljka Djuricic prof., Department of infectious animal diseases and diseases ofbees, Faculty of Veterinary Medicine, Belgrade, Bul.oslobodjenja 18; Dr Tamaš Petrovic, ScientificVeterinary Institute Novi Sad, Rumenaĉki put 20Literature1. Aldous E. W., Alexander D. J., Technical review: detection and differentiation ofNewcastle disease virus (avian paramyxovirus type 1), Avian Pathology, (2001)30:117–128;2. Aldous E. W., Fuller C. M., Mynn J. K., Alexander D. J., A molecular epidemiologicalinvestigation of isolates of the variant avian paramyxovirus type 1 virus (PPMV-1)responsible for the 1978 to present panzootic in pigeons, Avian Pathology, (2004)33(2):258-269;3. Alexander D. J., Newcastle disease World Organisation for Animal Health Manual ofDiagnostic Tests and Vaccines for Terrestrial Animals, 6th ed, Chapter 2.3.14. OIE,Paris, 2008., pp 576-589;4. Alexander D. J., Parsons G., Protection of chickens against challenge with the variantvirus responsible for Newcastle disease in 1984 by conventional vaccination, VeterinaryRecord (1986) 118(7):176-177;117

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYS5. Alexander D. J., Russell P. H., Collins M. S, Paramyxovirus type 1 infections of racingpigeons: 1 characterisation of isolated viruses, Veterinary Record (1984)114(18):444-446;6. Biancifiori F., Fioroni A., An occurrence of Newcastle disease in pigeons: virologicaland serological studies on the isolates, Comparative Immunology, Microbiology andInfectious Diseases (1983) 6(3):247-252;7. Henning J., Morton J., Hla T., Meers J., Mortality rates adjusted for unobserved deathsand associations with Newcastle disease virus serology among unvaccinated villagechickens in Myanmar, Preventive Veterinary Medicine 85 (2008) 241–252;8. Hoque M. A., Burgess G. W., Karo-Karo D., Cheam A. L., Skerratt L. F., Monitoringof wild birds for Newcastle disease virus in north Queensland, Australia, PreventiveVeterinary Medicine, 103, 1, (2012), pp. 49–62;9. Kattenbelt J. A., Meers J., Gould A. R., Genome sequence of the thermostableNewcastle disease virus (strain I-2) reveals a possible phenotypic locus, VeterinaryMicrobiology 114 (2006) 134–141;10. Lamb R. A., Collins P. L., Kolakofsky D. et al., Family Paramyxoviridae, Fauquet CM,Mayo MA, Maniloff J et al (eds) Virus taxonomy, Eighth Report of the InternationalCommittee on Taxonomy of Viruses, Elsevier, San Diego, 2005., pp 655-668;11. Rauw F., Gardin Y., Palya V., Anbari S., Gonze M., Lemaire S., van den Berg T.,Lambrecht B., The positive adjuvant effect of chitosan on antigen-specific cellmediatedimmunity after chickens vaccination with live Newcastle disease vaccine,Veterinary Immunology and Immunopathology 134 (2010) 249–258;12. van Boven M., Bouma A., Fabri T. H. F., Katsma E., Hartog L., Koch G., Herdimmunity to Newcastle disease virus in poultry by vaccination, Avian Pathology,(2008)37:1, 1-5.ЕПИЗООТОЛОШКА ИСТРАЖИВАЊА ПОЈАВЉИВАЊА ПТИЧЈЕПАРАМИКСОВИРОЗЕ КОД ГОЛУБОВА У РЕПУБЛИЦИ СРБИЈИДимитрић А., Манић Марија, Петровић Т., Ђуричић БосиљкаУводNewcastle disease (ND) je заразна болест од које оболи велики број птица и човек–зооноза. Узрочник болести је вирус из фамилије Paramixoviridae–авијарнипарамиксовирус (avian paramyxovirus type–1, APMV-1) или вирус Њукастл болести(NDV). У савременом голубарству ово обољење прави веће губитке него сва другаобољења заједно. Постоји велика могућност ширења овог обољења у току дуге инапорне такмичарске сезоне услед пада отпорности организма голубова, као иуслед мешања голубова различитих одгајивача у току тренинга и такмичења.Клиничка слика код голубова оболелих од Њукастл болести се разликује зависноод старости, имунитета птица и патогености соја вируса који изазива инфекцију.Голубови (Columbiformes) се углавном заразе голубјим сојем парамиксовируса(pigeon paramyxovirus type-1, PPMV-1).Имајући у виду број голубова код одгајивача у Републици Србији, као и бројдивљих голубова, указала се јасна потреба за утврђивањем постојања овогобољења код голубова и његове преваленције на подручју Републике Србије.118

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕЦиљ рада - представља потребу сагледавања опште епизоотиолошке ситуације ораширености парамиксовирозе код голубова у Републици Србији и праћењеепизоотиолошке ситуације клиничким и вирусолошким испитивањима.Материјал и методе - Током испитиваног периода (2012.) прегледано је око 5000голубова на 26 локација при чему је акценат стављен на места са највећом бројемодгајивача голубова (Београд, Ниш, Суботица, Нови Сад, Шабац и друго) иприкупљено је 124 узорка угинулих голубова (мозгова) са израженим клиничкимсимптомима који указују на ND, као и крвни серуми од живих клинички оболелихголубова. Узорци су обрађени на Катедри за заразне болести и болести пчела наФВМ у Београду (вирусолошки и серолошки), а потврда APMV-1 урађена је ПЦРметодом у вирусолошкој лабораторији НИВ-а у Новом Саду.Метод рада је подразумевао изолацију вируса APMV-1 на култури пилећихфибробласта и инокулацију у пилеће ембрионе старе 9-11 дана. За потврдуизолације вируса APMV-1 из материјала и за преглед крвних серума од оболелихголубова коришћена је реакција хемаглутинације (ХА) и инхибицијехемаглутинације (ИХА) према препорукама ОИЕ (ОИЕ Мануал, 2008).Резултати рада - На основу добијених резултата вирусолошким, серолошким имолекуларним техникама доказано је присуство APMV-1 на локалитетима Ниш,Суботица и Шабац. На основу спроведених клиничких истраживања добијенирезултати показују на значајно повећање појаве обољења у јесењим и зимскиммесецима, тако да је од укупног броја узорака 4,03% прикупљено у јануару, 1,61%у фебруару, 7,24% у августу, 16,12% у септембру, 37,89% у октобру, 23,37% уновембру и 9,65% у децембру. Од укупног броја голубова са израженимклиничким симптомима, 85,48% су младе птице до годину дана старости, а14,52% су старије птице, што указује да је старост значајан фактор ризика унастанку обољења код голубова. Започета истраживања APMV-1 су настављена идаље.Закључак - У епизоотологији APMV-1 голубови су значајна карика у ланцупојаве, ширења и одржавања ове инфекције на простору Републике Србије.Започета истраживања неопходно је наставити ради бољег сагледавања општеепизоотиолошке ситуације на терену.*Рад је урађен у склопу Пројекта 37015 Министарства науке и технолошког развојаКључне речи: Newcastle disease, avian paramyxovirus type–1 (APMV-1), голубови,епизоотиолошка истраживањаMр.сци. Александар Димитрић, Ветеринарски завод Суботица, Београдски пут 123; Др вет мед МаријаМанић, истраживач приправник, Др сци. вет. мед. Босиљка Ђуричић ред. проф., Катедра за заразнеболести животиња и болести пчела, Факултет ветеринарске медицине, Београд, Булевар Ослобођења18; Др Тамаш Петровић, Научни институт за ветеринарство Нови Сад, Руменачки пут 20119

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYSPHYLOGENETIC ANALYSIS OF FOOT-AND-MOUTH DISEASE VIRUSTYPE O ISOLATED IN SOUTH EASTERN BULGARIA IN 2011Polihronova Lilyana, Alexandrov T., Tchakarova Simona, Zaharieva Krasimira,Filipov C., Georgiev G.AbstractFoot-and-Mouth Disease (FMD) outbreak in South Eastern Bulgaria was confirmed on04-th of January 2011, after a gap of more than 14 years. Phylogenetic analysis ofseveral isolates proved that the causative agent belongs to serotype O, ME-SA topotype,PanAsia-II strain of FMDV, recently circulating in the endemic area of Middle East andTurkey.In this study we present the results from sequencing and phylogenetic analyses ofseveral foot-and-mouth disease virus (FMDV) field isolates in order to identify theprobable source of infection on Bulgarian territory and molecular epidemiologicalrelationship between confirmed FMD cases.Key words: Foot-and-Mouth Disease Virus, sequencing, phylogenetic analysis, SouthEastern BulgariaLilyana Polihronova, Simona Tchakarova, Krasimira Zaharieva, National Diagnostic and Research VeterinaryInstitute, 1231, Sofia, Bulgaria; Tsviatko Alexandrov, Risk Assessment Center, Bulgarian Food SafetyAgency, Bulgaria; Chavdar Filipov, Animal Health & Welfare Directorate, Bulgarian Food Safety Agency,Bulgaria ; Georgi Georgiev, University of Forests, Veterinary Faculty, Sofia, BulgariaIntroductionFoot-and-Mouth Disease (FMD) is an infectious viral disease in cloven hoofed animalswith significant economical impact. The disease is endemic in many parts of Asia,Africa and South America and periodically affects Europe from these natural pools.Seven different serotypes of FMD virus exist (O, A, С, Asia1, SАТ1, SАТ2 and SАТ3),but serotype O is world‘s most predominant and is often responsible for devastatingepidemics in FMD free countries. (Knowles at al., 2001, Knowles at al., 2005)The FMDV genome consists of single strand positive RNA (8.3 Kb) with high mutationrate, (between 10 -1 and 10 -4 substitutions/nucleotide/year) due to errors of RNApolymerase in each replication cycle. (Domingo et all., 2003, Drake at al., 1999) Thesegenetic changes appear on random basis, 1 to 8 nucleotides (nt) per replication cycle(Domingo at al., 1995., Knowles at al., 2001) leading to progressive viral evolution andgenetic heterogeneity of the new population defining the quasispecies nature of FMDvirus.Sequencing and phylogenetic analysis are widely used for field strains characterizationand tracing of the infection source and transmission pathways during the FMDoutbreaks (Cottam at al., 2006, Cottam et al., 2008). The VP1 (1D) coding region is themost variable part of viral genome and its analysis has been used for many years to gainuseful information about the genetic relationship between different isolates (Carrillo et120

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕal., 2005, Knowles et al., 2003, Beck et al., 1987) However the VP1 (1D) represents lessthan 10% of entire viral genome and it doesn‘t allow high resolution analysis betweengenetically closely related viruses. Thus comparison of full genome sequences is morereliable tool for detailed genetic studies.On 4-th of January 2011 FMD case was detected in a wild boar, shot near to Kostivillage, 2 km north from the border with Republic of Turkey (42° 00‗409"N;27°46'49.33"E). Totaly three FMD outbreaks were reported until the end of January2011 in the villages of Kosti, Rezovo and Gramatikovo, all located in Tsarevo and M.Tarnovo municipalities, Burgas District. A second wave of outbreaks in 5 new villagesin the same district was reported more than one month later, between 19-th and 25-th ofMarch. (Fig. 1)This study is focused on molecular-epidemiological analysis of the relationshipsbetween different FMDV isolates, collected in South Eastern Bulgaria during FMDepidemic in January – March 2011 and tracing the possible source of infection andtransmission pathways between confirmed FMD cases, based on sequence data.The preliminary data shows that the causative agent belongs to serotype O, PanAsia-IIANT-10 sublineage of ME-SA topotype and has a close genetic relationship (99.84 –99.69% identity) with contemporary FMD type O strains isolated in 7 differentprovinces in Turkey in 2010. (Valdazo-González et al., 2011)Materials and methodsSamples and primers: The samples investigated in this study originated from 3different FMD outbreaks reported in Burgas region, South East of Bulgaria in January –March 2011, including the FMDV isolate from the wild boar (Fig.1) Detailed samplesdescription, including sample collection date and place of origin is given in Table 1.The L-P1 capsid coding region sequences (ca. 2814 nt) of 6 isolates (O/Kosti/1/2011,O/Kosti/2/2011, O/Rezovo/3/2011, Rezovo/4/2011, O/G. Bukovo/1/2011 and O/G.Bukovo/2/2011) and near full genome sequence (ca. 7500 nt) of 3 of them(O/BUL/2010, O/Kosti/1/2011 and O/Rezovo/3/2011) have been generated usingprimers listed in Table 2 (Preben Normann, DTU).RNA extraction, RT-PCR and sequencingTotal RNA was extracted directly from epithelium suspensions using QIAamp RNABlood Mini Kit (Qiagen, Germany), according to the manufacturer‘s instructions. RNAwas eluted in 50 µl water (DEPC) and subjected to cDNA synthesis using Ready-To-Go You-Prime First-Strand Beads Kit (GE Healthcare Life Science, Sweden) and 4-primers mix ע (5µl 100 NVT 24 + 5 µl 25 ‎8-Aע PN 63 + 5µl ע‎25‎ G 15 H + 85 µl 50ng/µlpdN6). The cDNA was subsequently diluted to 100 µl before use.Conventional PCR reaction of overlapping fragments was performed in 50 µl reactionvolume using 5 µl template, primers (5 pmol/µl ), 2.5 U AmpliTaq gold DNAPolymerase (AB), (10x) AmpliTaq buffer, MgCl2 (1,5 mM) and dNTP mix (25 mM).The following thermal profile was used: 95° C for 5 min (polymerase activation), 30cycles - 95° C for 15 sec, 60° C for 2 min and 72° C for 1 min and final extension stepat 72° C for 4 min.121

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYSThe PCR products (between 800 and 1000 bp) were subjected to gel electrophoresis(1,5 % agarose gel, 120 V, 30 min.) and then purified with Qiaquick gel extraction kit(QIAgen, Germany) using the manufacture protocol.Cycle sequencing PCR was performed in 10 µl reaction volume using BigDyeTerminator kit, v 1.1 (Appiled Biosystems), primers (Table 2) and thermal profile asfollow: 96° C for 20 sec, 25 cycles - 96° C for 10 sec, 50° C for 5 sec and 60° C for 4min. The reaction mix was purified with SigmaSpin sequencing reaction clean up kitand subjected to sequencing in automated DNA Sequencer (ABI PRISM 3500, AppliedBiosystems).The nucleotide sequences were aligned using Clustal W alignment and Neighbour-Joining phylogenetic tree was constructed using MEGA 5.0 software (Kumar et al.,2008). The robustness of the tree topology was assessed with 1000 bootstrap replicates.Pairwise comparison was done and genetic distance between isolates was calculatedusing Kimura 2-parameter model (Kimura, M., 1980).Results and discussion:Sequencing data and phylogenetic analysis - In the present study L-P1 sequences (ca.2814nt) of 6 FMDV isolates (O/Kosti/1/2011, O/Kosti/2/2011, O/Rezovo/3/2011,Rezovo/4/2011, O/G. Bukovo/1/2011 and O/G. Bukovo/2/2011) and near full genomesequence (ca. 7500nt) of 3 representative isolates (O/BUL/2010, O/Kosti/1/2011 andO/Rezovo/3/2011) were generated in order to define strains characteristics and toanalyze the molecular - epidemiological relationship between FMD cases in Bulgaria in2011. The samples originated from 3 infected premises (Kosti, Rezovo and GolyamoBukovo villages) in Burgas district, South-Eastern Bulgaria and the FMDV isolate fromthe wild boar. (Table 1).The sequence data was compared with the data available in GenBank database(http://www.ncbi.nlm.nih.gov/) using BLAST analysis to access the percentage ofidentity between the FMDV strains. The phylogenetic analysis shows that the currentisolates belong to Middle East – South Asia (ME-SA) topotype, PanAsia-II lineage ofFMDV serotype O, responsible for major FMD epidemics in the region of Middle Eastand Turkey.Molecular analysis of the sequences encoding VP1 capsid protein region revealed closegenetic relationship between O/BUL/2010 virus and isolates from Iran (O/Iran/1/2010 -HQ450645) (98,4% identity) and Turkey (Anatolia) in 2010 (99% identity) indicating acommon origin and they belong to the same genetic sublineage within Pan Asia II strainof the ME-SA topotype (Fig.2).The sequence of the VP1 (1D) coding region shows 99.8% identity betweenO/BUL/2010, isolated from the first case of FMD in wild boar and Kosti isolates and99.5% identity with Rezovo isolates supporting the epidemiological enquiry data,defining Kosti village as an earlier case and Rezovo as a second outbreak. Continuousvirus replication in susceptible population leads to 0.3 % genetic distance within VP1region between Kosti and Rezovo isolates. The phylogenetic analysis does not showclear epidemiological link between these two outbreaks and different scenarios arepossible, including FMD virus replication in wild animal populations. Nevertheless thequasi-species nature of FMD virus together with the short infectious period (less than 1month) limits the potential for detailed analysis of transmission pathways and does not122

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕallow clearly definition of epidemiological relations between the cases. Coming back tothe history, the Bulgarian isolate (O/BUL/1/96) from the previous FMDV outbreak in1996 is closely related with Turkish isolate O/TUR/1/96 with 99% identity. This twoisolates together with isolate from FMD epidemic in Greece during that time(O/GRE/18/96) are situated in the same cluster, indicating common origin (Fig 2).There is considerable interest from an epidemiological point of view in sequence resultsof the 2 samples, originated from a new wave outbreak in Golyamo Bukovo village,reported on 25 March 2011, more than one month later than the first two cases in Kostiand Rezovo.Pairwise comparison of the percentage nucleotide identities shows only 2 nucleotidesubstitutions (transitions) within VP1 region (table 3) between the recent isolates fromGolyamo Bukovo village (O/G. Bukovo/1/2011 and O/G. Bukovo/2/2011) andO/Kosti/2/2011, corresponding to 0.5% genetic distance. The previous isolates fromRezovo village have 0.8% distance with Golyamo Bukovo with 5 nucleotidesubstitutions in VP1 region.The L-P1 sequences (2814 nt) of these samples were generated and compared with theprevious isolates (Kosti/1/2011 and Rezovo/3/2011) as well as the isolate from the wildboar (O/BUL/2010).In total 12 nucleotide substitutions within the L-P1 region were found between Gol.Bukovo isolates and the initial case of wild boar (O/BUL/2010). All substitutions (table4) are transitions and may not have consequences to the chemical and antigenicstructure of viral isolates.Pairwise comparison shows 0.4% genetic distance between G. Bukovo/2/2011 andKosti/1/2011 and 0.5% between G. Bukovo/2/2011 and O/Rezovo/3/2011 respectively.According to these data the FMDV isolate from the second wave outbreak in G. Bukovodiffers from the first two isolates from Kosti and Rezovo villages and wild boar isolate(O/BUL/2010) which belongs to the common cluster (Fig.3).The genetic analysis doesn‘t reveal clear consequence between these 3 confirmed FMDoutbreaks in Bulgaria in almost 3 months period between January – March 2011.Sequencing information combined with the epidemiological inquiry data suggests thatthe FMD epidemic is as a result of continuous virus replication in susceptiblepopulation (wild or domestic animals) or probably due to different virus incursion onBulgarian territory.Comparison of the near complete genome sequences (7582 nt, lacking some of the 5‘terminal region of the 5‘ UTR) of Kosti and Rezovo isolates shows 0.2 % geneticdistance of these two isolates with the initial case in wild boar. These Bulgarian isolatesshow close relationship but still belong to different genetic lineages with FMDV, type Oisolates from Pakistan - O/ISL/PAK/L1573/2009 (HQ 113232) and O/PAK/48/2008(GU384683), with 92% identity in both cases (Fig.4).Conclusions - The phylogenetic analysis of sequence data generated in this studyclearly shows that the causative agent (FMDV) responsible for FMD outbreaks inBulgaria in 2010/2011 belongs to ME-SA topotype, PanAsia-II strain of serotype O ofFMDV. Close genetic relationship was revealed between current Bulgarian isolates andsome FMD type O viruses circulating in the endemic area of Middle East (Turkey, Iranand Pakistan) between 2008 - 2010.123

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYSThe genetic analysis does not reveal clear consequence between confirmed FMDoutbreaks in Bulgaria in almost 3 months period between January – March 2011.Sequencing information combined with the epidemiological inquiry data suggests thatthe FMD epidemic is a result of undetected continuous virus replication in susceptiblepopulation (wild or domestic animals) or probably due to different virus incursions onBulgarian territory which can be confirmed by TCS (Statistical Parsimony) analysis.AcknowledgementThe current study have been performed under IAEA Fellowship (BUL 09011) with thekind support of prof. Graham J. Belsham and Preben Normann from the NationalVeterinary Institute, Technical University of Denmark, Lindholm where the sequencingdata was generated and Dr Syed M. Jamal from the National Veterinary Laboratory,Islamabad, Pakistan for the methodological review.References1. Beck E, Strohmaier K (1987). Subtyping of European foot-and-mouth disease virusstrains by nucleotide sequence determination. J Virol., 61:1621–1629.2. Carrillo, C., Tulman, E. R., Delhon, G., Lu, Z., Carreno, A., Vagnozzi, A., Kutish, G.F.and Rock, D. L (2005). Comparative genomics of foot – and - mouth disease virus. J.Virol., 79: 6487-6504)3. Cottam, E. M., Haydon, D. T., Paton, D. J., Gloster, J. Wilesmith, J. W., Ferris, N. P.,Hutchings, G. H. & King, D. P (2006). Molecular epidemiology of the foot-and-mouthdisease virus outbreak in the United Kingdom in 2001. Journal of Virology 80, 11274-112824. Cottam, E. M., Wadsworth, J., Shaw, A. E., Rowlands, R. J., Goatley, L., Maan, S.&others (2008). Transmission pathways of foot-and-mouth disease virus in the UnitedKingdom in 2007., PLoS Pathogens, 4(4)5. Domingo E., Cristina Escarmı , Eric Baranowski,Carmen M. Ruiz-Jarabo , ElisaCarrillo, Juan Ignacio Nunez , Francisco Sobrino (2003) . Evolution of foot-and-mouthdisease virus. Virus Research., 91: 47 - 636. Domingo E, Dopazo J, Rodrigo MJ, Rodriguez A, Saiz JC, Sabrino F. Aphthovirusevolution. In: Gibbs AJ, Calisher CH, Garcia-Arenal F (1995). Molecular basis of virusevolution. Cambridge University Press; p. 310–207. Domingo, E., Baranowski, E., Escarmis, C. and Sobrino, F (2002). Foot-and-mouthdisease virus. Comp. Immunol. Microbiol. Infect. Dis., 25: 297-308.8. Drake, J. W. and Holland J (1999). Mutation rates among RNA viruses. Proc. natl.Acad. Ent Sci. USA., 96: 13910-13913.9. Kimura, M (1980). A simple method for estimating evolutionary rate of basesubstitutions through comparative studies of nucleotide sequences. J. Mol. Evol. 16,111–120.10. Knowles, J., Samuel, A.R., Davies, P.R., Kitching, P., Donaldson, A.I (2001). Outbreakof foot-and-mouth disease virus serotype O in the UK caused by a pandemic strain. Vet.Rec. 148, 258–259.11. Knowles, N. J. and Samuel, A. R (2003). Molecular epidemiology of foot-and-mouthdisease virus. Virus Res., 91: 65-80.12. Knowles, N.J., Samuel, A.R., Davies, P.R., Midgley, R.J., Valarcher, J.-F (2005). Pan- demicstrain of foot-and-mouth disease virus serotype O. Emerg. Infect. Dis. 11 (12), 1887–1893.13. Kumar S., Masatoshi Nei, Joel Dudley and Koichiro Tamura and MEGA: (2008). A biologistcentricsoftware for evolutionary analysis of DNA and protein sequences. Briefings inbioinformatics, Vol. 9. No 4, April 16124

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕ14. Valdazo-González B., Nick J. Knowles, Jemma Wadsworth, et al. (2011). Foot-and-mouth diseasein Bulgaria., Veterinary Record, March 5, 2011, 168: 247)Table 1. Details of the samples used in the present studySamplenumberDate ofsamplecollectionSample typeAnimalspeciesPlace of origin(village)O/BUL/2010 30/12/2010 epithelium tissue wild boar Makevtzi, KostiO/Kosti/BUL/1/2011 14-01-2011 epithelium tissue bovine KostiO/Kosti/BUL/2/2011 14-01-2011 epithelium tissue bovine KostiO/Rezovo/BUL/3/2011 16-01-2011 epithelium tissue bovine RezovoO/Rezovo/BUL/4/2011 16-01-2011 epithelium tissue bovine RezovoO/G. Bukovo/BUL/5/2011 25-03-2011 epithelium tissue bovine Golyamo BukovoO/G. Bukovo/BUL/6/2011 25-03-2011 epithelium tissue bovine Golyamo BukovoBurgas Municipality, South-East Bulgaria, January - March 2011Table 2. Oligonucleotide primers used for sequencing of L-P1 region or near completegenome of FMDV (Preben Normann, DTU)Primer Primer sequence(5’ – 3’)Sense Genomeposition *Genomeregion8-A PN 3 GGCTAAGGATGCCCTTCAG forward 937 P18-A PN 4 AACCAGTCXTTCTTXTGXGTG reverse 1880 P18-A PN 34 ATGGACACXCAGCTTGGTGAC forward 1797 P18-A PN 124 GCCTCAGCCACATCAAGG reverse 2746 P18-A PN 51 CCACAGATCAAGGTGTATGC forward 2532 P111- F PN 41 CGGGGTCAGCTGACTCACC reverse 3276 P111-F PN 28 GGGCCCAGGGTTGGACTC reverse 3936 P111-F PN 29 GCXGCXGACTACGCXTACACYGC forward 3093 P18-A PN 2 GTCXCCTATTCAGGCXTAGAAG reverse 1033 CG8-A PN 35 GAGAAANGGGACGTCNGCGC reverse 565 CG8-A PN 45 GGAAGAAACTCGAGGCGAC reverse 4356 CG9-F PN 24 AGGGCCGAAACATACTGCC forward 3807 CG8-A PN 22 AAGGACCCXGTCCTTGTGGC forward 4191 CG8-A PN 23 CCGTCXAAGTGGTCAGGGTC reverse 4842 CG8-A PN46 TGGTCGTTTGCCTCCGTGG forward 4723 CG8-A PN 87 CTCAAAGAATTCAATTGCTGC reverse 5433 CG8-A PN99 TGTACCAXCTTGTTXAXGAGGTG forward 5299 CG9-X PN 9 CTTTXAGAGGTXTCTGACGCTC reverse 5922 CG8-A PN 14 ATCTCXAACTCAAACACTCTG reverse 6245 CG8-A PN 113 CGCGAXACTCGCAAGAGAC forward 5601 CG8-A PN80 GGAGTGTTTGGCACTGCC forward 6147 CG9-X PN 16 GCGGGTCCTTGTTGGACA reverse 6799 CG8-A PN 79 TGGGTTGCAACCGACCGC reverse 7339 CG8-A PN 100 CCACACCATGAAGGGTTG forward 6672 CG8-A PN 17 CTGAAGGACGAXXTXCGXCC forward 7170 CG8-A PN 52 GGAXTGACCAAGAACAAAACC reverse 7800 CG1-A TBR 1 E GAGCTGGACACTTACACCATGATCTC forward 7662 CG*- primers genome position is according FMDV reference strain O/UKG/35/2001(AJ539141).125

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYSTable 3. Nucleotide substitutions positions observed in the VP1 fragment of FMDVisolates. Reference strain O/UKG/35/2001 (AJ539141)Genome positions of nucleotideFMDV isolates:substitutions (VP1)71 273 419 589 621O/BUL/1/2010 T T G A AO/Kosti/BUL/1/2011 T T G A AO/Rezovo/BUL/3/2011 C T G G GO/G. Bukovo/BUL/5/2011 T C A A AO/UKG/35/2001 (AJ539141) T T G A ATable 4 Nucleotide substitutions positions observed in the L-P1 fragment of FMDVisolates. Reference strain O/UKG/35/2001 (AJ539141)FMDV isolates:Genome positions of nucleotide substitutions (L-P1)6949284910831101147316321788211422432445259127612793O/BUL/1/2010 A T C C G T A A T T T G A AO/Kosti/BUL/1/2011O/Rezovo/BUL/3/2011O/G.Bukovo/BUL/5/2011O/UKG/35/2001(AJ539141)A C T C G T A A C T T G A AA C T C G T A A T C T G G GG C T T A C G G T T C A A AA C T T G T G A T T T C A G126

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕFig.1 Location of the FMD outbreaks in South Eastern Bulgaria, in the periodJanuary – March 2011 from which the FMDV isolates included in this studyoriginated.Fig. 2 Neighbor-joining tree (MEGA 5), showing the relationship between FMDV, typeO isolates in Bulgaria 2010 – 2011, based on the VP1 coding region nucleotidesequences. The isolates marked with triangles originated from the first 2 outbreaks,reported in January 2011 and those with circle - from an second wave outbreak inGolyamo Bukovo confirmed on 25 March 2011. The first FMDV isolate from wild boar(O/BUL/2010) and some other FMDV type O isolates (1969 – 2010) are included inthis analysis.127

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYSFig. 3 Neighbor-joining tree (MEGA 5), showing the relationships between FMDVisolates in Bulgaria between Jan – March 2011, based on L-P1 nucleotide sequences.FMDV type O isolate (O/BUL/2010) from the initial case in wild boar (2010) isincluded.Fig. 4 Neighbor-joining tree (MEGA 5), showing the relationships between FMDVisolates in Bulgaria 2010 – 2011 (marked with triangles), based on near full genomenucleotide sequences. Some other FMDV type O isolates between 2001 – 2009 areincluded.ФИЛОГЕНЕТСКА АНАЛИЗА ТИП О ВИРУСА СЛИНАВКЕ И ШАПАИЗОЛОВАНОГ У ЈУГОИСТОЧНОЈ БУГАРСКОЈ У 2011. ГОДИНИLilyana Polihronova, Tsviatko Alexandrov, Simona Tchakarova, KrasimiraZaharieva, Chavdar Filipov, Georgi Georgiev 4Кратак садржајЦиљ: Последња појава слинавке и шапа (СиШ) у југоисточној Бугарској јепотврђена 04. Јануара 2011. године, након више од 14 година како је забележенпоследњи случај појаве ове болести. Свих 11 локалитета на којима је забележенапојава болести до краја априла 2011. год. се налазе на југу, у близини границеизмеђу Бугарске и Турске.У овом раду су приказани резултати секвенционирања и филогенетске анализенеколико изолованих дивљих сојева вируса слинавке и шапа, са циљемидентификације највероватнијег извора инфекције на територији Бугарске, као иутврђивање везе између потврђених случајева болести, применом молекуларноепидемиолошкихметода.Материјал и методе: Узорци који су прегледани у току овог истраживања потичуса три различита подручја где је дошло до избијања СиШ-а. То су подручја уоколини Бургаса, у југоисточној Бугарској, а случајеви болести су се појавили упериоду од јануара до марта 2011. године. L-P1 секвенца (ca.2814nt) од 6 СиШизолата (О/Kosti/1/2011, O/Kosti/2/2011, O/Rezovo/3/2011, Rezovo/4/2011, O/G.Bukovo/1/2011 и O.G. Bukovo/2/2011) и скоро цела геномска секвенца (ca.7500nt)128

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕoд 2 репрезентативна изолата (О/Kosti/1/2011 и O/Rezovo/3/2011 су испитани какоби се дефинисале карактеристике ових сојева и анализирала молекуларноепидемиолошкавеза између појаве слинавке и шапа на различитим локалитетимау Бугарској, током 2011. године.Резултати и закључци: Упоређивањем скоро комплетног генома секвенци Kostiи Rezovo изолата, резултати показују 0,2% генетичке удаљености ових изолата уодносу на почетни сој, који је изолован од оболелог дивљег вепра. Ови бугарскиизолати показују велику повезаност, али ипак припадају различитим генетскимлинијама СиШ-а типа О, који је изолован у Пакистану-О/ISL/PAK/L1573/2009(HQ 113232) и O/PAK/48/2008 (GU384683), са којимa имају 92% поклапања у обаслучаја.Филогенетске анализе неколико изолата су потврдиле да узрочник припадасеротипу О, МЕ-SA топотип, PanAsia-II сој FMDV-а, који у последње времециркулише на територији средњег истока Европе и Турске.Кључне речи: вирус слинавке и шап-а, секвенционирање, филогенетске анализе,југо-источна БугарскаLilyana Polihronova, Simona Tchakarova, Krasimira Zaharieva, Национални ветеринарски институт задијагностику и истраживања, 1231, Софија, Бугарска , Georgi Georgiev, Директорат за здравље идобробит животиња, Бугарска Агенција за безбеднст хране, Софија, Бугарска; Tsviatko Alexandrov,Универзитет за шуме, Факултет ветеринарске медицине, Софија, Бугарска ; Chavdar Filipov, Центар запроцену ризика, Бугарска Агенција за безбеднст хране, Софија, Бугарска129

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYSDETECTION, IDENTIFICATION AND CHARACTERIZATION OF AVIANINFLUENZA VIRUS SUBTYPE A BY STANDARD AND BIOMOLECULARVIRUSOLOGICAL TECHNIQUESŠekler M., Vidanović D., Polaček V., Vasković N., Kurćubić V., Obradović S.AbstractAim and objectives of this study are to show the whole diagnostic procedure in order toconfirm the presence of Avian Influenza virus,subtype H5N1, with special emphasis onits later characterization and biomolecular features assay by applying biomoleculartechniques: RT- PCR technique,real time RT- PCR and the process of avian influenzavirus sequencing.For material we used some of the Avian influenza virus isolates , which are placed invirus collection of National Reference laboratory of Republic of Serbia for AvianInfluenza and Newcastle disease of birds and poultry, while they are in SpecialisticVeterinary Institute „ Kraljevo „. During performance of diagnostic tests we usedantigens and antiserum ,which we got from OIE reference laboratory in Waybridge,while primers and tests, as well as protocols for conducting PCR,real time RT-PCR andsequencing, are performed in accordance with recomendation of the very samereference laboratory,i.e. reference studies from this field.The results we have got werediscussed, with special notes considering obtained biomolecular characteristicswhichshow high pathogenicity of analyzed virus isolates. In our conclusions, we brought outadvantages of biomolecular techniques comparing to standard virological techniques.Key words: Avian influenza virus, Subtype A, biomolecular, virusological techniquesDr Milanko Šekler, PhD, dr Dejan Vidanović, dr Vladimir Polaĉek, mr.sci Nikola Vasković, SpecialistVeterinary Institute ―Kraljevo―, Zicka 34, 36 000 Kraljevo, dr Vladimir Kurćubić, Faculty of Agronomy,Ĉaĉak, doc.dr Saša Obradović, Faculty of economy and engineering management, Novi Sad;IntroductionAvian influenza is highly contageous viral disease of birds, which can also betransmitted to humans, as well as to many other domestic and wild animals. The causalagent is Influenza virus type A, which is characterized by high instability in terms ofability and frequency of alteration in degree of pathogenicity and mutation. Since 1997,when the disease caused by strain H5N1, was registered on the poultry farm in HongKong , and when as a direct result , we evidenced outbreak in humans,with fataloutcome , avian influenza became constant threat to poultry,as well as humanpopulation all over the world. Considering level of society development, nutritive andlife habits, mode in breeding poultry and birds,avian influenza got its greatest expansionon the Far and The Middle East, with South Asia as a ― focus― , in a broader sense, withsporadically outbreak on other continents ( Europe, Africa). Spreading of avianinfluenza from Asia towards west (Europe) is connected to migratory birds as vectorsand virus reservoirs. Thereby some of the wild birds species can be virus carriers but130

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕwithout manifestation any clinical signs of illness, like some wild ducks, which presentsa huge problem for early detection and prevention of spreading this disease. We shouldnot neglect illegal transportation of animals (poultry and wild birds) and poultryproducts,as one more way of transmission of this disease.The first outbreak of HPAI ( Highly Pathogenic Avian Influenza) was evidenced inItaly in 1878. and it was called . After that outbreak was evidenced innorthern Italy,and by infected poultry the disease spreaded to eastern Austria,Germany,Belgium and France. During that period there wasn't any knowledge about type ofcausal agent until 1901. when it was confirmed that the causal agent was filtrabilityagent. At the beginning of the 20th century outbreak is evidenced on almost allcontinents,besides Australia. Although geographically widely prevalenced, HPAI wasrare disease by 2003, with only 21 cases registered since 1959, and without epidemicrange.The attention of world public HPAI started to capture after outbreak in HongKong in 1997, caused by strain H5N1 during which 18 people was affected, of which 6cases ended fatal. There is a rule for influenza virus- they are highly specific for speciesand that extremely rarely they > barrier of species. Consequently,until recentlycases of humans infected by avian influenza virus were so rare that since 1959 to 1997only ten such cases were documented. Among the first described was the case from1959 by a man who came back from Africa, and by whom was confirmed presenceH7N7 subtype; than case of several people who were infected in 1978, with clinicallyexpressed conjuctivitis ,and who were in direct contact with affected seals caused by thesame subtype (H7N7), as well as conjuctivitis with woman which was caused by AIvirus which was transmitted from waterfawls which were in her yard. Avian influenzavirus transmission from animals to humans is very rare in nature, especially if we takein consideration number of affected birds,and that is tens of millions of birds around theworld. This is supported by the fact that 622 cases of infected people were laboratoryconfirmed, and of that number 371 cases ended fatal from 2003 to March 12,2013.Analysis of all registered cases refers to necessarily close contact of affected with deador affected poultry unit. Before all those are people engaged in thecare,feeding,slaughtering and preparation of food originated from infected poultry,aswell as people who live in direct environment of the birds,which is part of their lifehabits,tradition,customs and/or existential needs. It is also confirmed that the biggestnumber of cases was recorded in rural and periurban environment. Besides directcontact with affected birds as possible ways of transmission virus to humans ,there isalso a contact with contaminated faeces, water where virus attained through dead birdsand ― half-domestic― birds such as pigeons.Aim and objectives - To show the whole diagnostic procedure in order to confirm thepresence of Avian Influenza virus,subtype H5N1, with emphasis on its latercharacterization and biomolecular features assay by applying biomolecular techniques:RT- PCR technique,real time RT- PCR and the process of avian influenza virussequencing,which we conducted on some Avian influenza virus isolates , which areplaced in virus collection of National Reference laboratory for Avian Influenza andNewcastle disease of birds and poultry of Republic of Serbia, while they are inSpecialistic Veterinary Institute „ Kraljevo―.131

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYSMaterial and methodMaterial - We got antigene and positive antiserum for haemagglutination inhibition testfrom OIE and FAO reference laboratory for avian influenza,which is in Waybridge,Great Britain(Veterinary Laboratory Agency, VLA, New Haw, Addlestone, Surrey, KT15 3NB, UK ).Method - Isolation and identificationOrgans and bowels of died birds were homogenized with addition of PBS withantibiotics. Product of homogenization wass then centrifuged ,and supernatant was usedfor chicken embryos, 9 days old, inoculation. Embryos were incubated at 37 C andlamped every day.All embryos died very quickly, within 48 hours, so due to situation there was a realquestion if there were existence of potential bacterial contamination at procedure ofperforming inoculation itself.After opening of chicken embryos samples of allantioc fluid were taken and weconducted haemagglutination test in titration on it. We got haemagglutination titer from1: 64 to 1: 256.Out of allantoic fluid with such a haemagglutination activity we conductedhaemagglutination inhibition test by using reference antiserums (Waybridge,UK). Wegot haemagglutination inhibition titer in the amount of 1: 128.Conducting allantioc fluid titration in which we doubt there is avian influenza vitustype A subtype H5A. Pour 0,025 microlitre of PBS in each microtiter plate well with V baseB. Pour 0,025 microlitre of virus H5N1 ( antigene) suspention in the first wellC. Make double dilution series of H5N1 virus in corresponding sequence of wells,where in the first well we previously instill antigene ( or virus) so that 0,025microlitre of virus, of specific dilution, remain in each well.D. Pour again 0,025 microlitre of PBS in each well.E. Pour 0,025 microlitre of 1% erythrocytes dilution in each well.F. Carefully shake the plate and leave it for 40 minutes at the room temperature(at about 20 C). As control for sedimentation of erythrocytes we use sequenceof wells where we instill PBS dilution and erythrocytes.G. Virus (antigene) titer,i.e. haemagglutination unit is determined as the highestvirus dilution in which by correction of microtiter plate we achieve completeconfluence of erythrocytes in tear shape,as well as in control wells where weonly instill PBS dilution and 1% erythrocytes. With the simple countdown ofdilutin from the first well in which dilution is 1:2, we got virus titer in onehaemagglutination unit.H. We determined 4 HU (haemagglutination unit) by counting 2 places (wells)backward from the last highest dilution , i.e. left (in the first well backwardthere are 2 HU) and in the next one there are 4 HU.I. For haemagglutination inhibition test we are going to use that virus dilution asthe cuurent one, i.e. as the one which has 4 HU as provided by this protocol.Conduction of haemagglutination inhibition test to the presence of AI virus subtypeH5132

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕA. Pour 0,025 microlitre of PBS in each microtiter plate well with V baseB. Pour 0,025 microlitre of examining blood serums in the first wells of eachsequence of microtitre plateC. Make double dilution series of blood serums using deluters, as in the previousvirus titration ( look step C in the previously described haemagglutination orvirus titration textD. above)E. Pour by 4 HU antigene (H5N1 virus) in the amount of 0,025 microlitre in eachwell of examining blood serums, including positive and negative control, andleave them at the room temperature ( at about 20 C) at least 30 minutes.F. Pour by 0,025 microlitre of 1 % of erythrocytes dilution in each well and thengently shake ( making sure there isn't outflow of the content from the well,theirmixing and transition to other wells) and leave them at the room temperature atleast 40 minutes.G. Value of haemagglutination inhibition titre is determined as the highestdilution of examining blood serum , in which there is completehaemagglutination inhibition of erythrocytes, and we evaluate it by correctingthe plate and by evident confluence of erythrocytes at approximately the sameway as in the control wells ( only erythrocytes and PBS dilution).H. Validation of the test results is achieved by assessment of negative control ofthe blood serum which can't have titre higher than 1:4, and positive controlserum must have titre within one unit of the titre which is already known.I. Haemagglutination inhibition titre should be assessed as positive only if bloodserum dilution had expressed inhibition in titre equal or higher than 1: 16.Biomolecular techniques in identification and characterization of avian influenzavirus subtype H5a ) Real time PCR - RNA AI virus is extracted from allantoic fluid with the help ofQIAamp viral RNA mini kit (Qiagen, USA), with the complete compliance with themanufacturer's instructions.Real time RT-PCR is conducted with the help of One step RT-PCR kit (Qiagen, USA)complying with the manufacturer's instruction, and by using special primers and probesdesigned for detection of subtype H5 (procedure of the reference laboratory VLA,UK)b) Genome sequencing - For AI virus subtype H5 sequencing it is used One step RT-PCR kit ( Qiagen, USA) and specific primers kha1 and kha 3. PCR reaction product isabstracted by QiaQuick Gel Extraction kit ( Qiagen, USA), and sequencing reaction isconducted separately with kha1 and kha 3 primers. Sequencing product is abstractedethanol by EDTA method.Sequences are read on genetic analizer AB 3130 and processed by Sequencing Analyses5.2. software. Nucleotide sequences we got are transcribed into aminoacidsequencesnwhich are coded by EMBOSS transeq. programme.Results and discussion - Results of the analysis for nucleic acid presence with avianinfluenza virus subtype H5 by applying biomolecular technique real time RT-PCR133

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYS(Picture 1.) and its reading on Stratogene (USA) aparatus,from four avian influenzavirus subtype H5 isolates.Picture 1.By real time RT-PCR technique we can see four sigmoidal lines of amplification ofnucleic acid for four izolaza avian influenza virus subtype H5 by using primersrecomended by OIE and EU reference laboratory in Waybridge,UK.Picture 2.Results of the analysis for nucleic acid presence with avian influenza virus subtype H5by applying biomolecular technique of classical real time RT-PCR in gel(electrophoresis system- Biorad) and aparatus for reading results of electrophoresis Gel-Doc (Biorad) (Picture 2.). Notice band on the right hand which consists ofapproximately 300bp and which represents positive finding characteristic for presenceof avian influenza virus subtype H5.Sequences are read on genetic analyzer AB 3130 and processed by Sequencing Analysis5.2. software. The sequences of nucleotid are transcribed into aminoacid sequencewhich are coded by EMBOSS transeq. programme.Results processede through EMBOSS programme where we can see structure which is akey one for determination of pathogenicity of the virus, in other words whether it is highor low pathogen avian influenza virus. At so-called haemagglutinin (H) cleavage site itis necessary to find basis amino acids as many as possible, and in that way virulenceand pathogenicity of the virus is higher marked.On this sequence display (Pictures 3.and 4.) where you can see amino acid order, site of cleavage is on the right hand at thebottom of the picture, and it is represented by broad vertical blue tab, and which is, as134

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕyou can see completely identical for all six sequencing avian influenza virus subtypeH5.Picture 3.Amino acid order at the cleavage site of HA protein which we got is RRRKKR-GKF,shows that it is highly patogenic strain of avian influenza virus subtype H5, thevery same type which caused mortality of birds on Quinghai lake (China) inMay,2005,which is considered to be beginning of spreading this virus towards and inEurope.Picture 4.TIMKSKLEYGNCNTKCQTPIGAINSSMPFHNIHPLTIGECPKYVKSNRLVLATGLRNSPQGERRRKKRGLFGAIAGFX.Conclusions - Molecular diagnostic techniques covers presence of nucleic acid at avianinfluenza virus diagnostic. They reached expected and satisfactory level of specificityand sensitivity and they present practically unavoidable tool in diagnostic of thisdangerous disease and potentially dangerous zoonosis.Speed at which we can perform entire procedure of testing by applying moleculartechniques at presence of nucleic acid in avian influenza virus and it presents importantadvantage which this molecular technique demonstrates.In other words this disease canbe detected significantly earlier than by classical isolation techniques and latervirusological-serological identification ( haemagglutination inhibition by which weprove presence of the virus in allantoic fluid), therefore we can significantly earlier startimplementation of legal actions at the procedure of controling and eradication of thisdangerous zoonosis.Those several days,perhaps even weeks are crucial in speed atwhich we can control further spreading of disease.135

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYSBy molecular technique of sequencing PCR product of avian influenza virus,you cansuccessfully and quickly determine virulence of avian influenza virus for a few hours,which is ten times faster than standard procedure (cerebral pathogenicity index inchickens or intravenuos pathogenicity index in chickens). This can be crucial in processof successful control and eradication of this disease.By sequencing we can determine whether the virus is high or low pathogenic, instandard laboratory conditions. The risk of performing intracerebral pathogenicity indextest is lower,not to mention that it must be conduced in special conditions, withengaging more people, more work,clearly defined procedures,etc. Considering thatavian influenza virus can also be transmissed airborne and that always representspotentially dangerous zoonosis,we shouldn't point out that this is easier and morepractical way for determination of this virus pathogenicity.136ДЕТЕКЦИЈА, ИДЕНТИФИКАЦИЈА И КАРАКТЕРИЗАЦИЈА ВИРУСААВИЈАРНЕ ИНФЛУЕНЦЕ ПОДТИПА H5 СТАНДАРДНИМ ИБИОМОЛЕКУЛАРНИМ ВИРУСОЛОШКИМ ТЕХНИКАМАШеклер М., Видановић Д., Полачек В., Васковић Н., Курћубић В., Обрадовић С.Кратак садржајЦиљ и задаци рада су да прикажемо целокупан дијагностички поступакдоказивања присуства вируса авијарне инфлуенце подтипа Х5Н1, са посебнимакцентом на његову накнадну карактеризацију и испитивање биомолекурнихособина, применом биомолекуларних техника: RT- PCR технике, реал тиме RT-PCR и процеса секвенцирања вируса авијарне инфлуенце.Као материјал смо користили неке од изолата вируса авијарне инфлуенце, који сеналазе у колекцији вируса Националне референтне лабораторије за авијарнуинфлуенцу и Њукастл болест птица и живине Републике Србије, док с смештене уВСИ „Каљево―. Приликом извођења дијагностичких тестова, користили смоантигене и антисеруме добијене од OIE-ове референтне лабораторије у Вејбриџу,док су прајмери и пробе, као и протоколи за извођење PCR, real time RT-PCR исеквенцирање вршени у складу са препорукама исте референтне лабораторије,односно референтних радова из ове области. Добијени резултати су дискутовани,са посебним напоменама, које се тичу добијених биомолекуларнихкарактеристика које указују на високу патогеност анализираних изолата вируса. Узакључцима су изнете предности биомолекуларних у односу на стандардневирусолошке технике.Kључне речи : Вирус Авијарне инфлуенце, подтип H5,Др Миланко Шеклер, , др Дејан Видановић, др Владимир Полачек, мр.сци НиколаВасковић, ВСИ ―Краљево―, Жицка 34, 36 000 Краљево, др Владимир Курћубић,Агрономски факултет, Чачак, доц.др Саша Обрадовић, Фацултy оф ецономy анденгинееринг манагемент, Нови Сад;

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕBLOOD SERUMS EXAMINATION OF WILD AQUATIC BIRDS FROMANATIDAE FAMILY, CAUGHT ALONG THE DANUBE WATERCOURSE,FOR PRESENCE OF SPECIFIC ANTIBODIES AGAINST AVIAN INFLUENZAVIRUS TYPE A, SUBTYPES H5 AND H7Šekler M. 1 , Vidanović D. 1 , Polaĉek V. 1 , Vasković N. 1 , Kurćubić V. 2 , Obradović S. 3 ,Pavlović I. 4The aim of this study is to establish the presence and frequency of specific antibodiespresence against avian influenza virus type A and subtypes H5 and H7 in population ofwild aquatic birds along the Danube watercourse which is the biggest water territory inSerbia. Based on the results we have got and discussion, we assessed their significance,as well as need and importance of constant monitoring of these birds category, onpresence not just the virus itself and specific antibodies against avian influenza virus,but significance in risk assessment as well, which can emerge as result for health statusof poultry and finally for human health. In our conclusions we specified what species ofwild aquatic birds, out of those that are examined, are the most significant as reservoirsfor avian influenza virus, as well as reasons why it is necessary to conduct thesemonitoring regularly.Key words: avian influenza virus type A, H5, H7, SerbiaDr Milanko Šekler, PhD, dr Dejan Vidanović, dr Vladimir Polaĉek, mr.sci Nikola Vasković, SpecialistVeterinary Institute ―Kraljevo―, Zicka 34, 36 000 Kraljevo; Dr Vladimir Kurćubić, Faculty of Agronomy,Ĉaĉak; Doc.dr Saša Obradović, Faculty of economy and engineering management, Novi Sad; Dr IvanPavlović, Science veterinary InstituteIntroductionHISTORYCONSIDERING EPIDEMIOLOGICAL CIRCUMSTANCES WHICH CAUSEDAPPEARANCE OF THE FIRST INFECTIONS OUTBREAK BY AVIANINFLUENCE VIRUS SUBTYPE H5N1 DURING WINTER IN 2005/2006Highly pathogenic avian influenza virus H5N1 spreaded quickly from central Asiatowards Eastern Europe in the second half of 2005. The role of migratory wild birds andpoultry trade remains incompletely understood , because of it, it is needed to do moreresearch about it, which species of migratory birds can be hosts of this virus, exactcourse of these migratory birds and circumstances of spreading this highly pathogenicavian influenza virus subtype H5N1 comparing to other wild birds species fromAnatidae Family ( ducks, geese and swans) by defining specific corridors ,as well as theinfluence of climate factors on spreading of this virus. Spreading of the virus fromRussia and Kazakhstan to The Black sea basin was constant in space and time withhypothesis that the birds of Anatidae Family sow avian influenza virus subtype H5N1along their autumn migratory pathways.Spreading of HPAIV subtype H5N1 during 2003 / 2004 in east and Southeast Asia andduring 2005/2006 farther to west over central Asia and towards Eastern Europe, Middle137

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYSEast and Africa isn‘t typical for other epizooty of HPAIV. Until these events,appearances of epizooty HPAIV were connected to previous transmitting of lowpathogenic avian influenza virus from wild birds to domestic poultry. Spreading ofdisease back to wild birds from domestic poultry was considered possible but relativelyrare phenomenon. It is also considered unusual and very rare event that avian influenzavirus infection also cause high mortality with wild birds‘ population. Epidemiologicalstudies during 2004/ 2005 were mostly focused on persistence of HPAIV subtypeH5N1, comparing to poultry and domestic ducks production system , and little attentionwas paid to role of the wild birds in persistence AI virus locally or its spreading on longdistances. For everything that happened from the middle to the end of 2005., wild birdsbecame prime suspects for spreading HPAIV H5N1 on long distances by their regularyearly migrations. In May 2005, large epizooty and appearance of HPAIV H5N1 wasdetected in wild birds on Qinghai Lake (western part of China), that presents importantlocation where wild migratory birds species are nesting in eastern Asia. Within a fewweeks, several thousands of birds have died as a result of this disease outbreak. Afterthis epizooty, some other wild birds‘ species were infected with this virus. Soon, afterthis episode on Qinghai Lake, avian influenza virus H5N1 was detected in wild birds inMongolia, north of Elkhart Lake, along central migratory pathway of wild aquatic birds,but in surrounding areas as well where the poultry was raised near the settlement.In October 2005, HPAIV Subtype H5N1 spreaded over Eurasia and it appeared inTurkey, Romania and Ukraine, usually at places which presents wintering of wildaquatic birds or in proximity of these places. In spring 2006 avian influenza virussubtype H5N1 infected large number of mute swans and some other wild birds‘ speciesthroughout Western Europe, in the areas where there weren‘t previously detection ofthis disease and infection in domestic poultry, which is proved by intensivesurveillance. With these arguments, there are also those which are against hypothesisHPAIV subtype H5N1 is transmitted to wild birds. All wild birds which were foundinfected by this virus type were either dead or severely ill and were not able to fly andspread virus on long distances. Likewise, in several cases, there were no tight bondsbetween appearance of avian influenza virus subtype H5N1 infection and presence ofwild birds suspected for spreading it. For example, AI virus subtype H5N1 and itsappearance from Russia to Kazakhstan during summer of 2005, was clearly located andarranged along important trade routes that connect west of China and Russia , longbefore, than it has anything to do with direction of migratory course of wild birds.Role of migratory aquatic birds in ecology of avian influenza virusThe presence of avian influenza virus was recorded at the largest number of wild birds‘families, but prevalence and diversity of avian influenza virus subtypes were not equallydistributed among wild birds‘ species. Avian influenza virus was isolated in wild birdsfrom a total of 12 orders, but the most virus isolates were recorded in AnseriformesOrder (especially Anatidae Family: ducks, swans and geese) and Charadriiformes Order(shore birds, gulls and terns. Although there is a wide variety of avian influenza virus‘subtypes isolated from Charadriiformes Order, it is believed that they belong tosomething different genetic pool than those of avian influenza virus isolates originatingfrom wild birds‘ species which belong to Anseriformes Order.138

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕWild birds’ species from Anatidae Family, and especially Anatinae Subfamily(ducks), presents those with the highest degree of risk for transmission of avianinfluenza virus infection to domestic poultry from the following reasons:1) Anatidae is the carriers of the largest number of avian influenza virus subtypes;2) History of repetition of HPAIV in poultry is mostly connected with virus strainswhich circulate in wild ducks, more often then avian influenza viruses which appear inother species of wild birds;3) Domestic duck mallard can excrete large amounts of HPAIV Subtype H5N1, and tostay clinically healthy and in that way to transmit AI virus to long distances;4) Direct contacts among domestic poultry (especially ducks and geese) and wildAnatidae are more often then with other groups of the wild birds.Most wild aquatic birds‘ species migrate seasonally in Siberia and the Palearcticregions, to use temporary rich food sources during short spring and summer, and toavoid later harsh winter weather conditions which occur and rule during early autumnand winter.An important evolutionary impetus for these migrations of wild aquatic birds areabundant spring growth of plant life in Arctic region which occurs under the influenceof heath and large amounts of water given by ice melting, which provides greatproduction of saplings and insects rich in calcium and proteins needed for production ofquality hatching eggs (female ducks lay 8 to 12 eggs), as well as the growth of emergingoffspring. Suitable season for mating and upbringing of offspring is very short on thesehigh geographical latitudes and migratory populations of wild birds soon start migrationtowards south all together with offspring, to avoid frost which, in these areas, startsfrom midsummer on. This results in pre-migratory gathering of many species of wildaquatic birds, more to south than they nested, and where their offspring now becomemature and grow up, while adult units finish the process of moulting before moving tothe main migration direction towards south at the beginning of autumn. This seasonalgathering bring to interference of many species of aquatic birds, especially those withnaive (immature) system (young units) which in this case interfere with adult birds,which are unable to fly for about a month, until they completely finish moultingprocess. That presents ideal conditions for transmitting and redistribution of avianinfluenza virus within aquatic birds‘ population itself, but also within different species.Previous study on ecology of avian influenza virus theme showed that pre-migratorygathering of wild aquatic birds, along with presence of a large number ofimmunologically naive young units, causes seasonal and geographically noticeableoccurrence of prevalence peaks of avian influenza virus infection, noticeable beforeautumn migration, in the areas where those wild birds are gathering. During southwestdirection of migration, prevalence of avian influenza virus declines as a result ofenlargement immunological competence of young units, as well as for newly dispersionof this huge population of wild birds. Although avian influenza virus is harder to detectin wild aquatic birds during winter and spring, it is clear that virus survives in themthroughout whole year. Many have already proved that AI virus circulate continuallyfrom November to March in the areas of wintering of wild aquatic birds. High immunitylevel of these wild birds‘ flocks and relatively low level of avian influenza virus139

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYSisolation during winter and spring questions possible ways of survival AI virus duringthis period of time.Possible redistribution of AI virus among wild birds, which use different migratorydirections and routes, can significantly contribute successful survival of these virus atall geographical latitudes.Northeast Russia and Siberia are the main nesting for many migratory bird species ofAnatidae Family in Palearctic area. The birds arrive there during spring by differentroutes from Europe, Asia and Africa. Western part of Siberian depression is especiallysignificant and presents area of about 2, 745,000 square kilometers. It is the biggestswamp and water habitat of wild birds in the world. This area is important place of theirreproduction, with other similar locations placed in the northwest of Russia and thenorth of Scandinavia. In Western Europe, the main water habitats which presentwintering of aquatic birds are located along the shores of Denmark, Holland, GreatBritain, France (The Rhone River Delta), Spain and north of Italy. In the central partof Europe and western Asia, the main water habitats are in the region of The BlackSea in Ukraine, Romania (The Danube Delta) and Turkey, in the region of The CaspianSea in Russia and Iran and southeast part of Iraq. The three main routes or air corridorsconnect nesting with wintering:- The North Sea corridor connects water habitats of the northwestern Russia withwintering of Western Europe and go through Scandinavia, the Baltic basin and theNorth Sea.- The Black Sea corridor connects the habitats in Russia we have already mentionedwith the Middle East, Mediterranean and eastern Africa.- The Caspian corridor starts from western Siberia and goes through Mediterraneanpart of Europe and western Asia.If we take a number of birds that use these corridors as criteria for corridor significance,then certainly, the most important is The North Sea corridor, then The Black Seacorridor and eventually The Caspian Sea corridor.Possible models of spreading highly pathogenic avian influenza virus H5N1subtype over western paleoarcticDuring July and August in 2005, several occurrence of HPAIV subtype H5N1 wasrecorded in Russia and Kazakhstan. These occurrences were in domestic poultry, but itwas about genetically close AI virus strains previously recorded in China, on QinghaiLake. In October 2005, AI virus subtype H5N1 appeared in wild birds and poultry inTurkey and Romania, but also in dead swans in Croatia. Again, we dealt with a virusidentical to the one from the Qinghai Lake, China. The same AI virus was detected inUkraine in December of 2005. One mission (OIE) has found the first epicenter of theoutbreak in Kazakhstan located near the places which are important for moulting ofmigratory species of wild aquatic birds. It is interesting that in the regions where thebirds nest in western Siberia, the first frosts begin very early, at the beginning of July,and that the places where the birds pre-migratory gather for moulting process, arelocated south of these regions. Highly pathogenic AI virus subtype H5N1 can beentered in south Siberia through illegal poultry and poultry products trade along presentroads, especially through Trans- Siberian commercial routes, where it can enter intowild birds‘ population again. Highly pathogenic AI virus subtype H5N1 can be already140

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕpresent in wild birds‘ population, as it happened in spring of 2005 in west Siberia, or atplaces of wild birds‘ moulting, from where it was transmitted to domestic poultry at theexact time of the main transfer of AI virus in pre-migratory places of their gathering.Initial epicenters of HPAIV subtype H5N1 in Romania, Turkey and Ukraine appearednear water habitats where often wild birds of migratory aquatic species winter. Theselocations were far from any other known location where the presence of HPAIVsubtype H5N1 was recorded, while time and locations were clearly connected to autumnmigrations of wild aquatic birds. In that time frame we detected the presence of highlypathogenic avian influenza virus subtype H5N1 in Serbia as well, at the end of theFebruary and at the beginning of March, on two locations: Baĉki Monoštor and BajinaBašta. This phenomenon was registered in dead swans and in total 11 avian influenzaviruses subtype H5N1 was isolated.Aim and objectivesThe aim of this study is to establish the presence and frequency of specific antibodiespresence against avian influenza virus type A and subtypes H5 and H7 in population ofwild aquatic birds in Serbia. Based on the results it will be possible to assess theirsignificance and need for eventual monitoring of these birds category, on presence notjust the virus itself and specific antibodies against avian influenza virus, but significanceof risk assessment as well, which can emerge as result for health status of poultry andfinally for human health.Material and methodsWe caught wild aquatic birds in several ways:1. We mostly caught swans by feeding them on the shore and then catching them eitherby hands individually or with a large net.2. The other species of wild aquatic birds (like swans) we caught from the boat, withlong lending nets, during the day, but also with method of blinding during the night.Blood serum samples of aquatic birds were examined for presence of specificantibodies against avian influenza virus type A and subtypes H5 and H7 by usingthe following tests:1. ELISA tests: ELISA test for type A of AI virus (IDEXX, USA) and ELISA test forsubtype H5 of AI virus (ANIGEN, South Korea)2. By haemagglutination inhibition test by using antigens of subtypes H5 and H7;antigens from reference laboratory from Weybridge (UK)3. Agar gel precipitation test for establishing presence of specific antibodies againstavian influenza virus type A (antigen Animal Health Service, Doorn, Holland)We conducted ELISA test according to manufacturer‘s instructions, haemagglutinationinhibition test, and agar gel precipitation test according to OIE Manual from 2008.ResultsExamination results for blood serums of wild birds from Anatidae Family, for presenceof specific antibodies against avian influenza virus type A, subtypes H5 and H7 bymethods of agar gel precipitation and haemagglutination inhibition as well as by ELISAtest.141

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYSorder 1. family 1) Species / number of samples by order/family and species-Total of Anatidae Family- % blood serums with present specific antibodies against avian influenza virustype A and subtypes H5 and H7 comparing to number of samplesof wild birdsfrom Anatidae Family- Total from Anseriformes Family142

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕNumber ( in %) of positive blood serums of wild birds by species from AnatidaeFamily on presence of specific antibodiesagainst AI virus type A by ELISA test method comparing to total number ofexamined samples from that family of birds-Wild birds which didn’t have present specific antibodies against AI virus type Aby ELISA test 71% -swan 13%Number ( in %) of positive blood serums of wild birds by species from Anatidae Familyon presence of specific antibodiesagainst AI virus type A by ELISA test method comparing to total number of examinedsamples of the wild birds-Wild birds which didn‘t have present specific antibodies against AI virus type A byELISA test 96,54%143

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYS-The results are expressed as the number of blood serums of wild birds from AnatidaeFamily at which we established presence of specific antibodies against AI virus Type A,subtype H5 or H7 by serological tests ( AGP,HI and ELISA)DiscussionFrom this tabular display we can see that of 4 examined wild birds speciesin AnatidaeFamily, in 3 we proved the presence of specific antibodies against avian influenza virusand at: mallards, mute swans and common pochards.Only at blood serum of common pochards we didn‘t prove these specific antibodiesagainst avian influenza virus with none of the used methods.By agar gel precipitation method , not even in the single one of the blood serums of thewild birds of this family, we didn‘t prove the presence of specific antibodies againstavian influenza virus type A.From 30 examined blood serum samples of wild birds from Anatidae Family,at even 9reacted positively to presence of specific antibodies against avian influenza virus typeA,by ELISA test method,which presents 30% comparing to the number of examinedblood serums of the birds from this family.By haemagglutination inhibition test for subtype H5 of avian influenza virus, specificantibodies were present at 4 blood serums, at 3 blood serums taken from mute swans144

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕ(one of the blood serum samples was taken from the swan which was ringed in Poland)and at one blood serum sample of common pochard. That presents 13,33% comparingto number of examined blood serums of wild birds from this Family.By competitive ELISA test for subtype H5 of avian influenza virus we got the sameresultsi.e. the same are proved in blood serums of the same birds as with thehaemagglutination inhibition testof avian influenza virus subtype H5.By haemagglutination inhibition test for subtype H7 of avian influenza virus, specificantibodies were present at 3 blood serums, at 2 blood serums originating from mallardsand with one blood serum originating from mute swans.That presents 10%comparing to number of examined blood serums of birds from this Family.When we analyze number of positive blood serums for the presence of specificantibodies against avian influenza virus type A, by ELISA test, and according to typesof examined wild birds, we can see that even 25% blood serums of mute swans waspositive ,and even 33,33% blood serums of mallards.Comparing to a certain subtypes of avian influenza virus , by method haemagglutinationinhibition test for subtype H5 and competitive ELISA test for the same subtype, muteswans had 18,75% of positive bloosd serums for presence of specific antibodies againstthis subtype of the virus, compating to the total number of examined blood serumsamples of mute swans. By haemagglutination inhibition test for subtype H7, there were6,25 % of positive blood serums for specific antibodies at mute swans.At mute swans, by haemagglutination inhibition test for subtype H5 and competitiveELISA test for subtype H5, not even one of the blood serums had specific antibodies,but on the other hand even 16,66% of blood serums had specific antibodies againstsubtype H7 of avian influenza virus, by haemagglutination inhibition test methodfor avian influenza virus subtype H7.One blood serum sample of common ponchard reacted positively on presence ofspecific antibodies against avian influenza virus subtype H, with HI test and competitiveELISA test for this subtype.Titre altitude of haemagglutination inhibition test for subtype H5 ranged from 1: 16 to32 at swans to 1: 64 at common ponchard.Conclusion1. Population of different species of wild aquatic birds from Anatidae Family(swans,ducks,geese etc) also in Serbia the main reservoir of avian influenzavirus,subtypes H5 and H7, which are, in most cases , detected in the world as causalagents of severe clinical forms of disease in poultry, i.e. in forms of highly pathogenicavian influenza viruses and they at the same time presents the highest risk for humanhealth.2. It is necessary to conduct regular monitoring of this category of birds in Serbia, onpresence of specific antibodies against avian influenza virus as well as on presence ofavian influenza virus, so that we always have actual epidemiological data. According todata we could assess current risk of possibility of occurance any forms of epizooty withdomestic poultry in the country.145

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYS3. Particularly it is needed to conduct regular monitoring of local aquatic poultry (ducksand geese), considering possibilities of easy contact between these categories ofdomestic poultry ( geese and ducks) with related species of wild aquatic birds, whichpresents their ancestors, and it mainly happens during during domestic waterfowlsstaying in open water surfaces, which also presents natural habitat of related wildaquatic birds.ИСПИТИВАЊЕ КРВНИХ СЕРУМА ДИВЉИХ ВОДЕНИХ ПТИЦА ИЗФАМИЛИЈЕ АНАТИДАЕ, УХВАЋЕНИХ УЗ ВОДОТОК ДУНАВА, НАПРИСУСТВО СПЕЦИФИЧНИХ АНТИТЕЛА ПРОТИВ ВИРУСААВИЈАРНЕ ИНФЛУЕНЦЕ А ТИПА И ПОДТИПОВА H5 И H7Шеклер М. 1 , Видановић Д. 1 , Полачек В. 1 , Васковић Н. 1 , Курћубић В. 2 ,Обрадовић С. 3 , Павловић И. 4Кратак садржајГлавни циљ рада је да се установи присуство и учесталост присустваспецифичних антитела против вируса авијарне инфлуенце А типа, и подтипова H5и H7, у популацији дивљих водених птица уз водоток Дунава, који представљанајвећу водену површину у Србији. На основу добијених резултата и дискусије јеизвршена процена значаја истих, као и потреба и значај за сталним мониторингомове категорије птица, на присуство како самог вируса и специфичних антителапротив вируса авијарне инфлуенце, тако и значај у процени ризика који може дапроистекне за здравствено стање живине, и у крајњем исходу здравље људи.Узакључцима је наведено које су врсте водених дивљих птица, од оних које супрегледане, најзначајније као резервоари вируса авијарне инфлуенце, као иразлози због којих је потребно овакве мониторинге спроводити редовно.Кључне речи:Авијарна инфлуенца А типа, H5, H7, СрбијаДр Миланко Шеклер, Др Дејан Видановић, Др Владимир Полачек, Др Никола Васковић, Ветеринарскиспецијалистички институт "Краљево", Краљево; Др Владимир Курћубић, Агрономски Факултет Чачак,Чачак; Др Саша Обрадовић, Факултет за економију и инжењерски менаџмент, Нови Сад ; Др ИванПавловић, Научни институт за ветеринарство Србије, Беогард146

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕAPPLICATION OF BIOMOLECULAR TECHNIQUES TO IDENTIFY ANDCHARACTERIZE NEWCASTLE DISEASE VIRUS (DETERMINATION OFDEGREE OF ITS PATHOGENICITY)Šekler M. 1 , Vidanović D. 1 , Polaĉek V. 1 , Vasković N. 1 , Kurćubić V. 2 , Obradović S. 3 ,Pavlović I. 4AbstractAim of this study is to show significance of using biomolecular techniques in diagnosticand identification of presence of Newcastle disease virus with poultry and birds, as wellas possibilities and advantages of their appliance in characteristics and featuresdetermination of virus itself i.e. degree of its virulence. As a material we usedNewcastle disease virus from virus collection which is in National reference laboratoryfor avian influenza and Newcastle disease of poultry and birds of Republic of Serbia, inSpecialist Veterinary Institute ―Kraljevo‖. Newcastle disease virus RNA is extractedfrom allantoic fluid with QIAamp viral mini kit (QIAgen, Valencia, USA). For virussequencing we used One step RT-PCR kit (QIAgen) and specific primers (reverse andforward) by Seal author. PCR reaction product is refined by using Qiaquick GelExtraction (Quigane,USA) and sequencing reaction is conducted with primers by Seal.Sequencing product is refined Ethanol by EDTAS method. Sequences are read ongenetic analyzer AB 3130 and processed by Sequencing Analysis 5.2. software.Nucleotide sequences we got were transcribed into amino acid sequences and werecoded by EMBOSStranseq. program. The results we have got were discussed, withspecial notes considering obtained biomolecular characteristics, which show highpathogenicity of analyzed virus isolates. In our conclusions we brought out advantagesof biomolecular techniques comparing to standard virological techniques.Key words: NewCastle disease, SerbiaDr Milanko Šekler, PhD, dr Dejan Vidanović, dr Vladimir Polaĉek, mr.sci NikolaVasković, Specialist Veterinary Institute ―Kraljevo―, Zicka 34, 36 000 Kraljevo; DrVladimir Kurćubić, Faculty of Agronomy, Ĉaĉak; Doc.dr Saša Obradović, Faculty ofeconomy and engineering management, Novi Sad; Dr Ivan Pavlović, Science veterinaryInstituteINTRODUCTIONEtiologyTotal of 3 virus families: Rhabdoviridae, Filoviridae, and Paramyxoviridae make orderMononegavirales , which genome consists of negative, monochained and nonsegmentedRNA chains. Newcastle disease is caused by avian paramyxovirus serotype 1(APMV-1) which is, with other eight APMV serotypes (from APMV-2 TO APMV-9), placedinto class Avulavirus, subfamily Paramyxovirinaei and family Paramyxoviridae.147

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYSNatural hostsThere are some data about outbreak of Newcastle disease in animals originated fromthree classes: birds, reptiles and humans. It is known that Newcastle disease can infectat least 271bird species, which are classified in more than half of existing bird classes, as to 27 outof 50 classes in family Aves (birds class). The most likely is that all bird species aremore or less sensitive to this viral infection.Molecular basis of Newcastle disease virus pathogenicityDuring the replication Newcastle disease virus produce glycoprotein precursor ofprotein (F) fusion, which is denoted as F0.During the process of replication itself it isshared ,or as we usually translate it in our expert literature, it is ―cleaved‖ in protein F1and F2. This cleavage process takes place under the influence of cell proteases of thehost. It is proved that trypsin can tear fusion glycoprotein molecule precursors denotedas F0 with all virus strains of Newcastle disease, and it is known that in vitro conditions,even completely noninfectious Newcastle disease virus strains becomes infectious underits influence.The ability of the molecule F0 to ―cleave‖ (or to divides into two molecules) is directlyrelated to the degree of virulence of Newcastle disease virus itself in vivo conditions.Basic characteristic of F0 molecules with virulent virus of Newcastle disease inchickens is that the molecule can be cleaved by host proteases or by proteases which arein the wide range of different types of cells and tissue. This characteristic allowsvirulent viruses to spread through the organism of the host and in that way to damage itsvital organs. In contrast of this, glycoprotein F0 in Newcastle disease virus which is oflow virulence can be cleaved in a small number of cell proteases types of the host. Itmeans that these viruses can grow and replicate in a small and limited number of celltypes and tissue of the host. Many years of study and comparison of both types of aminoacids and the amino acid sequence at the cleavage site of F0 virus protein, at a largenumber of virulent and avirulent virus strains of Newcastle disease demonstrated thatthe presence of several basic amino acids at the cleavage site is a basic characteristic ofvirulent strains of the Newcastle disease virus. The usual sequence is 113 RQK/ RR-F117 at virulent virus strains and the most isolates had one basic amino acid at theposition 112. Apart them , low pathogenic viruses conventionally had sequence at thecleavage site of the following content 113 K/ RQG/ER-L 117. Particularly important isthe presence of basic amino acids at positions 113, 115 and 116 as well asphenylalanine at the position 117- when virulent virus strains are concerned, whichbrings to effect that this site can be ―cleaved‖ or activated by wide range of proteases ofdifferent tissues and organs of host infected.At low virulence virus, F0 protein can be cleaved by effect of only one protease, whichrecognizes arginine, for example enzymes similar to trypsin. Because of this theseviruses have limited number of sites within organism where they can replicate, and thatis only at those sites where cells contain enzymes of characteristics mentioned above(similar to trypsin). Before all those are respiratory and digestive tract cells while unlikethem virulent viruses can replicate in a wide range of different organs and tissuesleading to fatal systemic infections.148

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕOIE definition of Newcastle disease virulent virus in the Manual for diagnostic andproduction of biological agents from 2008. says:Newcastle disease is defined as bird infection caused by avian paramyxovirus serotype1 virus (APMV-1) which meets one of the following criteria comparing to virulence:a) Virus has intracerebral pathogenicity index (ICPI) in one day old chickens (Gallusgallus) equal to 0, 7 or higher.ORb) The virus has more basic amino acids at C- terminus (end) of F2 protein and there isphenylalanine at position 117i which is on N- terminus of F1 protein. The term “morebasic amino acids” refers to at least 3 arginine molecules or lysine at positions from113 to 116. In case there is no possibility to prove these characteristics which refers toamino acids positions as described, it is necessary to conduct characterization ofisolated virus by ICIP test.Example for the above mentioned parameters of characteristics evaluation forNewcastle disease virus by applying molecular techniquesTable 1. Nucleotide / amino acid sequences at F0 cleavage site high virulence virus[34/90] isolated from poultry in Ireland ,comparing to antigen and genetically closelyrelated virus of low virulence isolated from ducks.Table 2. Nucleotide / amino acid sequences at cleavage site of protein molecule F0(precursor of protein F fusion) at Newcastle disease virus of high and low virulence.149

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYSTaken from the book: Alexander D.J., J.G. Bell, R.G. Alders., 2004.Technology Rewiev: Newcastle Disease- With Special Emphasis on Its Effects onVillage Chickens. FAO ANIMAL PRODUCTION AND HEALTH. FOOD ANDAGRICULTURE ORGANIZATION OF THE UNITED NATIONS,Rome,2004.Aim and objectives of the studyAim of this study is to show significance of using molecular techniques in diagnosticand identification of presence of Newcastle disease virus with poultry and birds, as wellas possibilities and advantages of their appliance in characteristics and featuresdetermination of virus itself i.e. degree of its virulence. All of that was conducted onNewcastle disease viruses from virus collection which is in National referencelaboratory for avian influenza and Newcastle disease of poultry and birds of Republic ofSerbia, in Specialist Veterinary Institute ―Kraljevo‖.Material and methodsRNA of Newcastle disease virus is extracted from allantoic fluid with QIAamp viralRNA mini kit (QIAgen,Valencia, USA). For virus sequencing we used One step RT-PCR kit (QIAgen) and specific primers (reverse and forward) by Seal. PCR reactionproduct is abstracted Qiaquick Gel Extraction (Quigane, USA), and sequencing reactionis conducted with primers by Seal. Sequencing product is abstracted Ethanol by EDTAmethod. Sequences are read on genetic analyzer AB 3130 and processed by SequencingAnalysis 5.2. software. Nucleotide sequence we got are transcribed into amino acidsequences and are coded by EMBOSS transeq. program.Results and discussionPicture 1. (bellow) represents typical appearance and position of Newcastle diseasevirus product in gel whereby we can clearly see analysis result of PCR product of total18 Newcastle disease virus isolates and which are by applying this molecular techniquesuccessfully and explicitly confirmed. The size of PCR product characteristic forNewcastle disease virus is 254 bp, and that can be clearly seen along the horizontal axesof the picture in the form of a clear dotted line which is above the lighter one at thebottom of the picture. That blurred segmented line at the bottom of the picture presentsprimers. That the PCR products are at the exactly appropriate and typical position wherethey should be , when presence of nucleic acids of Newcastle disease virus areconcerned, we can clearly determine based on standard position which can be found onthe both sides of the picture, and by which each band (line) presents PCR product of100 bp in size ,starting from the ones at the bottom of the picture up to the tenth band atthe top which presents bend of 1000 bp.150

Picture 1.ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕ1. After we got PCR product in gel we conducted abstraction of PCR productcharacteristic for Newcastle disease virus from gel by using Centrispin kit (Princeton),complying with manufacturer‘s instructions.2. This way abstracted PCR product we sequenced by using One step RT-PCR kit(Qiagen) and specific pair of primers by Seal, the author who designed it, and whichpresents current standard for this virus.3. Sequencing product is abstracted by Sentrisept kit (Princeton) and according tomanufacturer‘s instructions.4. Sequences are read on genetic analyzer AB 3130 and processed by Sequencing Analysis5.2. software.5. Nucleotide sequences we got are transcribed into amino acid sequences which are codedby EMBOSS transeq, program.Sequences are read on genetic analyzer AB 3130 and processed by Sequencing Analysis5.2. software. Nucleotide sequences we got are transcribed into amino acid sequenceswhich are coded by EMBOSS transeq. program. Processed results through EMBOSSprogram enable us to see the structure crucial for determination of degree ofpathogenicity for Newcastle disease virus, and that is cleavage site of glycoprotein F0molecule. On so-called cleavage site it is necessary to find as many basic amino acids aspossible, and in that way virulence and pathogenicity of the virus is more expressed. Onthis display of amino acid sequence down bellow (Picture 2. and 3.) we can easilynotice the single yellow column with letter F, which presents position 117 where we canfind phenylalanine and that is the first condition for highly virulent virus strain ofNewcastle disease. From that place towards left, it can be seen that even four basicamino acids are present of which 3 molecules of arginine and one of lysine, whichindicates this is highly virulent virus of Newcastle disease.151

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYSPicture 2. and 3.Conclusions1. Molecular diagnostic techniques covers presence of nucleic acid at Newcastle diseasevirus diagnostic. They reached expected and required level of specificity and sensitivityand they present practically unavoidable tool in quick and safe diagnostic of thisdisease.2. Speed at which we can perform entire procedure of PCR testing at presence ofnucleic acid in Newcastle disease virus and it represents following advantage which thismolecular technique demonstrates.In other words this disease can be detectedsignificantly earlier than by classical isolation techniques and later virusologicalserologicalidentification (haemagglutination inhibition by which we prove presence ofthe virus in allantoic fluid), therefore we can start significantly earlier implementationof legal actions at the procedure of its control and eradication.Those severaldays,perhaps even weeks are crucial in preventing further spreading of disease.152

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕ3. By molecular technique of sequencing PCR product of Newcastle disease virus,youcan successfully and quickly determine degree of virus virulence i.e. its pathogenicity,for a few hours, which is ten times faster in days and it can be very important in processof controling and precise identification of virus which cause disease from those whichare incidental findings, or non pathogenic or low pathogenic or vaccine.4. Molecular characteristics of Newcastle disease virus are very significant from theviewpoint of epidemiological studyinf and monitoring ,especially for it is known thatwith a few dotted mutation s it can easily reach highly virulent virus strains ofNewcastle disease, of pre-established low pathogenic in some bird population, wild,aquatic, poultry or even completely apathogenic virus strains of Newcastle disease.5. Molecular techniques are irreplaceable in modern monitoring programs ofsurvaillance which all countries must have and which, before all, are primarilyconducted by wild aquatic birds,as well as some other bird species which are recognizedas actual reservoirs of the virus ( birds of prey, pigeons, pheasants, cormorants, owlsetc.), poultry in extensive breeding, as well as poultry in intensive poultry production. Inthat way and in line with modern methodology of risk analysis,especially quantitativeone, we can likely predict future events which concerns outbreak on analized territory.6. By sequencing we can successfully replace ICPI test,i.e. determination ofintracerebral pathogenicity index of the virus, which besides it lasts much shorter (dozens of times), it is less risky, it is cheaper, requires less work, less space, fewerpeople etc.PRIMENA BIOMOLEKULARNIH TEHNIKA U IDENTIFIKACIJI IKARAKTERIZACIJI VIRUSA NJUKASTL BOLESTI (ODREĐIVANJASTEPENA NJEGOVE PATOGENOSTI)Шеклер М. 1 , Видановић Д. 1 , Полачек В. 1 , Васковић Н. 1 , Курћубић В. 2 ,Обрадовић С. 3 , Павловић И. 4Кратак садржајЦиљ ове студије је да се покаже значај коришћења биомолекуларне технике удијагностици и идентификацији присуства вируса Newcastle болести код живинеи других птица, као и се прикажу могућности и предности њихове примене укарактеризацији и одређивању особина вируса као што је нпр. степенвирулентности вируса. Као материјал користили смо вирус Newcastle болести изколекције вируса који се налази у Националној референтној лабораторији заавијарну инфлуенцу и Newcastle болест живине и птица Републике Србије-Ветеринарски специјалистички институт "Краљево". Вирусна РНК се екстрахујеиз суспензије алантоисне течности инфицираних пилећих ембриона, помоћуQIAamp мини кита (QIAgen, Валенсија, SAD). За секвенционирање вирусненуклеинске киселине смо користили One step RT-PCR кит (QIAgen) и специфичнепрајмере (reverse and forward) према упутству произвођача. Производ реакција јепречишћен коришћењем Qiaquick Gel Extraction (Quigane,USA) и редоследреакција је урађен према упутству произвођача. Секвенционирани производ јепречишћен Ethanol by EDTAS методом. Секвенце се читају на генетском153

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYSанализатору AB3130 и обрађују се. Помоћу 5.2. софтвера, секвенце нуклеотидакоје смо добили су транскрибоване у аминокиселинску секвенцу, па су затимкодирани помоћу EMBOSStranseq. програма. Резултати које смо добили судетаљно објашњени и са посебним акцентом су разматране биомолекуларнекарактеристике, које показују висок степен патогености испитиваних изолатавируса. У нашим закључцима смо изнели предности коришћењабиомолекуларних техника у односу на стандардне вирусолошке технике.Кључне речи: NewCastle болест, СрбијаДр Миланко Шеклер, Др Дејан Видановић, Др Владимир Полачек, Др Никола Васковић, Ветеринарскиспецијалистички институт "Краљево", Краљево; Др Владимир Курћубић, Агрономски Факултет Чачак,Чачак ; Др Саша Обрадовић, Факултет за економију и инжењерски менаџмент, Нови Сад ; Др ИванПавловић, Научни институт за ветеринарство Србије, Беогард154

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕCOMPARATIVE STUDIES OF INACTIVATED VACCINES AGAINSTRABIES IN GOATSKneţević N., Veljović Lj., Đuriĉić Bosiljka, Stankov S. Lazarević-Ivanc LjiljanaFirst inactivated vaccine against rabies in Serbia (RABIVET®) was produced from PV-PARIS/BHK strain of rabies virus on BHK-21 C13 cell line.Harvested virus was filtrated, inactivated with beta -propionlactone, conserved withmerthiolate and after that adsorbed with aluminum phosphate (AlPO4). After toxicitytests we estimated immune response. Imunity is estimated on goats with vaccineproduced by internationally renomated producer, licences for goats, which areregistrated in Serbia. All in all we vaccinated 14 goats awhich were devided in groupsaccording to experimental design (Tab.1). Immune response s were estimated on thebasis of antirabies antibody titer and seroconversion as fallowed; 8 mounths after firstvaccination, 12 mounths after revaccination and 11 mounths after third vaccination.First conclusion is that immuni responses were very low after first vaccination with allvaccines. Satisfied titers and seroconversions we have got only after second vaccinationand after third vaccination (booster).Key words: rabies, goat, vaccines,immunityDr sc. Nikola Kneţević, Veterinary Institute Zemun, Belgrade, Serbia; Mr sc. Ljubiša Veljović ScaintificVeterinary Institute of Serbia, Belgrade, Serbia; Dr Bosiljka Đuriĉić, full professor University of Belgrade,Faculty of Veterinary Medicine, Serbia; Dr sc. SrĊan Stankov, mr sc. Ljiljana Lazarević Ivanc PasteurInstitute, Novi Sad, SerbiaКОМПАРАТИВНА СТУДИЈА ИНАКТИВСАНИХ ВАКЦИНА ПРОТИВБЕСНИЛА КОД ВАКЦИНСАНХ КОЗАКнежевић Н., Вељовић Љ., Ђуричић Босиљка, Станков С., Љиљана Лазаревић-ИванцКратак садржајПрва инактивисана антирабична вакцина домаће производње произведена је одPV-PARIS/BHK соја вируса беснила умноженог на стабилној ћелијској линијибубрега хрчка (BHK-21 C13). Умножени вирус је после филтрције инактивсанбета-пропиолактоном, конзервисан мертоилаитом а потом адсорбован наалуминијум-фосфат (AlPO 4 ).После испитивања нешкодљивости упоређиван је имунолошки одговор коза навакцинацију против беснила домаћом вакцином (RABIVET ® ) са иностраномкомерцијалном вакцином, лиценцираном за козе, која jе регистрована у Србији.Укупно је ваакцинисано 14 коза које су подељене у групe по експерименталномдизајну.155

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYSИмунолошки одговор је праћен на основу титрова антирабичних антитела (RFFIT,Smith i sar. 1996) и стопе сероконверзије 8 месеци по примовакцинацији, 12месеци по ревакцинацији и 10,5 месеци по трећој вакцинацији. На основу нивоаантирабичних антитела и стопе сероконверзије може се закључити да су титриантитела и стопа сероконверзије прилично ниски после примовакцинације безобзира на коришћене вакцине. Солидни титри и сероконверзија добијени су поревакцинацији, а посебно после бустериѕације.Кључне речи: козе, имунитет, беснило, вакцинеДр сц. Никола Кнежевић, Ветеринарски завод Земун а.д. Београд, Земун, Србија;nikola.knezevic@vetzavodzemun.com; мр сц. Љубиша Вељовић, Научни институт за ветеринарствоСрбије, Београд, Србија; Др Босиљка Ђуричич, редовни професор, Факултет ветеринарскемедицине Универзитета у Београду, Београд, Србија; Др сц. Срђан Станков и мр сц. ЉиљанаЛазаревић Иванц,Пастеров завод Нови Сад ,Нови Сад,Србија.УводУ Србији се беснило код коза јавља повремено. Тако је у протеклих 5 година(2008-2012) регистрован 1 случај (Лучице, Пријепоље новембар 2011.) што износи1,14 % од броја утврђених случајева код домаћих животиња, односно 0,17% одукупног броја регистрованих случајева беснила. Због екстензивног начинадржања (испаша је најчешће по шумамма и шикарама), ризик да козе оболе одбеснила је већи у односу на остале животињске врсте, посебно када владасилватично беснило. Потреба да се и козе вакцинишу против беснила јеиндикована у случајевима када се један или више региона прогласи зараженим одбеснила или у време сајмова и изложби. Беснило коза може бити узрокпостекспозиционог третмана (ПЕТ) људи као што је био описани случај на сајму уЊујорку 1996 године (Barron, 1996, Gasparotto, 1999). Наиме, на сајму је 25.000особа било у контакту са оболелим јаретом због чега је затим 467 особа подвгнутоПЕТ што је економски државу коштало 500.000 долара.За вакцинацију коза у свету скоро да нема лиценцираних антирабичних вакцина.Тако у САД нема ни једна*, у Европи постоји једна** а у Србији су регистрованедве вакцине**.Ова студија је извршена да би се утврдило да ли ова осетљива врста животињаможе адекватно да одговори на превентивну вакцинацију против беснила, када ихје потребно ревакцинисати и колико дуго траје имунитет.Mатеријал и методеЖивотиње: За оглед је укупно коришћено 15 коза мешане расе (Алпска и Санска)старије од 4 месеца и једно јаре старо 2,5 месеца. Животиње су смештене у шталуотвореног типа с настрешницом у ВЗ Земун. Исхрана је била испаша и/или сеноуз додатак пелетиране хране за овце (потпуна храна за овце у лактацији,произвођач ВЗЗ) док је појење било по вољи.Вакцине: За спровођење вакцинације коришћене су три серије вакцинеRABIVET ® различитих антигених вредности од 1,35-10,7 интеренационалних156

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕјединица/мл (ИЈ/мл-НИХ тест потентности, National Institutes of Health, Bethesda,MD, USA: Wilbur i sar., 1996). За упоређивање коришћена је инострана вакциналиценцирана у Европи за превентивну вакцинације коза (IN-Rabies 1) антигеневредности >2,0 ИЈ/мл. Коришћене вакцине, начин вакцинације и бројвакцинисаних животиња су приказани табеларно (табела 1). Животиње сувакцинисане са 2 мл интрамускуларно (и/м.) код вакцинације RABIVET ®вакцином а код иностране вакцине са по 1 мл такође и/м.Серолошки тестови: У време назначено у резултатима (Таб. 2 и 3) вађена је крвод коза из вратне вене (v. jugularis), затим је издвојен серум, инактивисан и доизвођења серолошких тестова складиштен на -20 0 Ц. За доказивање нивоаантирабичних антитела коришћен је брзи тест инхибиције жаришнефлуоесценције (RFFIT- rapid fluorescent focus inhibition test). Тестови су рађени уНационалној референтној лабореаторији за беснило (Пастеров завод Нови Сад).Титрови антитела су изражени у ИЈ/мл односно у средњој вредности за групу.Стопа сероконверзије је изражена пи формули: број позитивних серума (≥О,5ИЈ/мл х 100/ број тестираних животиња..__________________*( IMRAB ® 3, Merial Inc., Athens, GA 30601 USA препоручена од dr Mary Smith,Cornell/ author Goat Medicine w/David Sherman)** (Nobivac ® Rabies , Intervet/Schering-Plough Animal Health)** (Nobivac ® Rabies i RABIVET ® Ветеринарски завод а.д., .Београд ,Земун)Табела 1. Експериментални дизајн вакцинације коза и јаради против беснила1. вакцинација 2. вакцинација 3. вакцинацијаОглед Н о вакцина ИЈ/мл вакцина ИЈ/мл вакцина ИЈ/мл1.Нешкодљивост2(1+1)1 КRABIVET ® 1,35 1 kоза и 1 јаре (старост 2,5месеца )Оглед трајао 120 дана2.Имуногеност95праћењеRABIVET ® 1,04IN-Rabies 1 4,08 месециRABIVET ® 10,07IN-Rabies 1 4,012 месециRABIVET ® 5,96IN-Rabies 1 4,00,5 месециН о =број животиља у огледу, К= контрола, коза стара 2 г., ИЈ/мл= антигеност по НИХ тестуу време вакцинацијеРезултатиОглед 1: Испитивање нешкодљивости (безбедности)Једна коза стара око 2,5 г. и једно јаре старо 2,5 месеца вакцинисане су са по 2 х 2мл и/м. RABIVET ® вакцином антигене вредности 1,35ИЈ/мл. Поред мерењателесне температуре до 7 дана, праћења општег стања и локалних реакција до 14дана после вакцинације (п.в.) мерен је и титар антирабичних антитела прединокулацију вакцине као и 15., 64., 94. 120. дана после вакцинације. Клинички,осим благог повећања телесне температуре 4- и 5-ог дана, животиње су одлично157

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYSподнеле апликацију двоструке дозе вакцине што је у складу са захтевимамонографије за инактивисане антирабичне вакцине описане у ЕвропскојФармакопеји 5.0:2005, односно 6.0:2008., односно без локалних реакција ипоремећаја општег здравственог стања. Интересантно је да је јаре боље поднелоапиикацију двоструе дозе вакцине јер је код њега телесна температура била уфизиолошким границама осим на дан апликације вакцине.Табела 2. Титар антирабичних антитела коза вакцинисаних двоструком дозомRABIVET ® вакцине (нешкодљивост)Тетивир Пол /бројДоб31316 ♀ 2,531344 м.♀ 2г.31345 ♀ 2г.Вакцина/ ДозаRABIVET ®2x мл и.м.Титар RFFIT ИЈ/мл / Дани по апликацији0 15 64 94 120≤0,26 0,22 0,30 0,150,22 н.т. 0,57 0,620,24≤0,15Контрола ≤ 0,26 0,22 н.т. н.т. н.т.Резултати серолошкиох тестова приказани су табели 2 указују да све козе које субиле укључене у овај оглед пред вакцинацију нису поседовале специфичнаантитела на беснило. Такође, и поред апликације двоструке дозе вакцине јаре нијепродуковало антирабична антитела, док је старија коза поседовала титарантирабичних антитела изнад заштитног нивоа до 3 месеца по апликацији.Оглед 2. Имуногеност-компаративноЧетрнаест коза старијих од 5 месецеи подељено је у 2 групе: прва група (7 клоза идва јарета стара 4 месеца вакцинисано је са по 2 мл и/м. RABIVET ® вакцине адруга група (4 козе и 1 јаре) вакцинисани са по 1 мл и/м. вакцином страногпроизвођача лиценцираном за антирабичну вакцинацију коза. Титриантирабичних антитела праћени су 8 месеци по вакцинацији а процена заштитеизражена је у стопи сероконверзије. Добијени резулатаи су приказани у табели 3 играфиконима 1 и 2.У првој групи, козе и јарад, пред вакцинацију RABIVET ® вакцином нисупоседовала антитела на беснило (СВ ≤0,21 ИЈ/мл, сероконверзија 0%) . Месецдана по вакцинацији СВ титра антитела била је 2,34 ИЈ/мл, сероконверзија 87,5%,а 8 месеци по вакцинацији СВ= 0,88ИЈ/мл, сероконверзија 80%. Код друге групекоза (вакцинисане иностраном вакцином) пред вакцинацију једна коза је биласлабо позитивна (0,57ИЈ/мл, сероконверзија 25%). Месец дана по вакцинацијиСВ=2,05ИЈ/мл, сероконверзија 80%, a 8 месеци п.в. ова вакцина је продуковаланиже титре антирабичних антитела и сероконверзију (СВ =0,52IJ/ml,сероконверзија 50%). Oбе вакцине су продуковале сличне нивое антирабичнихантитела који доприносе заштити од беснила до 8 месеци по примовакцинацији(RABIVET ® 80% a инострана само 50%). Изузетно ниски титри антитела и нискастопа сероконверзије добијена је 4-ог месеца п.в. Изузетно ниски титри и нискастопа сероконверзије добијена је код обе вакцине 4 месеца п.в. ((RABIVET ®28.6%, a инострана 33,4%). Накнадном анализом је установљено да је већина козабила месец дана пред јарење у време када је рађено тестирање. Oсам месеци од158

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕпримовакцинације козе су ревакцинисане са истим вакцинама на исти начин, стом разликом што је за групу која је ревакцинисана RABIVET ® -ом коришћенавакцина више антигене вредности (по производњи 10,4ИЈ/мл; реконтролисана увреме ревакцинација 5,96 ИЈ/мл).Табела 3. Серолошки одговор коза вакцинисаних антирабичним вакцинамаРедБр.Вак-цинаМесеци по вакцинацији0 1 2 48Титар антитела у ИЈ/мл ( Р Ф Ф И Т)Месеци по ревакцинацији1 1,5 4 1012Месеци по 3. вак3 5 10,512.3.4.5.6.7.8.J9.JСВИЈ/млСерокон%12.3.4.5.JR -A 0.3B 5I 0,2V 6E 0,1T ® 60,13INRAB-1*0,591,760,572,436,32,00- 9 4 5 -Није вакцинисано 10,41,2-->1,20,720,2-4>1,21,10100-1,20.240,70>1,25,93,61,2-1,2--5,01,03,4100-1,21,02,61,2СВИЈ/млСерокон%0,2525,02,0580,00,6260,00,3133,40,5250,03,2280,00,7175,00,5820,00,7750,01,1260,00,7250,00,831001,5100*IN-RAB 1 = инострана вакцина лиценцирана за вакцинацију коза у Србији, Редбр= редни број коза у групи, РФФИТ= брзи тест инхибиције жаришнефлуоесценције, 9J= јаре старије од 4 месеца није укључено у обрачун СВ титраантирабичних антитела и стопу сероконверзије, СВ= средња вредност титраантирабичних антитела за групу, Серокон % = стопа позитивне сероконверзије.Да би утврдили да ли вакцина више антигене вредности доприноси бољемимунолошком одговору групи вакцинисаној са RABIVET ® -ом придодато је једно159

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYSјаре старо 4 месеца (9Ј) које је примовакцинисано (Таб. 3). Mесец дана поревакцинацији установљени су следећи титри антирабичних антитела: RABIVET ®вакцина СВ≥5,26ИЈ/мл, сероконверзија 100%, a код IN-RAB 1 вакцинеСВ=3,22ИЈ/мл, сероконверзија 80%. Примовакцинисано јаре код кога превакцинације нису детектована заштитна антитела (

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕГафикон 2. Стопа сероконверзије код коза вакцинисаних иревакцинисанихантирабичним вакцинамасероконверзија1009080706050403020100RABIVETIN-RAB 10 1 2 4 8 1 1,5 4 10 12 3 5 11%месеци по вакцинацији и ревакцинацијама1. вакц. 2. вакц. 3. вакц.Годину дана по ревакцинацији козе су трећи пут вакцинисане истим вакцинама наисти начин (6 koза RABIVET ® i 4 koзe IN-RAB 1 ). Титри антирабичних антителапраћени су 3, 5 иi 10,5 месеци по бустеризацији. Добијени резултати указују нанешто нижи титар и стопу серикинверзије установљен 3-ег месеца код IN-RAB 1вакцине у доносу na RABIVET ® вакцину (0,77 према 0,92 ИЈ/мл, сероконверзија50:83,3%). Пет и 10,5 месеци по трећој вакцинацији koд свих тестиранихживотиња утврђен је заштититни ниво антирабичнх антитела и 100%сероконверзија (Таб. 3 ; Grаф. 2).ДискусијаПрема Европској Фармакопеји (Eur. Ph 6.0:2008) нешкодљивост (безбедност)инактивисаних вакцина против беснила испитује се на врсти-ма за коју-е јевакцина намењена апликацијом двоструке препоручене дозе и начина апликације.Наши резулатаи испитивања нешкодљивости диказали су да је RABIVET ®вакцина нешкодњива за козе и јарад старије од 4 месеца, као и за јарад која непоседују матернална антитела на беснило старости 26 дана ако се вакцинишу са 2мл вакцине и/м.Различита антигена вредност антирабичних вакцина коришћених у овој студији(Таб. 1 и 3, Граф. 1 и 2) до 8 месеци п.в. нису значајно утицале на СВантирабичних антитела али је значајна разлика у сероконверзије. Чак је вакцинаниже антигене вредности (и 3 пута нижа) допринела вишим титровимаантирабичних антитела и сероконверзији 8 месеци по примовакцинацији.161

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYSRABIVET ® вакцина антигене вредности 1.35 ИЈ/мл продуковала је СВ=0,88 ИЈ/мли сероконверзију 80%, а IN-RAB 1 вакцина антигене вредности 4,0 ИЈ/млСВ=0.52 ИЈ/мл и сероконверзију 50%.Ревакцинацијом 8 месеци по примовакцинацији годину дана након ревакцинацијеСВ титра антирабичних антитела је била иста код обе вакцине (1,12 ИЈ/мл) док јесероконверзија код RABIVET ® вакцине износила 85,7% (6/7), односно кoд IN-RAB 1 вакцине 60% (3/5). Стопа сероконверзије код обе вакцине је нешто нижа одзахтеваног минимума (минимум 80%) јер ако изузмемо козу бр. 6 (

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕ8. Nikola Kneţević, Ljubiša Veljović, Ljiljana Paušak, Bosiljka Đuriĉić: Pre and PostExsposure Rabies Prophylaxis in Ruminants.Congress Procieedings „19 th InternationalCongress of Mediteranean Federation of Health and Production of Ruminants―, May25-28, 2011, Belgrade, Serbia; pp.95-102.9. Smith JS, Yager PA, Baer M. A rapid fluorescent focus inhibiton test (RFFIT) fordetermining rabies virus-neutralizing antibody. U: „Labortory techniques in rabies―,Fourth ed., Edited by: Meslin F.-X., Kaplan M.M., Koprowski H., WHOGeneva,1996;181-192.10. Smith CM and Sherman DM: Goat Medicine, 2nd Ed. Willey-Backwell Nov. 10,2009.pp. 888 /DOI 10.1002/9780813818825, ch/; chp. 5: Viral and Prion Diseases, 163-256.11. Wang Y, Xiang Z, Pasquini S, Ertl HC: Effect of passive immunization or maternallytransferred immunity on the antibody response to a genetic vaccine to rabies virus. JVirol.1998;72(3):1790-6.12. Wilbur LA, Aubert M.F.A.: The NIH test for potency. U: „Labortory techniques inrabies―, Fourth ed., Edited by: Meslin F.-X., Kaplan M.M., Koprowski H.163

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYSMYCOTIC COLITIS IN PIGS ASSOCIATED WITH PORCINE CIRCOVIRUSTYPE 2 INFECTIONCvetojević Đ., Kureljušić B., Savić B., Jezdimirović N., Veljović LJ., Kureljušić Jasna,Radanović O., Ivetić V. *AbstractPorcine circovirus typе 2 (PCV-2) is cosmopolitan widespread pathogen that causesimmunosuppression and increasing direct and indirect losses in intensive pigproduction. Infection of pigs with PCV-2 cause a number of different clinical forms ofthe disease, so that today we talk about circoviral pig diseases (PCVD - PorcineCircovirus Disease). A list of these diseases that are considered to be related to theetiology of PCV-2 was significantly expanded. According to this, recently is speakingabout diseases associated with PCV-2 (PCVAD - Porcine Circovirus AssociatedDiseases). In addition to clinical entities that belong to the complex of PCVAD,circovirus type 2 may contribute significantly to the evolution of clinical symptomscaused by other pathogens and even diseases caused by endogenous opportunisticmicroorganisms.This paper presents a case of mycotic colitis in two fattening pigs that exibit clinicalsigns of circoviral infection during the life. Corpses of pigs, about 80 days old,originated from a commercial farm, were autopsied at the Pathology Department of theInstitute of Veterinary Medicine of Serbia, Belgrade. After the necropsy samples oflymph nodes, spleen, tonsils and parechimatous organs were sampled for moleculardetection of viral genome of classical swine fever and PCV-2 virus, while the samplesof changed colon were taken for bacteriological, mycological and histopathologicalexamination.Macroscopic findings included circumscript, multiple, diphtheritic – ulcerative colitis.Foci of mucosal diphtheritic pseudomembranes are rising extremely above thesurrounding mucosa, recalling the buton with the classical swine fever. Some authorsdescribe them as buton - like colitis. Also, there was generalized lymphadenopathy,interstitial pneumonia and multiple subcapsular white foci in the kidneys.Histopathological examination of colon sections stained with HE reveals necrosis of thetunica mucosa in the form of eosinophilic structureless mass that reaches tunicasubmucosa, and in some places even deeper. In preparations stained by Grocott wereestablished branched and nonsepted hyphae of fungi which correspond morphologicallyascomycetas. Bacteriological results were negative for the presence of Brachyspirahyodisenteriae, Lawsonia intracellularis and Salmonella spp. Fungi of the genus Mucorspp. were isolated by mycological examination. RT-PCR assay of the sampled organshas not proved the presence of the genome of classical swine fever virus, and the PCRtest proved the presence of PCV-2 genome.Based on the findings of fungal elements in the tissue of colon and evidence of genomeof PCV-2 virus, we concluded that this case was about mycotic colitis, respectivelyabout local mycotic opportunistic infection that was caused by an immunosuppressiveaction of PCV-2. Morphology and localization of mycotic colitis requires a164

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕmultidisciplinary diagnostic approach in the differential diagnosis, especially incomparison to classical swine fever.Acknowledgments: The study was supported by grant III 46009 and TR 31062 from Ministry ofEducation, Science and Technological DevelopmentKey words: mycotic colitis, porcine circovirus type 2, swineDVM Djordje Cvetojević, research assistant, PhD Branislav Kureljušić, research associate, PhD BoţidarSavić, research fellow, DVM Nemanja Jezdimirović, research associate, MSc Ljubiša Veljović, researchassociate, DVM Jasna Kureljušić, research associate, MSc Oliver Radanović vet. spec., research associate,PhD Vojin Ivetić, senior research fellow, Institute of Veterinary Medicine of Serbia, Vojvode Toze 14, 11000Belgrade, Serbia, jaffvet@gmail.com ;МИКОТИЧНИ КОЛИТИС КОД СВИЊА УДРУЖЕН СА ИНФЕКЦИЈОМЦИРКОВИРУСОМ ТИП 2Цветојевић Ђ., Курељушић Б., Савић Б., Јездимировић Н., Вељовић Љ.,Курељушић Јасна, Радановић О., Иветић В. *Кратак садржајСвињски цирковирус тип 2 (PCV-2) је космополитски раширен патоген којидоводи до имуносупресије и све већих директних и индиректних губитака уинтензивној производњи свиња. Инфекција свиња са PCV-2 проузрокује неколикоразличитих клиничких облика болести, тако да се данас говори о цирковируснимобољењима свиња (PCVD – Porcine Circovirus Disease). Листа обољења за које сесматра да су у етиолошкој вези са PCV-2 значајно се проширила. Сходно овом, уновије време се говори о обољењима повезаним са PCV-2 (PCVAD - PorcineCircovirus Associated Disease). Поред клиничких ентитета који спадају у комплексPCVAD, цирковирус тип 2 може значајно допринети еволуцији клиничкихсимптома болести изазваних другим патогенима па чак и болести проузрокованихендогеним опортунистичким микроорганизмима.У овом раду је приказан случај микотичног колитиса код две свиње изтехнолошке фазе предтова којe су за време живота показивалe клиничке знаковецирковирусне инфекције. Лешеви свиња старости око 80 дана, пореклом са једнекомерцијалне фарме, обдуковани су на Одељењу за патолошку морфологијуНаучног института за ветеринарство Србије у Београду. Након обдукције узорцилимфних чворова, слезине, тонзила и паренхиматозних органа су узорковани замолекуларну детекцију генома вируса класичне куге свиња и PCV-2 вируса, доксу узорци промењеног дела колона узети за бактериолошка, миколошка ипатохистолошка испитивања.Макроскопским прегледом установљен је циркумскриптни, мултипли,дифтероидно – улцерозни колитис. Фокуси дифтероидних псеудомембранамукозе колона изразито су проминирали изнад нивоа околне слузнице,подсећајући на бутоне код класичне куге свиња. Поједини аутори их описују као165

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYSбутонима сличан колитис. Поред тога, установљени су генерализованалимфаденопатија, интерстицијална пнеумонија и мултипла субкапсуларна белаогњишта на бубрезима. У патохистолошким препаратима колона бојеним ХЕметодом уочена су некротична поља тунике мукозе у виду еозинофилнебеструктурне масе која досеже до тунике субмукозе, а на неким местима и дубље.У препаратима бојеним Grocott методом установљене су разгранате и несептиранехифе гљивица које морфолошки одговарају аскомицетама. Бактериолошки налазје био негативан на присуство Brachyspira hyodisenteriae, Lawsonia intracellularis ибактерија рода Salmonella spp. Миколошким прегледом изоловане су гљивицерода Mucor spp. RT-PCR тестом из узоркованих органа није доказано присуствогенома вируса класичне куге свиња, док је PCR тестом доказано присуство геномаPCV-2 вируса.На основу налаза гљивичних елемената у ткиву колона и доказа генома PCV-2вируса можемо закључити да се у овом случају радило о микотичном колитису,односно о локалној опортунистичкој микотичној инфекцији која је настала каопоследица имуносупресивног деловања цирковируса тип 2. Морфологија илокализација микотичног колитиса захтева мултидисциплинарни дијагностичкиприступ у диференцијалној дијагнози, пре свега, у односу на класичну кугусвиња.Захвалност: Рад је реализован по пројектима III 46009 и ТР 31062 који се финансирају одстране Министарства просвете науке и технолошког развоја Републике СрбијеКључне речи: микотични колитис, свињски цирковирус тип 2, свињадр вет. мед. Ђорђе Цветојевић, истраживач приправник, др Бранислав Курељушић, истраживачсарадник, др Божидар Савић, научни сарадник, др вет. мед. Немања Јездимировић, истраживачсарадник, мр Љубиша Вељовић, истраживач сарадник, др вет. мед. Јасна Курељушић, истраживачсарадник, мр Оливер Радановић спец. вет., истраживач сарадник, др Војин Иветић, виши научнисарадник, Научни институт за ветеринарство Србије, Војводе Тозе 14, 11000 Београд, Србија,јаffvet@gmail.com166

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕTHE INFLUENCE OF ENVIRONMENTAL FACTORS ON THE EMERGENCEOF INFECTIOUS DISEASESVidić Branka, Savić Sara, Cirar Ivana, Vidić M., Prica NadeţdaAbstractGlobalisation and climate changes have great influence in the world, on occurense anddevelopment of infectious diseases in humans and animals and esspecially zoonozes.Besides that, changes in demography and habits of people, advanced tecnologies,international transort and trade, and also changes and adaptation of microorganisms aresignificant factors for the occurence of infectious diseases, due to the apperiance ofnew pathogens, changes in already existing pathogens and known pathogens detected innew regions or new host population. Environmental changes, including the ones whichare a consequence of economical and agricultural development, are the most frequentcause of so called emergent infectious diseases, due to the close contact of humans anddomestic animals with infection reservoars in the surroundings. Some new, so farunknown infectious diseases have been detected, but also the increasingly commoninfectious diseases in humans which were considered already eradicated or undercontrol. Climate changes disturb natural processes in ecosystem and contribute tocreating favorable conditions to achieve contact with the reservoars of pathogen agentsfor humans and animals. Diseases previously perferably conected to tropical regions,now are spreading to the regions with moderate climate, what is conected to the globalworming. Insects which are vectors for certain diseases are now present also in regionswhere thez did not exist before. Humans are also exposed to a higher risk because of thepresence of insects - vectors for diseases like malaria, denga and zellow fever. Climatechanges on a long –term influence the population of insects, the dynamics of theirmultiplication, especially tamperature and humidity, which on the long run affects theirgeographical distribution. Higher temperature in the enviroment enables for insects andmicroorganisms to multiply faster, because that is not possible on lower temperatures.Significant and severe zoonozes, such as avien influence, Lzme disease and Rift valleyfever are probably a consequence of global warming. Highly pathogen virus H 5 N 1 is aserious threat and great concern, because the main bird migration roads are beeingdisrupted or changed, due to extremly low or high temperatures. This fact enables acloser contact of wild and domestic birds and also humans. The role of ticks in theapperiance of diseases such as babesiosis and Lyme disease, mosquitoes for tranferingthe virus of Rift valley fever, denga fever, blue tongue in ruminants, dirofilariosis andcausative agent for malaria are well known. Also, a geographical distribution of of thesediseases is known, caused by the climate changes. The influence of these diseases topublic health and economy of every country is huge and it affects humans and animals.Unfortunately, the consecquences are always the largest in the most poor countries. Themost important consequence of global warming can be an inceased mortality in wildand domestic animals and also humans. The degree of the spreading of diseases is hardto predict, because for the apperiance of the disease are also important some otherfactors. That is why it is very important to use data and analysis from the previous167

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYSepidemics, monitor and update control programs for diseases, use modern technology(satelite measurements), aply new knowledge and predict and prepare several scenariosfor the case the disease appears. Medical and veterinary services must work effectivlyand apply adequate procedures for the prevention and control of infectious diseases.New methods and for early, quick and precise diagnostics should be developed(nanotechnologies, biosenyores, etc)Key words: environment, climate changes, infectious diseasesdr Branka Vidić, dr Sara Savić, mr Nadeţda Prica, Scientific Veterinary Institute „Novi Sad―, Novi SadIvana Cirar student-master, Faculty of natural and mathematical sciences, University of Novi Sad; MilanVidić student, Agricultural faculty, University of Novi SadУТИЦАЈ ЕКОЛОШКИХ ФАКТОРА НА ПОЈАВИ И РАЗВОЈ ЗАРАЗНИХБОЛЕСТИВидић Бранка, Савић Сара, Цирар Ивана, Видић М., Прица Надежда 1Кратак садржајГлобализација и климатске промене имају огроман утицај у свету на настанак иразвој заразних болести људи и животиња, а посебно зооноза. Осим тога променеу демографији и понашању људи, напредак технологије, међународни транспорт итрговина, као и промене и адаптација микроорганизама су значајни фактори запојави заразних болести, као последица појаве нових патоге на, измењених већпостојећих патогена и познатих патоген који су доказани на новим подручју илиновој популацији домаћина. Еколошке промене, укључујући и оне које супоследица економског развоја и развоја пољопривреде су најчешћи узроци појаветкз. емергентних заразних болести, а које су последица блиског контакта људи идомаћих животиња са резервоарима инфекције у окружењу. Забележена је појаванових, до сада непознатих заразних болести, али и све чешћа појава заразнихболести код људи за које се мислило да су искорењене или да су стављене подконтролу. Климатске промене ремете природне процесе у екосистемима идоприносе стварању повољних услова да се оствари контакт са резервоаримапатогених агенаса за људи и животиња. Болести које су раније биле везане само затропске болести сада се шире на области са умеренијом климом, а што је повезаноса глобалним загревањем. Инсекти који преносе болести сада су присутни и уимереним областима у којима нису постојали. Људи су такође изложениповећаном ризику због присуства инсеката који су преносиоци болести као што јемаларија, денга и жута грозница. Дугорочне промене климе утичу на популацијуи динамику размножавања инсеката, нарочито температура и влажноста, штоутиче на њихову географску дистрибуцију. Виша спољашња температураомогућава инсектима и микроорганизмима да се брже размножавају, јер то наниских температурама није могуће. Значајне и озбиљне зоонозе као што је168

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕптичији грип, Лајмска болест и грозница долине Рифт су вероватно последицаглобалног загревања. Високопатогени вирус H 5 N 1 представља озбиљну претњу ивелику забринутост, јер су прекинути или измењени главни путеви миграцијептица због екстремно ниских и високих температура, а тиме је омогућен ближиконтакт дивљих и домаћих птица, а онда и људи. Улога крпеља у појављивањуболести као што је бабезиоза и Лајмска болест, комараца у појави и преношењувируса грознице долине Рифт, денга грознице, плавог језика код преживара, иузрочника маларије су добро познати, као ии географска дистрибуција овихболести са узрокована са климатским променама. Утицај ових болести наздравље и привреду сваке земље је огроман и погађа људе и животиње, али супоследице увек највеће у најсиромашнијим земљама. Најважнија непосреднапоследица глобалног загревања може бити повећана смртност дивљих, домаћихживотиња и људи. Степен ширења болести тешко је предвидети, јер за настанакболести битни су и неки други фактори. Због тога је веома важно користитиподатке и анализе претходних епидемија, пратити и иновирати програме контролеи праћења болести, користити савремену технологију (сателитска мерења),примењивати нова сазнања и предвидети и припремити неколико сценаријауколико се болест појави. Хумана и ветеринарска служба морају ефикасноделовати да се примене адекватне поступци и мере за спречавање и контролуинфективних обољења и да се развију нове методе за рано, брзо и тачнопостављање дијагнозе ( нанотехнологија, биосензори и др).Кључне речи: спољашња средина, климатске промене, заразне болестидр Бранка Видић, др Сара Савић, мр Надежда Прица, Научни институт за ветеринарство „Нови Сад―Нови Сад; Ивана Цирар студент-мастер, Природно-математички факултет, Универзитет у НовомСаду ; Милан Видић студент, Пољопривредни факултет, Универзитет у Новом Саду169

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYSIMMUNOHISTOCHEMICAL ANALYSIS OF MAREK'S DISEASEVucicevic Ivana, Nesic S., Vucicevic Miloš, Aleksic-Kovacevic Sanja*Aim: Marek‘s disease (MD) is a lymphoproliferative disease of chickens characterizedby multiple visceral lymphomas or by inflamation and degeneration of peripheralnerves. The disease is caused by an oncogenic herpes virus that is spread by dust fromdesquamated epithelial cells of feather follicles and is transmitted by inhalation. Thevirus is transported by macrophages from the respiratory system to the primary andsecondary lymphatic organs, where it multiplies. During the acute phase, virusmultiplies cytolytically in B cells, followed by a latent phase, during which T cellsbecome transformed and develop into lymphomas in several visceral organs, skin,muscles, nerves, and less frequently in the eyes. The aim of the paper is to determine thephenotype of neoplastic cells by using the immunohistochemical staining, as well as todetermine the presence of the proliferating cell nuclear antigen (PCNA).Material and methods: The following organs of 30 chikens infected with Marek‘sdisease were examined: liver, spleen, kidneys, proventriculus, lungs, heart, ovary andsciatic nerves. The streptavidin-biotin (LSAB) commercial detection kit (ChemmateK 5003) was used for the staining procedure in order to detect CD3 (T- lymphocytes)and CD79 (B-lymphocytes). The proliferating cell nuclear antigen was also determinedby immunohistochemical staining. The commercial primary and secondary monoclonalantibodies were used in this work. In order to unmask antigens the paraffin embeddedsections were heated in a microwave oven in citrate buffer pH = 6. 0,3% hydrogen peroxideand methanol were used to quench endogenous peroxidase. All rinsing procedures and seradilutions were done in PBS. Before incubation with primary antibodies the sections wereincubated with 10% goat sera in PBS. The reaction was visualized by applying chromogen aminoethyl-carbazole (AEC) or diaminobenzidine (DAB).Results: The affected organs were enlarged, compact and very brittle and very oftenhad an irregular shape. Livers were enlarged with multiple gray or yellow tumors.Spleens were enlarged and dark red. In some cases gray-yellow nodules of differentshapes were seen. Tumor proliferates predominantly consisted of lymphoblasts and hadall the characteristics of a lymphoma. Proliferation of lymphoid cells of focal anddiffuse character was found in various organs. Most of these cells were CD3 stained andCD79 positive cells were clearly seen in tumors, although the staining was weakcomparing to CD3. PCNA expression was intense in proliferating neoplastic cells.Conclusion: Immunohistochemical analysis revealed that lymphoma cells in MD arepredominantly of T cell type, CD3 + phenotype with a very high proliferative potentialand increased expression of PCNA.Key words: Marek diseaseDr vet.med.Ivana Vucicevic, dr vet.med Sladjan Nesic, assitent, dr vet.med Miloš Vucicevic, dr SanjaAleksic-Kovacevic, professor,Faculty of Veterinary Medicine, University of Belgrade Bul. osloboĊenja 18,11000 Belgrade170

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕИМУНОХИСТОХЕМИЈСКО ИСПИТИВАЊЕ МАРЕКОВЕ БОЛЕСТИВучићевић Ивана, Нешић С., Вучићевић М., Алексић-Ковачевић Сања *Циљ рада: Марекова болест је лимфопролиферативно обољење живине које секарактерише образовањем лимфома у унутрашњим органима или запаљенским идегенеративним променама на нервима. Узрочник МБ је онкогени херпес вирусживине који, везан за десквамисане епителне ћелије фоликула пера из простирке ипрашине објекта, представља извор респираторне инфекције за пилиће. Изреспираторног система вирус се макрофагима транспортује у примарне исекундарне лимфатичне органе где се и умножава. У првој фази инфекције Блимфоцити су главне циљне ћелије у којима се вирус умножава. После ове фазедолази до активације и ћелијске трансформације Т лимфоцита што је праћеноразвојем лимфома у органима, кожи, мускулатури, нервима и ређе на очима. Циљрада је да се помоћу имунохистохемијских бојења утврди фенотип неопластичнихћелија код Марекове болести, као и присуство маркера ћелијске пролиферације(Proliferating Cell Nuclear Antigen – PCNA, енг).Материјал и методе : Испитани су јетра, слезина, бубрези, жлездани желудац, плућа,срце, јајници и исхијадични нерви 30 пилића оболелих од Марекове болести. Одимунохистохемијских метода, употребљена је тростепена стрептавидин-биотин метода(LSAB) - детекциони кит (Chem Mate К 5003), са циљем обележавања ЦД3+ (Т лимфоцити)и ЦД79+ (Б лимфоцити). Обележен је и антиген ћелијске пролиферације (PCNA). Уимунохистохемијској методи коришћена су комерцијална примарна моноклонска антитела.Демаскирање антигена, претходно маскираних фиксирањем у формалину, постигнуто језагревањем у микроталасној пећи, у цитратном пуферу pH=6. Ендогена пероксидазаблокирана је у 0,3% H 2 О 2 у метанолу. Сва испирања и разблажења током реакције рађенасу у PBS-у. Преинкубација је постигнута у 10% козјем серуму у PBS-у. Реакција је учињенавидљивом помоћу хромогена етил-карбазола (АЕC) или диаминобензидина (DAB).Резултати: Захваћени органи су знатно повећани, компактни и веома крти, честонеправилног облика. Најкарактеристичније су промењене слезине и јетре. Јетре суувећане са већим бројем тумора сиве или жуте боје. Слезине су повећане и тамноцрвене боје. У појединим случајевима и на њиховој површини се уочавају сивожутинодули. Туморске пролиферате доминантно чине лимфобласти и имају свекарактеристике лимфома. У испитиваном материјалу установљена јепролиферација ћелија лимфоидне лозе, у различитим органима фокалног илидифузног карактера. Већина ових ћелија се позитивно обојила на ЦД3, док јеЦД79 бојење знатно слабијег интензитета. Експресија ПЦНА је била интензивна унеопластичним ћелијама.Закључак: Имунохистохемијском анализом је установљено да су ћелије лимфома кодМарекове болести доминантно Т ћелијског типа, ЦД3+ фенотип, са веома израженимпролиферативним потенцијалом, односно повећаном експресијом PCNA.Кључне речи: Марекова болестДр вет.мед Ивана Вучићевић, др вет мед.Слађан Нешић, асистент, др вет.мед Милош Вучићевић, профдр Сања Алексић-Ковачевић, Факултет ветеринарске медицине, Универзитет у Београду Бул.ослобођења 18, 11000 Београд171

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYSEPIZOOTIOLOGICAL SURVEY: VIRAL INFECTIONS OF APIS MELLIFERASantraĉ Violeta *AbstractViral infection diagnostic work is important part of knowing pathosfere of honey bee,Apis mellifera. OIE still does not recognize importance and need of viral infectionsnotification concerning honey bee health status.There are plenty publications with clear information‘s about widespread honey bee viralinfections trough whole world in pandemic form for most prevalent viruses andfindings that they are able to change natural history of coexistence virus and hostrelation under defined social organism that bee hives are. Varroa destructor parasiticmites, have vector transmission function for some of viruses that are seen as emergentpathogens.Epizootiological examination in the east Herzegovina region apiaries, which wereclinically normal and healthy productive hives; under six different locations, withmolecular diagnostic procedure, we found viral infections load. From 15 hives, weobserved, 12 of them (80%) where positive for signal of at least one from five virustotally. Infections were with single as well as confections with two distinctive virus atthe same time. We followed protocol for five honey bee viruses (ABPV, BQCV, CBPV,DWV, and SBV) and they were positive for three viruses: DWV (80%), BQCV (40%),SBV (13, 30%). In our samples there were no positive signals for ABPV, CBPV.Concerning our findings, as a showcase‖, it is relevant to have regularly examination forhoney bee viruses presence, regularly, if we want to know honey bee health statusconcerning qualitatively and quantitative results that will be evaluated.Key words: Apis mellifera, virus, molecular diagnosticMр.Sc. Violeta Santrac, DVM, Public veterinary Institute of the Republic of Serpska „ Dr Vaso Butozan―Banja LukaЕПИЗООТИОЛОШКИ НАДЗОР ВИРУСНИХ ИНФЕКЦИЈА КОД ВРСТЕAPIS MELLIFERAСантрач Виолета *АпстрактДијагностика вирусних болести пчела неопходан је дио доказа патосферепчелињих заједница. Oд стране ОИЕ-а вирусне болести пчела ни до данас нисусврстане на листу болести обавезних за пријављивање. Велики број публикацијаусвијету наводи чинјеницу о панзоотској присутности неколико најзначајнијихвируса који мијењају еволуцијску стабилност социјалне заједнице у отпорности172

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕна вирусе. Неки од проучаваних вируса због векторске улоге гриње Varoadestructor имају улогу емергентних патогена.У једном издвојеном испитивању на територији источне Херцеговине у клиничкинаизглед виталним производним заједниицама шест пчелињака, молекуларнимметодама дијагностике, утврдили смо присуство вирусних инфекција. Од укупноиспитаних петнаест заједница (са шест случајно изабраних пчелињака) у 12заједница (80%) доказали смо присуство једног од пет тражених вируса уформама инфекције једним вирусом или коинфекцијама са два вирусаистовремено. Од пет тражених вируса (ABPV, BQCV, CBPV, DWV, SBV)утврдили смо у испитаним узорцима присуство нуклеинских киселина за тривируса: DWV (80% ), BQCV (40%), SBV (13,30%). У испитаним узорцима нијеутврђено присуство вируса ABPV, CBPV.Како би слику патолошког оптерећења и фактора ризика за „здравље― пчелињезаједнице употпунили, што се види из приказаног показног случаја, било бипотребно контртолисати заједнице на присуство вирусних инфекција јер се безквалитативног али и квантификативног налаза вируса, дијагностика статусазаједница тешко може узети у обзир као релевантна.Кључне ријечи: Apis mellifera, вирус, молекуларна дијагностикаМр. Виолета Сантрач, ДВМ, Ветеринарски институт Републике Српске „ Др Васо Бутозан― Бања Лука173

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYSSession 4PARASITIC INFECTIONS / ПАРАЗИТСКЕИНФЕКЦИЈЕ174

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕ175

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYSHUMAN TOXOCARIASIS IN BELGRADEDakić Zorica, Mitrović N., InĊić N., Malinić J. , Ofori-Belić Irena , Pavlović M.AbstractToxocariasis is a parasitic zoonosis which occures due to migration of primarilyToxocara canis and Toxocara cati larvae through the human organism. Infected dogsand cats contaminate the environment by Toxocara eggs with their feces. According torecent case reports human toxocariasis is very common infection in Serbia. Theprevalence of infection of T. canis eggs in dog faeces was reported to be 30.5% inBelgrade. There's also high prevalence of T. canis eggs in soil samples collected frompublic parks in Belgrade.A retrospective seroepidemiological survey of human toxocariasis was carried out fromSeptember 2006 to May 2012 and included serum of 695 patients with suspectedtoxocariasis who were diagnosed in Parasitological Laboratory, Clinical Center ofSerbia. Toxocara-specific IgG was detected in sera by commercial ELISA. Theseroprevalence of toxocariasis was 22.2%. The highest seroprevalence was notified inthe

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕХУМАНА ТОКСОКАРИЈАЗА У БЕОГРАДУДакић Зорица, Митровић Н., Инђић Н., Малинић Ј., Офори-Белић Ирена,Павловић М 3Кратак садржајTоксокаријаза је паразитска зооноза која настаје миграцијом ларви Toxocara canisи Toxocara cati у организму човека. Инфицирани пси и мачке контаминирајусредину са јајима Toxocara sp. која се налазе у њиховом фецесу. Према недавнимприказима случаја токсокаријаза је веома значајна инфекција. Преваленција T.canis јаја код паса у Београду је 30,5%. Такође се бележи висока контаминираностјавних паркова јајима T. canis у Београду.Ово је ретроспективна сероепидемиолошка студија хумане токсокаријазе која јеспроведена анализом серолошких резултата 695 пацијената суспектних натоксокаријазу који су дијагностиковани у Паразитолошкој лабораторијиКлиничког центра Србије од септембра 2006. до маја 2012. године. За детекцијуToxocara-специфичних IgG коришћена је комерцијална ELISA. Серопреваленцијаје била 22,2%. Највиша серопреваленција забележена је у узрасту

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYSFIRST REPORT OF CAPILLARIA HEPATICA (BANCROFT, 1893) INAPODEMUS FLAVICOLLIS IN SERBIAĈabrilo B., Jovanović V., Budinski Ivanа, Blagojević Jelena, Vujošević M., Bjelić-Ĉabrilo OliveraAbstractInfection with Capillaria hepatica was detected in two specimens of yellow-neckedmouse (Apodemus flavicollis) collected from the cages set for breeding experiments inthe yard of the Institute for Biological Research, Belgrade, Serbia. The origin of theanimals was Obedska bara locality. The presence of the parasite was detectedmacroscopically, through pathological changes visible on the extracted livers, andmicroscopically, based on the presence of C. hepatica individuals and eggs in a tissuesmear. Parasitic infection was severe in both of the inspected individuals, with morethan half of the liver tissue suffering changes due to helminth infestation. Taking intoaccount the living conditions of the animals, transmission of the parasite was mostlikely achieved through cannibalism or via insects. Other rodent and insectivore species,as well as humans, are potential hosts of C. hepatica, and infection results in healthconsequences and, in certain cases, death. Thus, the presence of this nematode speciesin Serbia carries important epizootiological and epidemiological connotations.Key words: Capillaria hepatica, yellow-necked mouse, SerbiaBorislav Ĉabrilo, research assistant, Dr Olivera Bjelić-Ĉabrilo, Department of Biology and Ecology, Facultyof Science, University of Novi Sad, Dositej Obradović 2, Novi Sad; Dr Vladimir Jovanović, Ivana Budinski,research assistant, Dr Jelena Blagojević, Dr Mladen Vujošević, Institute for Biological Research ―SinišaStanković‖, Despot Stefan Boulevard 142, Belgrade178

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕПРВИ НАЛАЗ ВРСТЕ Capillaria hepatica (BANCROFT, 1893) КОД Apodemusflavicollis У СРБИЈИЧабрило Б., Јовановић В., Будински Ивана, Благојавић Јелена, Вујошевић М.,Бјелић-Чабрило ОливераКратак садржајИнфекција нематодом Capillaria hepatica је утврђена код две јединке жутогрлогмиша (Apodemus flavicollis) прикупљене из кавеза постављених радиексперимената парења у дворишту Института за биолошка истраживања уБеограду, Србија. Животиње потичу са локалитета Обедска бара. Присуствопаразита је потврђено како макроскопски, преко патолошких промена наизолованим јетрама, тако и микроскопски, на основу присуства јединки и јајанематоде у размазу ткива. Паразитска инфекција је у обе испитане јединке билавеома изражена, при чему је више од половине ткива јетре претрпело променеуслед инфекције хелминтом. Узимајући у обзир услове живота животиња, преноспаразита је највероватније постигнут канибализмом или путем инсеката. Другеврсте глодара и бубоједа, као и човек, су потенцијални домаћини врсте C.hepatica, при чему инфекција изазива последице по здравље индивидуе, а уодређеним случајевима и смрт. Стога присуство ове врсте у Србији са собом носизначајне епизоотиолошке и епидемиолошке конотације.Кључне речи: Capillaria hepatica, жутогрли миш, СрбијаБорислав Чабрило, истраживач приправник, Оливера Бјелић-Чабрило, Катедра за биологију иекологију, Природно-математички факултет, Универзитет у Новом Саду, Доситеја Обрадовића 2, НовиСад ; Владимир Јовановић, Ивана Будински, истраживач приправник, Јелена Благојевић, МладенВујошевић, Институт за биолошла истраживања „Синиша Станковић―, Булевар Деспота Стефана 142,Београд179

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYSEPIDEMIOLOGYCAL ASPECTS OF MOLEKULAR INVETIGATIONS OFECHINOCCOCOSIS AND HYDATIDOSIS IN DOMESTIC AND WILDANIMALSDebeljak Z., Kulišić Z., Vidanović D., Tomić A.AbstractEchinococcosis is a zoonotic disease caused by Echinococcus spp. tapeworms.The definitive hosts, which include dogs, cats, and other canids carry the adulttapeworms subclinically. Hydatid disease is caused by metacestode stage of parasitesand this is the most important disease in people and many domestic and wild animals.Dogs are particularly important in zoonotic transmission due to their close relationshipswith humans. Echinococcosis is a major public health problem in some countries, andvery serious economic problem in animal production.E. granulosus complex has been divided into strains, named G1 to G10. Some of thesestrains has zoonotic importance (the G1 - sheep strain, G2 - Tasmanian sheep strain, G3- buffalo strain, G5 – cattle strain, G6-camel strain, G7- pig strain, G8-cervid strains).The some strains of parasites (G1, G1BC, G2 and G3) grouped together in the speciesEchinococcus granulosus sensu stricto. Other species: E. equinus (G4), E. ortleppi(G5), E. canadensis (G6 – G10) and E. felids (reported from Africa) grouped togetherin the species E. granulosus sensu lato. The G9 strain has reported only from humancases in Poland, and it may be a variant of the pig strain (G7).Echinococcus multilocularis causes a type of echinococcosis known as alveolarechinococcosis or alveolar hydatid disease. E. shiquicus has been isolated only fromsmall mammals and Tibetan foxes (Vulpes ferrilata) from the Tibetan region of China.Echinococcus vogeli and Echinococcus oligarthrus are known as polycysticechinococcosis and thay have been found only in Central and South America,Molecular investigations of strains is very important becouse the different strains maydiffer in their morphology, rate of development, virulence, geographic range and otherfactors. Knowlage about present strains on some theritory has important epidemiologysignificance, and different aspects of control disease.Key words: echinococcosis, hydatidosis, genotips, molecular determinationMr vet. sci. Zoran Debeljak, dr. vet. spec. Epizootology, Dr vet. sci. Dejan Vidanović, Mr vet.sci. AleksandarTomić - VSI „Kraljevo―, debeljak@vsikv.com ; Prof. dr vet. sci. Zoran Kulišić, spec. Parasitology and parasit.diseases – Faculty of veterinary medicine in Belgrade180

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕЕПИЗООТИОЛОШКО ЕПИДЕМИОЛОШКИ АСПЕКТ МОЛЕКУЛАРНОГПРОУЧАВАЊА ЕХИНОКОКОЗЕ И ХИДАТИДОЗЕДОМАЋИХ И ДИВЉИХ ЖИВОТИЊАДебељак З., Кулишић З., Видановић Д., Томић А.Кратак садржајЕхинококоза је зоонотска инфекција изазвана одраслим обликом пантљичаре којаприпада роду Echinococcus, фамилији Taeniidae.Дефинитивни домаћини су пси, лисице, хијена и друге каниде, као и мачке идруге фелиде, код којих обољење јавља најчешће субклиничком току. Ларвениоблици ове пантљичаре (метацестоде) се налазе код прелазних домаћина (људи ибројних врста сисара) и изазивају тешко обољење, познато као хидатидоза илихидатидозна болест, са огромним економским штетама у сточарској производњи иозбиљним клиничким обољењем људи. Болест је по својој раширености светскихразмера, са сталним порастом у инциденцији, и код животиња и код људи, сапосебно неповољном ситуацијом у земљама трећег света где је низак хигијенски иекономски стандард, а истовремено значајно екстензивно сточарство.Са епидемиолошког аспекта посебан значај имају E. granulosus и E. multilocularis.Echinococcus granulosus који има статус глобалне раширености и Е. multilocularis сазначајном раширеношћу на северној хемисфери имају велики зоонотски значај натериторији Европе, Медитерана и региона у коме се налази и Србија.Од посебног епидемиолошког значаја је генетска разнородност E. granulosus комплексакоји има 10 генотипова од којих су 7 зоонозног карактера (овчији сој G1, сој Тасманијскеовце G2, бизонски сој G3, говеђи сој G5, камиљи сој G6, свињски сој G7 и јеленски сој G8).Тренутна подела рода Echinococcus, извршена је на више врста: Е. granulosus sensu stricto(G1, G1BC, G2 i G3), E. equinus (G4), E. ortleppi (G5), E. canadensis (G6 – G10) и E. felids(лављи сој доказан у Африци). Сој Г9 доказан је само код људи у Пољској и неки ауторисматрају да је то варијанта свињског Г7 соја. Echinococcus chiquicus доказан је код малихсисара и Тибетанске лисице на Тибетској висоравни. Инфекција са Е. vogeli и Е. oligarthrus,познати као изазивачи полицистичне хидатидозе, за сада су генетски јединствени, априсутни у Централној и Јужној Америци. Различите врсте паразита и генотипови имајуразличите, или више њих чак и исте, дефинитивне и прелазне домаћине, што зависи одврсте и генотипа.Молекуларна детерминација узрочника хидатидозе данас је саставни деопроучавања савремене молекуларне епизоотиологије и епидемиологије овеозбиљне болести. У многим земљама овим проучавањима дефинисани суприсутни и доминантни генотипови као узрочници хидатидозе код људи иживотиња. Значај ових проучавања је у различитим епизоотиолошкимкарактеристикама појединих сојева, који су битни са аспекта озбиљног приступа уконтроли и сузбијању болести.Кључне речи: ехинококоза, хидатидоза, генотипови, молекуларна детерминацијаМр вет. сци. Зоран Дебељак, др. вет. спец. Епизоотологије Др вет. сци. Дејан Видановић, Мр вет.сци.Александар Томић, - ВСИ „Краљево―, debeljak@vsikv.com ; Проф. др вет. сци. Зоран Кулишић, спец.паразитологије и паразит. болести - Факултет ветеринарске медицине Универзитета у Београду181

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYSINVESTIGATION ON COMPARATIVE EFFICACY OF COMBINATION OFIMIDACLOPRID AND PERMETHRIN OR MOXIDECTIN IN CONTROL OFDOG TICKSMilanka Jezdimirović, Nevenka Aleksić, Nemanja JezdimirovićAbstractTicks are obligatory haematophagous arthropods, reservoirs and vectors for numerouszoonoses, including those caused by Rikettsia spp., Anaplasma phagocytophilum,Borrelia burgdorferi sensu lato, Francisella tularensis, Crimean-Congo haemorrhagicfever virus and tick-borne encephalitis virus. Thus, tick control is necessary in naturalhabitats, as well as indoors and on hosts.Nowadays synergistic combinations of endectocides with various mechanisms of actionare preferred for their higher efficacy, safety, wider antiparasitic spectre, long-standingefficacy and simple application (spot on formulation). In the current work the acuteacaricide and residual (protective) efficacy of the combination of imidacloprid withpermethrin or with moxidectin was assessed in dogs naturally infested withRhipicephalus sanguineus and Ixodes ricinus. The research was performed according tothe protocol proposed by EMEA.The results of investigation on acute acaricide efficacy (24 h and 48 h following theadministration) of the combination of imidacloprid and permethrin proved in sufficient(about 70 %), whilst the residual efficacy was maximum and did not change for fiveweeks.Acute acaricide efficacy of the synergistic combination of imidacloprid and moxidectinwas minimum (25-30 %), and the protective one even less (about 15 %). Thiscombination cannot be used for tick control, which is stated in the Instruction for use.Key words: ticks, dog, imidacloprid, permethrin, moxidectin, efficacyDr Milanka Jezdimirović, professor, dr Nevenka Aleksić professor, Faculty of Veterinary Medicine,University of Belgrade, Belgrade; DVM Nemanja Jezdimirović, Research assistant, Scientific Institute ofVeterinary Medicine of Serbia, BelgradeIntroduction - Ticks are obligate haematophagous arachnids, mechanical or biologicalvectors of the causative agents of numerous zoonoses, among which Rickettsia spp.,Anaplasma phagocytophilum, Borrelia burgdorferi sensu lato, Francisella tularensis,Congo-Crimean haemorrhagic fever virus and tick encephalitis virus are of utmostimportance (Milutinović et al., 2008, Pavlović et al., 2008; Tomanović et al., 2011).Approximately 900 tick species have been described; about 10 % may attack animalsand humans, which leads to the necessity of their control with efficacious acaricides(Eckert et al., 2008; Guglielmone et al., 2010). In Serbia about twenty species arepresent Ixodes ricinus, Dermacentor reticulatus, Dermacentor marginatus and182

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕRhipicephalus sanguineus being the most prevalent (Pavlović et al., 2008; Savić et al.,2012).From the epidemiological standpoint knowledge on the biology and distribution of ticksis very important. Their control in natural habitats, as well as indoors and on hosts isnecessary. In the recent past for tick control on animals most frequently organicchlorine, organophosphorus and carbamate acaricides were used, which hadcomparatively low efficacy, resulted in frequent unwanted side-effects and lead to longlastingcontamination of the environment (Jezdimirović, 2010; Aleksić, 2012).However, over time ticks have developed resistance to many synthetic pyrethroids(Pavlović et al., 2000; Eiden et al., 2012). The use of organophosphorus andorganochlorine preparations has considerably decreased or even discontinued in somecountries (Information on prohibited and acceptable external parasite control productsfor animals within the Animal Welfare Approved program). In the last decade theproblem with tick resistance prompted the work on efficacious and safe synthetic andnatural acaricides, or combinations of newly synthesised (phenylpyrazole acaricides,neonicotinoids, insect growth regulators) and old substances with the aim of thedevelopment of more efficient and safe preparations for use on animals. Nowadays thecontrol of tick infestation on dogs is mainly based on preparations consisting ofsynergistic combinations of ectocydes with different mechanisms of actions in spont-onformulations for topical treatment. They are expected to have a prompt, effective andlong-lasting acaricidal effect as well as to be harmless to the host and the environment.They are significantly less toxic to dogs in comparison with mono-componentpreparations and do not lead to unwanted reactions in people who handle them.In the current work the acute acaricidal efficacy and the duration of residual (protective)efficacy of two preparations containing imidacloprid and permethrin or moxidectin wasassessed in dogs.Material and methods - Two spot-on preparations were tested for their acute efficacyand the duration of protective effect (in a 35-day period) in dogs with spontaneous tickinfestation: Combination of imidacloprid and permethrin (1:5, Advantix®-Bayer) Combination of imidacloprid and moxidectin (4:1, Advocate®-Bayer).In addition, their possible local unwanted effects and safety were assessed.The research was performed on 16 working dogs (Illyrian sheepdogs and Germanshepherds) on two localities in Serbia (Kuršumlija and Prokuplje), in the spring of 2011.Each group consisting of 8 dogs was both the control (number of live ticks before thetreatment) and the tested one (number of live and dead ticks after the treatment). All ofthe dogs were marked and kept isolated, one in a cage. Prior to the treatment, on fourconsecutive days the dogs were exposed to natural tick habitats in Kuršumlija (group I)and Prokuplje (group II) in order to acquire spontaneous infestation. Tick determinationwas based on conventional key. On day 5 after the initial exposure to ticks the dogswere treated with the preparations following the instructions of the producer: group Iwith imidacloprid+permethrin and group II with imidacloprid+moxidectin.The assessment of acute (immediate) acaricidal efficacy was based on the number ofticks on animals detected by inspection and palpation before the treatment, and 24 h and183

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYS48 h after the drug application. Having been counted, the ticks were removed from theanimals. The residual acaricidal afficacy (long-term persistent efficacy) was tested 7,14, 21, 28 and 35 days after treatment. The dogs were exposed to spontaneous tickinfestation on daily basis throughout 35 days. At the end of each week thoroughinspection, combing and palpation of every dog were performed. For the evaluation ofthe acaricidal efficacy all the ticks were assessed and registered if they were alive ordead, free of fixed on the dog, and engorged or not. The degree of immediate acaricidalefficacy was calculated using Abbott‘s formula (EMEA, 2007). The efficacy isconsidered satisfactory if higher than 90 %.The duration of acaricidal efficacy was estimated according to the reduction in thenumber of live fixed and dead ticks 1, 2, 3, 4 and 5 weeks after the treatment. Thepossible local unwanted effects were monitored immediately after the rugadministration (24 h and 48 h following the treatment).Results and discussion - The dogs acquired a low-degree spontaneous tick infestationwith tick species Ixodes ricinus and Rhipicephalus sanguineus.Immediate acaricidal efficacy of the combination of imidacloprid with permethrin(Advantix ® spot-on) against ticks on day 1 after treatment was 68.18 %, which wasinsufficient. On day 2 it was somewhat higher (70.45 %) but still unsatisfactory. Theseresults roughly correspond to those of Fourie et al. (2011) who detected that 1 and 2days post treatment the same combination showed the efficacy against Dermacentorreticulatus which did not exceed 80 %. Similar results of immediate acaricidal efficacy(84%) were obtained on day 3 (Young et al., 2003).However, there are also data on satisfactory acute acaricidal efficacy (>90 %) of thesame combination on day 2 against Ixodes ricinus (91.1%) and Rhipicephalus spp.(98.3%), (Hellmann et al., 2003).The degree of long-term acaricidal efficacy of the combination of imidacloprid withpermethrin (Advantix ® spot-on) was 95.45% on day 7. In the second week following theadministration the drug achieved maximum efficacy against ticks, 100%, which slightlydecreased on day 21 and remained unchanged up to day 35 (97.73%).Our results correspond with the findings of Hellmann et al. (2003), who detected aresidual acaricidal efficacy of 95.2% against I. ricinus and 98.5% against Rhipicephalusspp. four weeks after the administration of imidacloprid and permethrine combination.Moreover, it was proved that 65 % permethrin drops (Defend Export-Schering PloughAnimal Health) applied on the dog‘s skin two days after treatment have the efficacy of99.1 % against Ixodes ricinus; the long-term efficacy after one week was 99 %, aftertwo weeks 95.9 %, after three 88.5 %, 87.1 % after four and finally, decreased to 48 %six weeks post treatment (Endris et al., 2000).However, the data provided by Dryden et al. (2008) obtained in a research on theresidual acaricidal efficacy of imidacloprid+permethrin against Dermacentor variabilissignificantly depend on the time which passed from the treatment: significant acaricidalefficacy was achieved on day 9 (90.2%), but decreased to minimum on day 35 (17.5%),the number of ticks being slightly different in treated and untreated animals. Moreover,the residual efficacy of imidacloprid in combination with permethrin was less than 90%in dogs three weeks post treatment against Dermacentor reticulatus (Tielemans et al.,2010).184

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕGiven that in our research the degree of residual efficacy of this ectocide combinationwas beyond 90 %, its high intensity of acaricidal efficacy as well as the duration (35days) of residual efficacy were confirmed. The duration of residual efficacy ofAdvantix ® spot-on against Ixodes ricinus and Rhipicephalus sanguineus exceeded 4weeks, which was the time claimed by the producer (Bayer) in the instructions for use.However, the immediate acaricidal efficacy of the combination against the ticks Ixodesricinus and Rhicephalus sanguineus in dogs was proved to be unsatisfactory both 24 h(68.18 %) and 48 h (70.45 %) following the administration on the dog‘s skin.The immediate acaricidal efficacy of the combination of imidacloprid, an insecticidewith moxidectin, an endectocide (Advocate ® spot-on) against Ixodes ricinus andRhicephalus sanguineus in dogs on the first day post treatment was 30.30 %, andsomewhat lower, 25 %, on day 2, being unsatisfactory on both occasions. This wasexpected due to the fact that both substances have narrow anti-ectoparasitic spectrum, indogs acting mainly against fleas and lice.The long-term acaricidal efficacy of Advocate spot-on on day 7 was 30.76 %, but aslow as 6.25 % on day 14. Slightly higher efficacy was recorded on day 21 – 16.66 %, aswell as on day 28 – 21.42 %. Five weeks following the administration the drug waswithout residual efficacy (0 %).Our results pointed to the very low immediate and long-term acaricidal efficacy ofimidacloprid+moxidectin combination against ticks in the dog, which is in accordancewith the contents of the instructions for use of Advocate spot-on. However, moxidectin,a milbemycin, applied on the skin has good to excellent effect on Boophilus microplusin cattle (Remington et al., 1997; Tipecamu and Vivas, 2003) whilst on the ticks indogs, its effect is very poor or completely absent(http://www.lowchensaustralia.com/pests/paralysis-tick/prevent-tick-infestation.htm#PreventionPets, Jezdimirović, 2010), which is in sharp contrast with ivermectin,one of the avermectins, closely related to milbemycins.Our results obtained in the five-week-long assessment of local tolerability of thecombinations of imidacloprid+permethrin (Advantix spot-on) and Imidacloprid +moxidectin (Advocate spot–on) after single application to the dogs‘ skin proved thatboth preparations were well tolerated and did not produce irritation or sensitisation ofthe skin (rash, itch, alopecia). These results of dermal tolerability of Advocate spot-onare in accordance with those published by Paul et al. (2004), who claimed thatimidacloprid+moxidectin concentrations even five times higher than recommended didnot lead to local toxic effects.However, there are some data on the possibility that these substances on localadministration may sometimes produce transient irritation and sensitisation of the skinin dogs (Flannigan et al., 1985; Jezdimirović, 2010; Noah, 2010). Permethrin may causeirritation, itch or paresthesia (sensation of burning or numbness) in humans after localexposure. These symptoms are usually transient and disappear within 24 h. Permethrincauses painful conjunctival irritation with hyperaemia and burning sensation.Conclusions - The following conclusions may be derived from the results of the currentinvestigation: The dogs exposed to natural tick habitats in Kuršumlija and Prokupljeacquired low degree tick infestation with species Ixodes ricinus and Rhipicephalussanguineus.The combination of acaricides imidacloprid and permethrin (Advantix spot-185

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYSon) has unsatisfactory immediate acaricidal efficacy (70 %) after 24 h and 48 h. Bycontrast, the long-term persistent efficacy is maximal and is maintained throughout fiveweeks after the administration.The combination of imidacloprid and moxidectin (Advocate spot-on) has minimumimmediate acaricidal efficacy (25-30 %) and insignificant long-term efficacy(approximately 15 %) up to the 4 weeks post treatment, when it disappears. Theintensity and duration of acaricidal efficacy of this combination is not satisfactory and itis not to be used in the control of tick infestation in dogs, which corresponds to theinstructions for use provided by the producer.Both preparations are safe for administration in dogs since their use did not lead to anylocal irritation or sensitisation on the skin.AcknowledgementThe current research was financially supported by the Ministry of education, science and technologicaldevelopment of the Republic of Serbia, Projects No. III 46009 and No. III 46002.References1. Aleksić N. Parazitske bolesti, VIII izdanje, Beograd, 2012.2. Dryden MW, Payne PA. 2004, Biology and control of ticks infesting dogs and cats inNorth America, Vet Ther, 26: 2-16.3. Eckert J, Friedhoff TF, Zahner H, Deplazes P. Metazoa. Lehrbuch der Parasitologie furdieTiemedizin. 2nd Ed, Stuttgart, Enke Verlag, 2008, 375-391.4. Eiden, A., P. Kaufman, and F. Oi. 2012. Acaricide resistance in brown dog tickpopulations in Florida. 9th Arbovirus Surveillance and Mosquito Control Workshop. St.Augustine, FL. March 29, 2012.5. Endris RG, Matthewson MD, Cooke D, Amodie D. 2000, Repellency and efficacy of 65% permethrin and 9,7 % fipronil against Ixodes ricinus, Vet Ther, 1(3):159-68.6. Flannigan SA, Tucker SB, Key MM, Ross CE, Fairchild EJ, Grimes BA, Harrist RB.1985, Synthetic pyrethroid insecticides: a dermatological evaluation. Br J Ind Med, 42:363-72.7. Guglielmone AA, Robbins RG, Apanaskevich DA, Petney TN, Estrada-Pena A, HorakIG, Shao R, Barker SC. 2010, The Argasidae, Ixodiidae and Nuttalliellidae (Acari:Ixodida) of the world: list of valid species names. Zootaxa, 2528:1-28.8. Guideline for the testing and evaluation of the efficacy of antiparasitic substances forthe treatment and prevention of tick and flea infestation in dogs and cats,EMEA/CVMP/EWP/005/2000-Rev. 2, 2007.9. Hellmann K, Knopper T, Krieger K, Stanneck D. 2003, European multicenter field trialon the efficacy and safety of a topical formulation of imidacloprid and permethrin(Advantix) in dogs naturally infested with ticks and/or fleas. Parasitol Res, 90: S125-S6.10. Jezdimirović M. Farmakologija, IV izdanje, Beograd, 2010.11. Milutinović M, Masuzawa T, Tomanović S, Radulović Ţ, Fakui T, Okamoto Y. 2008,Borrelia burgdorferi sensu lato, Anaplasma phagocytophilum, Francisella tularensisand their co-infections in host-seeking Ixodes ricinus tick collected in Serbia. Exp ApplAcarol, 45: 171-83.12. National office of animal health (NOAH) Compendium, 201013. Pavlović I, Husinec S, Đokić V, Vukša M. 2008, Efikasnost razliĉitih formulacijalambda-cihalotrina u suzbijanju igzodidnih krpelja, Pestic Phytomed (Belgrade), 23,127-131.186

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕ14. Pavlović I, Kneţević D, Milutinović M, Pavlović N. Petković D. 2000, Our experienceof tick control by using deltamethrin. Arch Toxicol Kinet Xenobiot Metab, 8(3):221-222.15. Prevention of tick infestations of pets and humans, Accessed on March 23 2013athttp://www.lowchensaustralia.com/pests/paralysis-tick/prevent-tickinfestation.htm#PreventionPets16. Savić S, Vidić B, Grgić Ţ, Jurišić A, Ćurĉić V, Ruzić M, Lolić Z. 2012, Vektorskezoonoze pasa u Vojvodini, Arhiv veterinarske medicine, 5(1):77-87.17. Tipecamu AG and Vivas RI. 2003, Effect of moxidectin against natural infestation ofthe cattle tick Boophilus microplus (Acarina: Ixodidae) in the Mexican tropics. VetParasitol, 111(1-2), 216-6.18. Tomanović S, Milutinović M, Radulović Ţ, Ćakić S, Mihaljica D. 2011, Krpelji kaovektori zaraznih bolesti. Simpozijum entomologa Srbije, Donji Milanovac, 14-7.УПОРЕДНО ИСПИТИВАЊЕ ЕФИКАСНОСТИ КОМБИНАЦИЈЕИМИДАКЛОПРИДА СА ПЕРМЕТРИНОМ ИЛИ МОКСИДЕКТИНОМ УСУЗБИЈАЊУ КРПЕЉА КОД ПАСАМиланка Јездимировић, Невенка Алексић, Немања ЈездимировићКратак садржајКрпељи су облигатни хематофаги артроподи, резервоари и вектори проузроковачабројних зооноза, од којих су најважнији Rikettsia spp., Anaplasma phagocytophilum,Borrelia burgdorferi sensu lato, Francisella tularensis, вирус кримске-конгохеморагичне грознице и вирус крпељског енцефалитиса. Због тога је неопходнаконтрола и сузбијање крпеља у природним стаништима, затвореним просторима ина домаћинима.Данас се углавном користе синергистичке комбинације ендектоцидаразличитог механизма деловања у циљу добијања ефикаснијих ибезбеднијих препарата са ширим антипаразитским спектром дејства идуготрајнијом ефикасношћу, а који се једноставно примењују (спот он).У раду је испитивана непосредна акарицидна и резидуална (протективна)ефикасност комбинације имидаклоприда са перметрином или са моксидектином усузбијању крпеља код паса природно инфестираних врстама Rhipicephalussanguineus и Ixodes ricinus. Испитивање је обављено према процедури коју јепрописала ЕМЕА. Резултати испитивања непосредне акарицидне ефикасности (24х и 48 х после примене) комбинације имидаклоприда и перметрина показали су даона није задовољавајућа (око 70 %), док је резидуална ефикасност максимална иодржава се током пет недеља.Непосредна акарицидна ефикасност комбинацијеимидаклоприда и моксидектина је минимална (25-30 %), а резидуална ефикасностјош мања (око 15 %). Ова комбинација не може да се користи за контролу крпеља,што је упутством и предвиђено.Кључне речи: крпељи, пас, имидаклоприд, перметрин, моксидектин, ефикасностПроф др Миланка Јездимировић, проф др Невенка Алексић, Факултет ветеринарске медицине уБеограду; Др вет. Мед. Немања Јездимировић, Научни институт за ветеринарство Србије, Београд187

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYSPRESENCE OF DOG`S MICROFILARIE ON WIDER TERITORY OFBELGRADE *Marić J., Simić V., Medić S., Nadaškić M., Manić Marija, Prokić Nataša, Pavlović I.AbstractMicrofilariae is a parasitic evolving form of heart worms - Dirofilaria immitis andDirofilaria repens. It is transmitted through bites / stings hematofague insects, primarilymosquitoes. The disease occurs mainly in countries with warmer climates, but lately,due to adaptation of vectors and global climate change it is increasing occurrence of theparasite in moderate, even in colder regions.The aim of this study was detection of microfilariae ownership dogs in the wider areaof Belgrade for the month of October 2012. During the test 99 dogs were exemened.As a material for this study were used blood samples, and diagnosis was performedusing a modified Knot`s test.The results showed the presence of microfilariae in 6 dogs (6.1%), as evidence of asignificant presence of parasites in the exemined field. All tested dogs didn`t showcharacteristic somptomes for this disease. Epizootic reports show that disease is presentin our area for a longer period of time and so far the published data suggest that itoccurred in the city of Belgrade, Panĉevo and Vojvodina. Protection of dogs comesdown to application-specific repellents, pest premises where the dog lives andpreventive testing mikrofilariju all animals older than 6 months.* Article was financied by Ministry of Education, Science and Techological Development (ProjectTR 37015)Key words: microfilaria, Dirofilaria immitis, Dirofilaria repens, dogsDVM Jovan Marić, research assistant, DVM Marija Manić, research assistant, DVM Nataša Prokić, researchassistant, Faculty of Veterinary Medicine, Belgrade, Bulevar Oslobodjenja 18, jovan_vet@yahoo.com ; DVMVladan Simić, DVM Strahinja Medić, Veterinary laboratory ―VetLab‖, Ţivka Davidovića 30, Belgrade; DVMMarko Nadaskić, Veterinary ambulance "Mondo Animale", Panĉevo, Oslobodjenja 27; Dr Sci Ivan Pavlović,Scientific veterinary Institute Serbia, Vojvode Toze 4Introduction -Dirofilariosis is a parasitic disease that occurs in areas with warmerclimates. However, lately dirofilariosis established in moderate and even in colderregions. There is evidence that in the last few years dirofilariosis occurs in ourgeographic area. The causes of these parasitic disease are nematodes Dirofilaria immitisand Dirofilaria repens. It can often be diagnosed and dipetalonemosis causedDipetalonema reconditum. This disease can occur alone or as mixed infection. In humanmedicine are also recorded cases of infection with D. repens, which means thatdirofilariasis have zoonotic nature.Females of these parasites have born alive ability and L1 larvae stage is disseminatedthrough the bloodstream throughout the body. In the development of Dirofilaria asintermediate host participate mosquitoes of the genera Aedes, Anopheles, Culex and188

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕothers (17), which are involved in the development of L1 to L3 development stages.When mosquitoes suck blood of infected animals they enter microfilariae of L1developmental stage (150μm) from which occur L2 (230μm) and L3 larvae (800μm),after moulting. L3 stage infective larvae migrate to the mosquito mouth where it will betransferred to the new host. The whole development of microfilariae in the intermediatehost is 2-3 weeks depending on the outside temperature (1, 3, 5, 17).After inoculation infective larvae migrate actively into other parts of the subcutaneousand subserosis tissue, or muscle and adipose tissue. For 9-12 days after infection, thelarvae moult to the L4 stage (18 mm), followed by 70-80 days after infection in the L5stage (80mm). In the next 3-4 months the larvae migrate to the target places: heart of D.immitis and subcutaneous tissue, the space between the tendons and blood vessels,kidneys and lymph nodes in D. repens. In humans, it can be found in the eye andsubcutaneous tissue. Sexually maturation of parasites usually lasts about 6 months, andthe entire development cycle takes about 8-9 months. Microfilariae in the blood can stay1-3 years and adult parasites and over (1, 3, 5, 17).Number of microfilariae in the blood usually increases at higher temperatures, aftermeals and late at night. Because of the negative fototropic effect microfilariae can befound in mostly midnight (in the blood), and lowest concentration about 10 o'clock inthe morning.In our country, performed studies have not included the whole territory (2, 6, 8, 16).However, these data may be enough to alert veterinarians, and that it is necessary toconduct timely diagnosis and recommend appropriate treatment and prophylaxis indogs.The aim of this study was to detect the random presence of microfilariae in theownership dogs in the wider region of Belgrade during the month of October 2012.Methods - Blood samples collected from dogs that didn`t show symptoms characteristicfor microphilariosis (apathy, dyspnea, increased fatigue in normal physical activity andweight loss) were used like a material for this study. Tested dogs didn`t have protectionagainst mosquitoes. The collected blood samples were examined using a modifiedKnot`s test. Part of the survey was done in veterinary laboratory "VetLab" which gavesamples for review, and the rest was viewed in the laboratory of Department ofinfectious animal diseases and diseases of bees, Faculty of Veterinary Medicine.Results - In total was examined 99 dogs, from which 6 (6.1%) were positive for thepresence of microfilariae, which indicates a significant presence of parasites on a testedfield, because it is a random inspection or a random finding. The results are shown inthe following table.Race Sex AgeGolden retriever f 10German shepherd m 9Crossbreed m 8Crossbreed m 2Siberian Husky m 2,5Crossbreed f 3189

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYSDiscussion - Research of microphilariosis domestic and wild canids in the world, aswell as the results obtained in this research indicate the impact of these parasites on thehealth and usefulness of dogs. This parasites have significant impact on the humanpopulation because of their zoonotic character.During this experiment a total of 99 samples were examined (whole blood of dogs).None of the examined dogs didn‘t show symptoms characteristic for this disease.Totally is confirmed 6 positive animals. As for the sex distribution, the majority ofpositive cases were males; 4 males and 2 females. Age of affected dogs ranged from 2to 10 years. Positive animals were from a municipality Borĉa, Krnjaĉa and Stari grad(Dorćol), which confirms the constatation that the agent transferred hematophagousinsects (17), most of which has been active in the coastal area of the river (Danube) andswamps (Figure 1.).190Figure 1. Location of positive dogs, BelgradeDirofilariosis of dogs is an endemic disease, spread mainly in parts of the world with atropical climate, however due to global warming parasite occurs more frequently inregions with moderate and even colder climate. This phenomenon can be explained bythe adaptation of vectors to lower temperatures and finding ways to survive underchanged environmental conditions. In some endemic regions, the prevalence ofdirofilariasis in an adult dog may be 1-45% or more. According to some data, in certaindog breeding, can be infected up to 80% of the animals (5).There is evidence that the dirofilariosis is established in most neighboring countries, butalso in our country (9, 10, 11, 17, 7). One group of authors (16) are investigatedincidence of dog‘s dirofilariasis in the region of Novi Sad caused by D. immitis, whileothers (18) found the appearance of infection in dogs in the Vojvodina caused by D.repens, D. immitis and Dip. reconditum, with prevalence of 47.90%. There are results ofstudy reported in 2011. led by Dr. Luigi Venco, where an average prevalence in dogswas 16.1% (the lowest in the southern regions, 0% to 50% in Smederevo and the leftcoast of the Danube near Belgrade). This study have confirmed cases in the entireterritory of Vojvodina (Sombor, Subotica, Kikinda, Novi Sad, Zrenjanin, etc..).The study conducted 2009. included a total of 122 dogs from the territory of Panĉevoand the Veliko Gradište, as well as 298 people from different regions of Serbia(Panĉevo, Novi Sad, Zajeĉar, Leskovac, Vranje, Niš, Pirot). The results were show thatseroprevalence for dogs ranged from 22.9% for D. immitis up to 42.6% for D. repens,

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕwhile for men was 15.4% (19). The Army of the Republic of Serbia has done testing oftheir dogs. Testing was performed in Vojvodina 2004. with 16% positive, 2006. with19% positive and 2010 where the positive cases were not confirmed.Also seroprevalence testing was done 2011. on the territory of 10 cities (Belgrade, NoviSad, Subotica, NiĊ, Kragujevac, Kraljevo, Šabac, Sremska and Cacak), where areexamined blood samples of 387 dogs and it was found presence of D.immitis of 14.98%in total population (20).There are also known results from 2011. and 2012. from the territory of city Panĉevo,where is detected presence of this parasite in 30 of 55 cases (14), and 44 of 80 (15). Allthese results indicate a significant presence of microfilariae in our country.Conclusions - In order to protect the dogs it is necessary to apply specific repellents,pest premises where the dogs lives, and to do preventive testing of all animals olderthan 6 months.To obtain a more complete epizootic picture it is necessary to research further.Literature1. Brumpt E. (1949): Precis de parasitologie. Sixieme edition, Paris;2. Dimitrijević S., Tasić A., Tasić S., Adamović V., Ilić T., Miladinović – Tasić N. (2007):Filariosis in dogs in Serbia. In: Genchi C, Rinaldi L, Cringoli G, editors. Proceedings ofthe first European Dirofilaria days, Zagreb, Croatia, 201;3. Flynn JR. (1973) Parasites of laboratory animals. The Iowa State University Press /AMES;4. Kelly J. D. (1977): Canine Parasitology. Veterinary Review, 25-33;5. Milosavljević P., Kulišić Z. (1989): Prvi sluĉajevi dirofilariaze kod pasa u Jugoslaviji.Vet Glasnik; 43: 71-6;6. Tasić A., Rossi L., Tasić S., Miladinović – Tasić N., Ilić T., Dimitrijević S. (2008):Survey of canine dirofilariasis in Vojvodina, Serbia. Parasitol Res; 103: 1297 – 302.7. Blitva-Mihajlović G, Ralić M, Miletić B. Bolest srĉane gliste. Simpozijum Maleţivotinje – ţivot i zdravlje. Beograd; 1995.8. Kulišić Z, Mišić Z, Milosavljević P, Popović N. Dirofilarioza pasa u Jugoslaviji. 8.Savetovanje veterinara Srbije. Zlatibor; 1995.9. Lalošević D. (2004): Parazit sliĉan Dirofilaria spp. na mezenterijumu uklonjenoperacijom. Med. Pregl., (5-6):307-8;10. Milosavljević P, Kulišić Z. Prvi sluĉajevi dirofilarioze pasa u Jugoslaviji. Veterinarskiglasnik 1989;43(1):71-6.11. Nadaškić M., Aleksić-Agelidis A., Vasić M., Majstorović K., Blitva Robertson G.,Marić J., (2012): Presence of microfilariae of dogs in the city of Pancevo in 2011(Rasprostanjenost mikrofilarije kod pasa na teritoriji grada Panĉeva u 2011. godini): IIInternational epizootiology days (XIV Epizootiološki dani Srbije), Book ofabstracts/Proceedings (Knjiga radova i kratkih sadrţaja), , 203-204.12. Nadaškić M., Majstorović Katarina, Blitva-Robertson Gordana, Marić J., Manić Marija,Blagojević M., (2012): Prisutnost mikrofilarije kod pasa na teritoriji grada Panĉeva u2011/2012.godini; Zbornik kratkih sadrţaja, 17.Godišnje Savjetovanje doktora13. Savić-JevĊenić S., Vidić B., Grgić Ţ., Milovanović A., (2004): Brza dijagnostikadirofilarioze pasa u regionu Novog Sada, Veterinarski glasnik, 58 (5-6), 693-698;14. Tasić A, Katić-Radivojević S, Klun I, Mišić Z, Ilić T, Dimitrijević S. Prevalencijafilarioza pasa u nekim podruĉjima Vojvodine. 15. Savetovanje veterinara Srbije.Zlatibor, 2003;191

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYSПРИСУТНОСТ МИКРОФИЛАРИЈЕ КОД ПАСА НА ШИРОЈТЕРИТОРИЈИ ГРАДА БЕОГРАДА *Марић Ј., Симић В., Медић С., Надашкић М., Манић Марија, Прокић Наташа,Павловић И.Кратак садржајМикрофиларија је паразитска развојна форма срчаног црва – Dirofilaria immitis иDirofilaria repens. Преноси се путем уједа/убода хематофагних исеката, на првомместу комараца. Обољење се углавном јавља у земљама са топлијом климом, алиу последње време, услед адаптације вектора и глобалних климатских промена свеје чешћи налаз овог паразита у умереним, па и у хладнијим пределима.Циљ рада је био откривање присуства микрофиларије код власничких паса наширем подручју града Беграда за месец октобар 2012. године. У току испитивањабило је обухваћено 99 паса.Као материјал за израду овог рада послужили су узорци пуне крви, а дијагностикаје вршена применом модификованог Кнотовог теста.Добијени резултати су показали присуство микрофиларије код 6 паса (6,1%), штодоказује значајну присутност овог паразита на испитиваном терену, с обзиром даје реч о псима који нису показивали симптоме карактеристичне замикрофилариозу. Епизоотиолошки гледано болест је присутна на нашем теренудужи временски период и за сада литературни подаци говоре да се она јављала наподручју града Београда, Панчева и Војводине.Заштита паса се своди на примену специфичних репелената, дезинсекцијупростора где пас живи и превентивно тестирање на микрофиларију свих јединкистаријих од 6 месеци.* Рад је финансиран од стране Министарства просвете, науке и технолошког развоја(Пројекат ТР 37015)Кључне речи: микрофиларија, Dirofilaria immitis, Dirofilaria repens, пасаДр вет. мед Јован Марић, истраживач приправник, Др вет.мед Марија Манић, истраживач приправник,Др вет.мед Наташа Прокић, истраживач приправник, Факулет ветеринарске медицине, БулеварОслобођења 18, Београд, jovan_vet@yahoo.com ;Др вет. мед Владан Симић, Др вет. мед СтрахињаМедић, Ветеринарска лабораторија „ВетЛаб―, Живка Давидовића 30, Београд; Др вет. мед МаркоНадашкић, Ветеринарска амбуланта „Мондо анимале―, Ослобођења 27, Панчево; Др сци. ИванПавловић, Научни институт за ветеринарство Србије, Војводе Тозе 4, Београд.192

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕPRESENCE OF EHRLICHIOSIS IN SHELTER FOR NON-OWNER DOGS INLOZNICAElezović Radovanović Milica, Đurić Ljubica, Prokić Nataša, ĐuriĉićBosiljka,Pavlović I.AbstractCanine monocytic ehrlichiosis is an infectious disease caused by therickettsia Ehrlichia canis which reservoirs and carriers are brown dogticks, Rhipicephalus sanguineus. It belongs to a group of vector-borneinfections diseases which identification had an impact on raising awareness of thezoonotic problem of rickettsial diseases . The disease was found discovered for the firsttime in Algeria, 1935 th in dogs with high infestation of ticks. Epidemiology andepizootiology of this disease shows that it is worldwide spread disease, with biggestprevalence in tropical regions. In our country first case of canine monocytic ehrlichiosiswas registered in Belgrade territory, by microscopic examination of peripheral bloodsmear Giemsa method colored (proof of morulae in monocitic cells).The goal of research is representation of the extent of ehrlichiosis in the population ofnon-owner dogs in shelter, from different places in the municipality of Loznica.As material we used blood sera of dogs and commercial E.canis IFA canine IgGAntibody Kit (VMRD ® ,Inc).Methodology used in this research was IFA- indirectimmunofluorescence assay.Results- In our research (during 2012.) of the total number of dogs (58) from thisshelter (IFA method), 8 samples were positive (13.79%) which shows a very highprevalence of this diseases in municipality of Loznica. Considering that the shelters arepart of current strategies for stray dog population control, this results are an importantindicator of the presence of certain infectious zoonotic diseases that usually does notpay adequate attention.Key words : Ehrlichiosis, dogs, shelter for non-owner dogs, LoznicaElezović Radovanović Milica, DVM, research assistant, Prokić Nataša, DVM, research assistant, ĐuriĉićBosiljka, PhD, full professor, Department of infectious diseases of animals and bee diseases, Faculty ofVeterinary Medicine, University of Belgrade, Bul. Oslobodjenja 18, Belgrade ; ДВМ Ljubica Đurić, Msc,Veterinary station ―Loznica ― ,Loznica; drIvan Pavlović ,scientific advisor, Scientific Veterinary Institute ofSerbia,IntroductionThe canine vector-borne infections diseases are an emerging problem in veterinarymedicine and the zoonotic potential of many of these agents is a significantconsideration for human health. Ehrlichiosis belongs to this group (1). The disease wasfound discovered for the first time in dogs in Algeria, 1935 th. (2) In 1960s scientificresearch began after sudden death of more than 200 military dogs during Vietnam War.The disease was named „Tropical pancitopaenia―(3). Nowdays, by the term monocitic193

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYSehrlichiosis of dogs disease caused by Ehrlichia canis is considered. Beside E.canis thedisease in dogs can be caused also by E.ewingii and E.chaffeensis in form ofgranulocitic ehrlichiosis, and rarely cyclic thrombocitopaenia (4). The ehrlichia isrickettsia, small, pleomorfic, gramm negative, obligatory intracellular microorganismbelonging to genus Ehrlichia, family Anaplasmatacae (5). Vectors are ticks ofRhipicephalus sanguineus. In them the agent is multiplying, and it is transmitted to thehost via bite of tick. Ticks can be infected via host blood only in acute phase of disease(6). Ehrlichiosis is sesonal disease, most frequent in warm season and in time of activityof vectors. Epidemiology and epizootiology of this disease shows that it is worldwidespread disease with biggest prevalence in tropical regions. The causative agents showstropism for cells of hematopoietic system where they can form intracellurar inclusionsnamed morulae (7). In the Republic of Serbia first case of E.canis canine ehrlichiosiswas registered in Belgrade territory, by microscopic examination of peripheral bloodsmear Giemsa method colored and proof of morulae in monocitic cells (8). Since thanthe disease has been detected in veterinary practices throughout Serbia by commercialrapid diagnostic kits.Clinical symptoms - Ehrlichia canis infection in dogs is divided into 3clinicopathogenic stages : acute, subacute and chronical. Acute begins 1-3 weeks afterexposure. The Ehrlichia organism is replicating in this time period and attaching towhite blood cell membranes. The organism multiplies within circulating mononuclearcells and the mononuclear phagocytes within the liver, spleen,and lymph nodes. Theinfected cells are then transported in circulation to the rest of the body, with apredilection for the lungs, kidneys and meninges. Cells infected with ehrlichia adhere tothe vascular endothelium and induce vasculitis and subendothelial tissue infection. Thissubsequently leads to platelet consumption, sequestration, and destruction that results inthe thrombocytopenia seen during this acute phase. During this time the platelet countwill drop and an immune-mediated platelet destruction will occur. It is characterized byfebrile state, anorexia, lethargy petechia, limphadenopathy, splenomegaly, ocular andnasal exsudation, thrombocytopenia, changes in eye and tendency of bleeding (9). Atthis point most dogs recover, if they are treated, but some progress to the subacute andchronic phases.Subacute phase of disease characterized hypergammaglobulinemia, polyclonal orsometimes monoclonal gammopathy, thrombocytopenia and anemia (10). Dogs can stayin this phase for months or even years.In chronic phase the dog gets sick again. Most of dogs infected with Ehrlichia caniswill have abnormal bleeding due to reduced platelets numbers. Deep inflammation inthe eyes, uveitis, may occur as a result of the long term immune stimulation. Neurologiceffects may also be seen. Increased globulin levels are almost always seen in this stagewhile albumin is often low. Pancitopenia is the most important hematologicalabnormality in chronical course of the disease (11). Ehrlichiae have a complex life cycleinvolving a tick vector a mammalian host and have developed strategies to establishpersistent infections in natural hosts to insure their survival and transmission in nature.Nymphal or larval ticks typically are infected with E.canis by feeding on a persistentlyinfected dog, and maintain the infection transstadially as the tick molts from stage tostage. The mechanism of persistent ehrlichial infection has not yet been determined but194

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕrecent studies have identified important immunoreactive proteins and potentialpathogenic mechanism of ehrlichiae.Diagnosis - Diagnosis of an ehrlichial infection can be performed using visual,serologic or molecular methods. Erhlichia spp. replicate inside a membrane boundvacuole (i.e., morula) that can sometimes be observed by light microscopic examinationof stained blood smears inside either monocytes (E. canis)(12) Detection of antibodiescan be performed by immunofluorescent assay (IFA) or enzyme linked immunosorbantassays (ELISA) but cross-reactivity between antibodies to Ehrlichia species is possible(13). Polymerase chain reaction (PCR) is the most common molecular method used todiagnose an Ehrlichia spp. infection, particularly in dogs with acute illness where theonset of clinical signs may precede a measurable antibody response (14).Goal - The goal of our research was to investigate the current epizootic situation inregion of Loznica city. The population of these dogs is considered to be an idealindicator of the presence of certain infectious diseases, many of which are zoonotic. Inthis paper we present the results of serological examination on the presence ofantibodies against Ehrlichia canis of the population of stray dogs from Loznica , whichwere conducted during 2012.Materials and methods - The blood sera of 58 stray dogs, substrate slides, conjugate,positive control, negative control and all the necessary ingredience for laboratorydiagnostics have been used in our research. Methodology used in this research is IFAindirectimmunofluorescence assay.For detection and semi-quantitation of IgG class canine antibodies to Ehrlichia cani,swe used the E.canis IFA canine IgG Antibody Kit. The technique was perfomedaccording to the manufacturer‘s recommendations (VMRD ® ,Inc.) Ten microliters ofcanine sera, dilueted in buffered saline (PBS), were applied into wells of slides,prepared with fixed canine macrophage cells ( DH82 cell line). The slides wereincubated in a humidifield chamber at 37 º C for 30 minute, to allow reaction ofantibody with the Ehrlichia antigens. Slides are then washed tri times with PBS, toremove unreacted serum proteins, and air dried. 5µl of anti-canine IgG fluoresceinisothiocyanate conjugate was added to each well.. After a similar incubation for 30minutes, the slides were washed, dried and examined under fluorescent microscope. Apositive reaction is seen as sharply defined green fluorescent morulae within thecytoplasm of the cells. An antibody titer of 1:50 or greate was considered positive.(15)Positive reaction may then be retested at higher dilutions to determine the hifhestreactive dilution. A negative reaction is seen either as red-counterstained cells orfluorescence different that seen in the positive control well.Results and discussion - Of the total number of sera (58) examined by indirectimmunofluorescence assay, in 8 samples were found specific intracellurar inclusions–morulae, which corresponds to the prevalence of 13.79%. Investigated dogs weredivided into 3 groups on the basis of age: dogs puppies-up to 12 months of age, youngdogs 1-3 years old and adult dogs 3-5 years old. All sera who gave a positive reactionwere taken from the 3rd group. Age of dogs was assessed simultaneously during blood195

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYSsampling, on the basis of a teeth appearance and insight into the general body condition.This high percentage of prevalence gives a reliable picture of disease distribution innature. This is why stray dogs may serve very well as a sort of bioindicator in nature. Infact, examined dogs originate from the wider territory of the Municipality of Loznica.All of them, greater part or entire life spent in nature and the most common shelter fromweather conditions. Variety of risks had founded exactly in grassy and shrubby areas,where their exposure to ticks is greater than for pets. Although assessment of dogs' agewas subjective and therefore not precise enough, however, we can conclude that thelength of life in these conditions certainly contribute to increase the chances that a dog"pick up" infected tick. This means that age, when are considered stray dogs, is directlycorrelated with the outbreak of disease, where the key role is a lifestyle. Regardless ofthe fact that this disease is only recently registered in our country, it is important to raiseveterinarians awareness to think about ehrlichiosis in the differential diagnosis, in theirclinical practice. Earlier, infestations were tied up exclusively to the tropical regions,but in recent decades, as a result of the great flexibility of vectors and global climatechanges, tick-borne diseases are becoming more common not only in moderate parts ofthe world, but even in the north (for example, more frequent occurrence of anaplasmosisand Q-fever in the territory of Siberia). In accordance with the existing literature, aboutspread of tick population (the vector ticks Rhipicephalus sanguineus are second mostspread tick species in Serbia) showss that we can expect expansion of disease similar toproblems caused by Babesia canis.The results in this study shows a large percentage of positive samples ehrlichiosispresent in the population of stray dogs in this shelter, which indicate the validity of theperformed research.Conclusion - Canine ehrlichiosis is a seasonal disease, mostly in the warm period of theyear, when the number of vectors in the nature is greatest. Age, breed and gender haveno impact on the infection rate although, in German Shepherd dogs ehrlichiosis is oftendescribed (16) . Today, identification of emerging infectious disease has greatsignificance. The incidence and prevalence of this disease transmitted by ticks as avector has been increasing, due to climate changes. The presence and extent of ticks andeven cause infections in them, depending on a number of environmental factors andbiodiversity of a specific geographic area (17). Further investigations of canineehrlichiosis are necessary.AcknowledgmentsThis study was supported by the Ministry of Education, Science and Technological Developmentof Serbia , grant 37015References1. Potkonjak Aleksandar (2010) Razvoj optimalnog protokola za dijagnostiku infekcijepasa sa Erlihijama. Doktorska disertacija Poljoprivredni fakultet, Univerzitet u NovomSadu, Novi Sad2. Nims, R.M., J.A. Ferguson, J.L. Walker, P.K. Hildebrandt, D.L. Huxsoll, M.J.3. Samardzic S Marinkovic D Marinkovic T ,.Simovic T., Bozovic B., Milic A., VukovB., Gligic A.(2007), Ehlichia chaffeensis infection in different regions of Serbia,Mtaeria Medica Vol 23. No2;10-14196

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕ4. Breitschwerdt EB. The rickettsioses. In: Ettinger SJ, Feldman EC. Eds Textbook ofVeterinary Internal Medicine. 5 th ed. Philadelphia, PA; WB Saunders; 2000: 400-75. Jennifer H. McQuiston, DVM, MS; Candace L. McCall, DVM, MPH; William L.Nicholson, PhD(2003) Ehrlichiosis and related infections, AVMA Collections,Zoonosis updates6. Rikihisa, Y.( 2010). Anaplasma phagocytophilum and Ehrlichia chaffeensis:7. subversive manipulators of host cells. Nat Rev Microbiol 8:328-339.8. Pavlović I., Terzin V., Petkovic Dragana, Ćurĉin Lj, Stanković B., Terzin Dragana,Ćurĉin Klara. (2006 ) Erlihioza pasa na podruĉju Beograd. Epizootiološki dani, Vrdnik9. Pavlovic Ivan, Petkovic Dragana, Kukovska Valentina, Stamenkovic Vojislav,Jovcevski Srdjan, Pavlovic Milos, Jovcevski Stefan, Elezovic Milica (2012) 3rdInternational Scientific Meeting, Days of Veterinary Medicine 2012. 2-. 4 September2012., Ohrid, Republic of Macedonia, UDC: 636.7.09:616.995.41, 34-3710. Hegarty BC, de Paiva Diniz PP, Bradley JM, Lorentzen L, Breitschwerdt E. Clinicalrelevance of annual screening using a commercial enzyme-linked immunosorbent assay(SNAP 3Dx) for canine ehrlichiosis. J Am Anim Hosp Assoc. 2009;45:118–124.11. Domenico Otranto, Gabriella Testini, Filipe Dantas-Torres, Maria S. Latrofa, PedroPaulo Vissotto de Piava Diniz, Donato de Caprariis.Riccardo p.Lia, Gioia Capelli,Edward B.Breitscchwerdt (2010). Diagnosis of Canine Vector-Borne Diseases InYoung Dogs: a Longitudinal Study. Journal of Clinical Microbiology; 48(9): 3316-332412. Peleg O, Baneth G, Eyal O, Inbar J, Harrus S. (2010) Multiplex real-time PCR fordetection of Ehrlichia canis and Babesia canis vogeli. Vet Parasitology,;29:292-913. Harrus S., Kass PHK, Lement E et al.(1997), Canine monocytic ehrlichiosis :aretrospective study of 100 cases and an eoidemiological investigation of prognosticindicators for the disease.Veterinary Record 141:360-363ЗАСТУПЉЕНОСТ ЕРЛИХИОЗЕ ПАСА У ПРИХВАТИЛИШТУ ЗА ПСЕЛУТАЛИЦЕ У ЛОЗНИЦИЕлезовић Радовановић Милица, Ђурић Љубица, Прокић Наташа, ЂуричићБосиљка, Павловић И.Kратак садржајМоноцитна ерлихиоза паса је инфективно обољење кojе изазива рикецијаEhrlichiа canis за коју су крпељи врсте Rhipicephalus sanguineus и резервоари ипреносиоци. Обољење спада у групу новијих векторских болести чије откривањеје знатно утицало на подизање свести о зоонотској проблематици везаној зарикеције. Ерлихиоза је први пут описана 1935. године код паса у Алжиру кодкојих је доказана висока инфестација са крпељима. Епизоотиолошкоепидемиолошкиобољење се данас региструје широм света, са највећомпреваленцом у тропским регионима. У нашој земљи први случај инфекције пасаса E.canis утвђен је 2002. године на подручју Београда микроскопским прегледомразмаза периферне крви обојеног по Гимзи (присуство морула у моноцитима).197

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYSЦиљ рада је приказ раширености ерлихиозе невласничких паса у азилу којипотичу са територије општине Лозница.Као материјал за рад коришћени су крвни серуми паса и комерцијални IFA canineIgG Antibody Kit (.VMRD ® ,Inc.) а као метод рада коришћена је методаиндиректене IFA.Резултати-У оквиру наших истраживања (током 2012. ) од 58 паса из овог азила(методом ИФА) 8 серума је било позитивно (13.79%) што представља изузетновисоку преваленцу за територију општине Лозница. Ако се има у виду да суприхватилишта део усвојене стратегије у циљу решавања проблема све већегброја уличних паса, добијени резултати су значајан показатељ заступљеностипојединих инфективних болести зоонозног карактера на које се најчешће необраћа адекватна пажња.Кључне речи : Ерлихиоза, пси, прихватилиште за уличне псе, ЛозницаДр вет.мед Милица Елезовић Радовановић, истраживач приправник,. др вет.мед Наташа Прокић,истраживач приправник, др Босиљка Ђуричић, редовни професор, Катедра за заразне болестиживотиња и болести пчела, Факулетет ветеринарске медицине, Бул.ослобођења 18,mimaelezovic@gmail.com ; др вет. мед спец Љубица Ђурић, Ветеринарска станица ―Лозница‖,Лозница; др Иван Павловић, научни саветник, Научни институт за ветеринарство Србије Београд198

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕDESCRIPTION OF THE APPEARANCE OF PARASITIC INFECTION INFLOCK OF CANARIES (SERINUS CANARIA DOMESTICA) WITHSTERNOSTOMA TRACHEACOLUM (NASAL MITES), DIAGNOSIS ANDTHERAPY – A CASE REPORTŠekler M. 1 , Vidanović D. 1 , Polaĉek V., Vasković N., Kurćubić V. 2 , Obradović S. 3 ,Pavlović I. 4AbstractThe aim of this study was to display clinical case of appearance of parasitic infection incanaries with Sternostoma tracehacolum ( nasal mites) as well as to indicate to alldiseases that can differentially diagnostic to take into consideration ( influenza,Newcastle disease, chlamydiosis, mycoplasmosis), as well as to describe therapyprocedure which brought to complete recovery of all affected units. The material weused for laboratory diagnostic was taken from sacrificed units of affected flock, anddiagnostic procedure was conducted in compliance with described procedures in theexpert literature. Therapeutic approach we chose is described in detail, with note that itbrought to complete recovery of all affected units, without a single death of a bird.Key words: parasitic infection, flock of canaries, Sternostoma tracheacolum, nasalmitesDr Milanko Šekler PhD, dr Dejan Vidanović, dr Vladimir Polaĉek, Nikola Vasković, Specialist VeterinaryInstitute ―Kraljevo―, Kraljevo ; Dr Vladimir Kurćubić, Faculty of Agronomy, Ĉaĉak ; Saša Obradović Facultyof economy and engineering management, Novi Sad; Ivan Pavlović, Scientific institute for veterinary ofSerbia, BelgradeIntroductionThere are at least 3000 types of mites described so far (Arachinidae: Acari) , which livein close parasitic coherence with its hosts – birds, and all of them are classified intoapproximately 40 special families. Their influence on host ( birds) can be minimal, butoccasionally can lead to severe health issues, such as irritation, anemia, allergicreactions, and it can open gate to other secondary infections with other microorganisms( in most cases by bacteria), until death. The most benign mite types live in feathers andare fed with it, while more dangerous types for health of the birds are the one that arefed with their blood and tissue- they live and feed on within bodies of the birds ( inchoana, air ways, nasal cavities, trachea, lungs, air bags, nostrils, ears, eaves etc.)Nasal mites of the birds make 4 philogenetic separate families: Rhinonyssidae(Suborder: Mesostigmata), Speleognathidae (Suborder: Prostigmata), Turbinoptidaeand Cytoditidae (Suborder: Astigmata).In this study we described case where infection appeared and it was caused by typeSternostoma tracheacolum ( Order: Mesostigmata, Suborder: Monogynaspida,Family: Rhynonissidae, Genus: Sternostoma), which is frequent causal of infection in199

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYSbirds type from Order Passeriformes, Family Fringillidae, in most cases with canariesand finches, although there are occasional infection findings with many other types ofthe birds.Clinical signsThe owner of the flock of canaries (approximately 100 birds) reported appearance ofrespiratory disease signs, which started with a few newly acquired specimens of birds,but within couple of months the disease has affected more than a half units of the flock.Even after several months the bigger number of units in the flock showed weaker orstronger symptoms of the illness, despite unsolicited therapy of different antibioticstaken by the owner of the birds.The symptoms included were: watery eyes, weight loss, decreased food intake,intermittent diarrhea, depression of the birds, discharge from the eyes and nose,―snuffing and wheezing‖ of the birds, which was particularly expressed at night. Noneof the birds has died despite much expressed symptoms, but a few birds were at poorhealth status.After detailed history was taken, we suspected that the clinical picture we describedcould be result of infection with several most common causal agents of disease in birds,by which described respiratory syndrome would dominate, such as: chlamydiosis,influenza, Newcastle disease, mycoplasmosis, bacterial infections etc.Placed under suspicion we suggested that treatment with norfloxacin and tetracyclinepreparations should begin immediately in order not to waste time until we establishdefinitive diagnosis, as part of all diagnostic procedures we intended to conduct.Considering that it was valuable and young birds, in agreement with the owner, weplanned to take the following activities:1. To implement the enrofloxacin therapy over the whole flock of the canaries , throughdrinking water, in the highest doses, according to drug manufacturer‘s instructions,lasting from 5 to 7 days, with appropriate supportive therapy ( multivitaminspreparations with essential amino acids) and with strengthened and better nutrition. Weagreed that if comes to death of the birds or if some of the birds are at pre- lethalcondition, he would bring them to the laboratory for autopsy and further examination.2. After seven days there wasn‘t any noticeable improvement of health status of the birds,but there wasn‘t dying or seriously ill units either, in agreement with the owner, werecommended that changing and conducting new cycle of therapy with tetracyclinepreparations, with the same previously described measures. There weren‘t any visibleimprovement of the health status of the flock even after tetracycline therapy; there waseven further spreading of the disease among the units of the flock.3. We make an agreement with the owner to bring the worst affected birds, as well as theones at which the first symptoms of the disease were noticed, for their sacrifice forneeds of examination (pathoanatomic, and if necessary laboratory). The owner broughtthree live birds. All three were skinny, light, with noticeable respiratory diseasesymptoms that included already described signs of illness: excrement matted nostrils,rapid and dyspnoea with open beak, eyes discharge, matted cloaca etc. Auscultation ofthe birds (directly on the ear) we heard noise and sounds of cracking similar to ―crushedstyrophoam or cellophane bags‖.During detailed autopsy of sacrificed birds we200

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕespecially paid attention to possible pathomorphological changes on respiratory organs.We noticed that in the nasal choana there was a large amount of serous to purulentcontent and that it was provided on the entire length of the trachea to the bifurcation ofthe bronchus in the left and right side. The lungs were some darker in colour (from darkpink to pale red) at the intersection with serous content that was foamy. Air bags wereenlarged and with the blurred colour of serosa.4. During opening of trachea we noticed several small black dots (pinhead sized) that werevery hard to identify, and for which we thought they might be small drops of bloodemerged during sacrificing of the birds by slaughtering. Entire tracheas with branches oftracheal bronchus were sent to microscopic examination.5. We decide to take the blood from all three sacrificed birds. The blood were sent toexamination on presence of specific antibodies against Chlamydia psittaci, Newcastledisease virus and avian influenza virus type A. By autopsy examination of remainedorgans of sacrificed birds we haven‘t noticed any specific pathomorphological changes.Laboratory reportBy examination of three blood serum samples on presence of specific antibodies againstChlamydia psittaci by applying test AVIAN CHLAMYDOPHILIA PSITTACI AB.TEST KIT (Biogal‘s Immuno Comb, Israel), they were not established .by examination of three blood serum samples by haemagglutination inhibition test ( 4hu) we did not establish the presence of specific antibodies against newcastle diseasevirus.by examination of three blood serum samples by applying elisa test for detection ofspecific antibodies against avian influenza virus type a (NP) they were not established.Microscopic examinationBy microscopic examination of trachea, as well as its mucous content, we noticedseveral small brownish to black dots, in size from 0,2 to 0,3mm, and we found that itwas live parasites, with very characteristic appearance, and which we, after furtherexamination and after consulting literature, succeeded to identify as Sternostomatrecheacolum.EtiologyThese parasites are, for its size and category, extremely mobile, so that, in affected flockor in other words area, they are practically everywhere: water, food, equipment. Thisexplains its easy and fast transmission to all susceptible units in a flock, despite theirseparate keeping in the cages and special premises. Most often and the fastest way oftransmitting is during taking out and feeding of the young by regurgitation process.Female parasite lays eggs in air canals of the lungs. After parasites hatch, after justcouple of days, and after the first feeding (blood, tissue), females go to air bags, andmales stay in the lungs and trachea. After that, females move to upper air ways (choana,nasal sinuses, paranasal area, sirings), and in a few days they again lay eggs in thelungs, on their way back from the air bag. From the eggs, in a few days, a newgeneration of parasites hatches. Mating happens during their passage through tracheaand lungs. The whole cycles lasts for 6 to 8 days.201

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYSDiagnosisMicroscopic examination taken by parasites from death (often) or ill (rare) bird.Recommended method for all suspicious birds to this disease is so-called―transillumination‖ method. Examination is carried out with strong correspondingdirected light source, in completely dark room. The light is directed to be on one side ofthe bird‘s neck and it is observed on the opposite side. Considering that the skin andneck brawniness of these birds are very thin, parasites can be easily seen in trachea andair canals, and it can be easily noticed even their movement.TherapyMedicine of choice for this parasitic infection is oil solution Ivermecitin. There are threeways of application for this medicine in which these sick birds can be treated:Applying injection into the pectoral muscle. With application like this, besides itremains open question of toxicity and harmfulness of the puncture in such a small birds,the issue is the need for individual treatment of each individual bird, and that furthercomplicates the process of therapy.Through drinking water. The problem is that active medicine substance is very easilydegradable in water (that is the reason why this medicine is on sale as oil solution), sothere is a problem of dosage and speed at which active substance degrades, in otherwords speed at which birds drink treated water.Surface treatment through skin. The advantage is that oil solution easily and quickly canbe applied to any part of the bird‘s skin. Dosage is simple, one drop for birds under 50gr. and two drops for birds over 50 gr. Most often a drop of solution is applied to neckregion, near jugular vein. Treatment is necessary to repeat after three weeks.Besides that it is necessary to implement all zoohygienical measures in the flock as wellas in the object (cleaning, washing up, disinfection, treatment with some of insecticidesand larvicides).After implemented treatment in affected flock, and through drinking water, the ownerinformed us that all clinical signs of the illness disappeared, in just two days, and thatall birds were more cheerful, they eat more and act normally. The health status of theflock is the same till this day.Literature1. Wayne Knee and Heather Proctor. 2006. Keys to the families and Generes ofblood and tissue feeding mites associated with Alebrtan birds. CanadianJournal of Artropod identification No.2 (June 2006.). p: 1-18.2. Wayne Knee. 2000. Parasitic nasal mites (Rhinonyssidae. Ereyenetidae &Turbinoptidae) associated with birds of Alberta and manitoba. Department ofBiological Sciences, University of Albert, Canadl3. Cumming R.B. 1959. Respiratory acariasis of canaries and Goluld finches.Journal of the South African Veterinary and medical Association 30:31-32.4. Spicer G.S. 1987. Prevalence and host-parasite list of some nasal mites frombirds (Acarine: Rhinonyssidae, Speleognathidae).202

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕОПИС ПОЈАВЕ ПАРАЗИТСКЕ ИНФЕКЦИЈЕ ЈАТА КАНАРИНАЦА(SERINUS CANARIA DOMESTICA) СА STERNOSTOMA TRACHEACOLUM(НОСНИМ ГРИЊАМА), ДИЈАГНОЗА И ТЕРАПИЈА - ПРИКАЗ СЛУЧАЈА.Шеклер М. 1 , Видановић Д. 1 , Полачек В 1 , Васковић Н. 1 , Курћубић В. 2 , ОбрадовићС. 3 , Павловић Иван 4Кратак садржајЦиљ рада је био да се прикаже клинички случај појаве паразитске инфекцијеканаринаца са Sternostoma tracehacolum (носне гриње), да се укаже на све болестикоје могу диференцијално дијагностички да се узму у разматрање (инфлуенца,Њукастл болест, хламидиоза, микоплазмоза) као и да се опише терапијскипоступак који је довео до потпуног оздрављења свих оболелих јединки. Материјалкоји смо користили за лабораторијску дијагностику је био узет од жртвованихјединки оболелог јата, а дијагностички поступак је изведен у складу са описанимпроцедурама у стручној литератури. Терапијски приступ који смо изабрали једетаљно описан, уз напомену да је довео до потпуног оздрављења свих оболелихјединки, без иједне угинуле птице.Кључне речи: паразитска инфекција, јато канаринаца, Sternostoma tracheacolum,носне грињеДр Миланко Шеклер, др Дејан Видановић, др Владимир Полачек, Никола Васковић, Ветеринарскиспецијалистички институт "Краљево", Краљево; Др Владимир Курћубић, Агрономски Факултет Чачак,Чачак; Саша Обрадовић, Факултет за економију и инжењерски менаџмент, Нови Сад; Др ИванПавловић, НИВС ~Београд~, Београд203

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYSECTOPARASITOSES IN RUMINANTS IN BOSNIA-HERZEGOVINAZuko Almedina *ObjectivesIn the conditions of extensive keeping, ecto-parasitoses in ruminants in Bosnia andHerzegovina represent an important factor having adverse affect on growth anddevelopment of young animals, decreasing productivity and reducing resistance ofgrown-up animals to a number of infectious diseases and breeding conditions.Having in view the above facts concerning the importance of parasitoses in ruminants,especially those hazardous to human health and causing huge economic losses in livestockfarming, it has become obvious that more comprehensive research is necessary, imposingthe following research tasks: on the basis of findings from parasitologic investigation tomake an inventory of ecto-parasitoses in ruminants in Bosnia and Herzegovina; toestablish extensity and intensity and interrelations between the species of ecto-parasiteswhen detected in different age-groups and species of ruminants.Material and methods:During the 5 years investigations performed were complete 5.805 ruminants, out ofwhich 1.908 were sheep from 11 localities and 3.897 cattle from 19 localities. Theanimals belonged to different age groups. Examination by adspection of cattle andsheep was done for scab, ticks, lice, hypodermosis, and in case of positive finding orsuspected scab, ecto-parasites were collected for determination in laboratory.Results and conclusion:A total number of detected species of ecto-parasites was 16,which by their morphology were classified into 2 classes. Of Insecta class establishedwere 4 species Haematopinus eurysternus (41,9%), Oestrus ovis (3,0%), Hypodermabovis (32,8%) and Melophagus ovinus (37,0%). and of Arachnida class 12: Ixodesricinus (28,3-48,3%), Hyalomma excavatum (0,05-0,6%), H.detritum (0,3-12,9%), H.savignyi (2,6-16,1%), Rhipicephalus sanguineus (2,4-4,0%), Rh. bursa (9,1-29,4%),Haemaphysalis punctata (3,6-23,2%), H. inermis (0,4-1,4%), H. cholodkowskyi (0,7-6,2%), Dermacentor reticulatus (0,005-0,1%), D. silvarum (3,9-5,5%) and Psoroptesovis (12,8%).Taking into consideration the obtained results, it can be concluded that ectoparasitofaunaof Bosnia and Herzegovina is varied, represented by a large number of species causingvarious parasitoses, which is judged as very important from epizootiological point ofview, especially with regard to the parasite species common both to sheep and cattle.Key words: ectoparasitoses, ruminants, Bosnia and Herzegovina* Prof dr Almedina Zuko, Veterinary faculty Sarajevo, Zmaja od Bosne 90, Sarajevo, Bosnia and Herzegovina204

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕЕKТОПАРАЗИТОЗЕ КОД ПРЕЖИВАРА У БОСНИ И ХЕРЦЕГОВИНИКратак садржајЗуко АлмединаУ условима екстензивног држања, ектопаразитозе код преживара у Босни иХерцеговини представљају важан фактор који негативно утиче на раст и развојмладих животиња, смањује продуктивност и отпорност одраслих животиња уусловима узгоја на велики број заразних болести.Резултати - Укупан број откривених врста ектопаразита је био 16, они су посвојој морфологији подељени у 2 класе. Из класе Insecta заступљене су 4 врсте:Haematopinus eurysternus (41,9%), Oestrus ovis (3,0%), Hypoderma bovis (32,8%) иMelophagus ovinus (37,0%), а из Arachnida класе заступљено је 12 врста: Ixodesricinus (28,3-48,3%), Hyalomma excavatum (0,05-0,6%), H. detritum (0,3-12,9%), H.savignyi (2,6-16,1%), Rhipicephalus sanguineus (2,4-4,0%), Rh. bursa (9,1-29,4%),Haemaphysalis punctata (3,6-23,2%), H. inermis (0,4-1,4%), H. cholodkowskyi (0,7-6,2%), Dermacentor reticulatus (0,005-0,1%), D. silvarum (3,9-5,5%) и Psoroptes ovis(12,8%).Закључак: Узимајући у обзир добијенe резултатe, може се закључити да јеектопаразитофауна преживара у Босни и Херцеговини разноврсна, а заступа јевелики број врста које изазивају разне паразитозе што се оцењује као веома важноса епизоотиолошке тачке гледишта, посебно у погледу паразитских врстазаједничких и за овце и говеда.Кључне речи: ектопаразитозе, преживари, Босна и ХерцеговинаПроф др Алмедина Зуко, Ветеринарски факултет Сарајево, Змаја од Босне 90, Сарајево, Босна иХерцеговинаУводИстраживања паразитофауне преживара имају велики значај. Наиме, свакоподручје са различитим климатским условима, начином сточарења и исхраномстоке, представља специфићну средину за коју није могуће примјењиватиуниформне мјере сузбијања и превенирања економски значајних паразитоза упреживара. Без тачног познавања епизоотиолошке ситуације паразитоза на некомподручју не постоји основ за благовемено подузимање одређенихпрофилактичких мјера. Због чињенице које се односе на важност ектопаразитозапреживара, нарочито оних које угрожавају људско здравље и узрокују великеекономске губитке у сточарству, наметнула се потреба за обухватнијимиспитивањима ектопразитоза.Циљеви: Имајући у виду наведене чињенице о значају паразитоза код преживаракоје су посебно опасне за људско здравље и изазивају огромне економске губитке205

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYSу сточарству, постало је очигледно да је неопходно свеобухватно истраживање.Намећу се следећи истраживачки задаци: на основу налаза из паразитолошкогистраживања треба пописати ектопаразитозе код преживара у Босни иХерцеговини, затим треба испитати интензитет и међуоднос врста ектопаразитакоји су откривени у различитим старосним категоријама и врстама преживара.Материјал и методе: Током 5 година обављена су комплетна истраживањакојима је обухваћено 5.805 преживара, од којих су 1.908 биле овце са 11локалитета и 3.897 говеда са 19 локалитета. Животиње су припадале различитимстаросним категоријама. Говеда и овце су методом адспекције прегледане наприсуство шуге, крпеља, ваши, ларве говеђег штркља и у случају позитивногналаза или сумње на присуство шуге, ектопаразити су прикупљени запотврђивање у лабораторији.Резултати - Током периода од 5 године истраживања, извршене су комплетнепретраге 5.805 преживара од чега је 1.908 оваца и 3.897 говеда. Поријеклоиспитиваних животиња је са брдско-планинских региона Босне и Херцеговине.Испитивање оваца било је на 11 а говеда са 19 локалитета у БиХ. Због потпунијеслике, поред наведених претрага на ектопаразите преживара, још је претраженоискључиво на хиподермозу 1624 говеда.Анализом добивених резултата из класе Insecta утврђене су 4 врсте ектопаразита којесу по зоолошкој класификацији сврстане у два реда (Anoplura i Diptera). Искључивокод оваца утврђене су врсте Oestrus ovis и Melophagus ovinus, а у говедаHaematopinus eurysternus и Hypoderma bovis. Према утврђеном укупном екстензитетуод наведених врста најчешћа је била врста Haematopinus eurysternus, друга је билаMelophagus ovinus и Hypoderma bovis и Oestrus ovis. Hypoderma bovis мада је била натречем мјесту по екстензитету инвадираности, ипак јој са епизоотиолошкогстановишта има највише значаја. Установљена је на 8 локалитета са екстензитетомод 22,3-77,0%. Највише позитивних случајева утврђено је код добних категоријајунади а интензитет инвадираности био је низак гдје је просјечно установљено 6-8ларви угрка III степена.У говеда, врста Haematopinus eurysternus регистрована је са екстензитетом од 41,9%и интензитетом инвадираности од 27 до 93 примјерка. Регистрација овог паразитаизвршена је на 18 локалитета, с тим да је највећи постотак утврђен на подручјуКључа и Приједора а постотак инвадираности кретао се од 38,2% до 67,0%.Примјећена је повечана инфестираност говеда у периоду јесен-зима, када је ипросјечан екстензитет био већи 58,0%.Претрагом оваца од инсеката најучесталији био је налаз Melophagus ovinus.Регистрован је код свих добних категорија са екстензитетом инвадираности од37,0%. Код оваца запажен је пад инвадираности овом врстом након стриже док јеистовремено код јањади био у порасту, тако да је у прољетном периоду (март-април)достизао вриједности од 29,2%. Интензитет инвадираности није био занемарљив,просје~но по једном грлу установљено је од 12 до 112 примјерака.206

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕOestrus ovis, врста из реда Diptera, код оваца евидентирана је у ниском постоткусвега 3,0%. Установљена је на 3 испитивана локалитета са налазом 3-5 ларви по грлу.Везано за локализацију ове врсте подједнако су биле заступљени налази и усинусима и у носним проходима. На основу резултата добивених прегледом кожепреживара на испитиваним подручјима Босне и Херцеговине утврђено је укупно 12врста из класе Arachnida од чега је из фамилије Ixodidae регистровано 11 а изфамилије Psoroptidae једна врста.Од иxодидних крпеља установљене су слиједеће врсте: Ixodes ricinus, Haemophisalispunctata, H. cholodokowskyi, H. inermis, Dermacentor reticulatus, D. silvarum,Hyalomma savignyi, H. detritum, H. excavatum, Rhipicephalus bursa i Rh. sangvineus и одшугараца врста Psoroptes ovis. Након проведених испитивања код преживара јеустановљена максимална инвадираност од 38,5% са врстом I. ricinus а минимална саD. reticulatus 0,05%. Екстензитет инвадираности преосталих врста кретао се од 0,9%за H. inermis do 19,2% za Rh. bursa. (Graf. 1.)Граф.1.: Међусобни однос у процентима утврђених врста крпеља код говеда иоваца Босне и ХецеговинеСа географског аспекта, односно према регионалној подјели у Босни је установљено8 врста крпеља код говеда и 4 у оваца, док је у Херцеговини бројност утврђенихкрпеља била већа па је у говеда регистровано 10, а у оваца 8. У региону централнеБосне код преживара, евидентирано је најмање врста (4), а у источној Херцеговининајвише (10).Треба нагласити да инвадираност преживара на испитиваним подручјима у БиХ саиxодидним крпељима није била висока, изузетак су чиниле врсте I. ricinus, H.207

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYSpunctata, H. silvarum, H. detritum i Rh. bursa које су било код говеда или оваца ималерелативно већи ектензитет инвадираности од 12,9% до 48,8%, док су остале врстерегистроване у ниском постотку од 0,05% до 9,3%. У складу са наведеним налазимаекстензитета био је и интензитет инвадираности гдје је просјечно установљено 6 до 7примјерака по једној животињи. Најучесталији су били налази са једном врстомкрпеља у 77,4% случајева, са двије 19,8% и са 3 врсте 2,8%. Из фамилије Psoroptidaeу истраженом материјалу утврдили смо код оваца присуство врсте Psoroptes ovis саукупним екстензитетом од 12,8%. Треба нагласити да овако релативно високпостотак шуге код оваца највјероватније није одраз стварног стања на терену, поштоје евидентирана само на 4 локалитета од 26 испитиваних, а позитиван налазустановљен је код оваца у којих претходно није вршено редовна антипаразитарназаштита.Истраживања ектопаразита која су обавиљена на преживарима више су ималафаунистичку основу, тачније базирала су се на детерминацији врста ираспрострањености установљених врста на испитиваним подручјима. Збогобимности података нисмо били у могућности детаљније обрадити епизоотиолошкуслику ектопаразитоза те испитати и утицај осталих фактора (вегетације, састава тла,микроклиме и др.) који условљавају појаву одређене врсте ектопаразита.Литература1. Bowman D.D.: Georgis Parasitology for Veterinarians, 7 th edition. W.B.Saunders Company, USA, 1999.2. Ĉanković M., Jaţić A.: Parazotologija domaćih ţivotinja, Sarajevo, BiH, 1998.,3. Hendrix C.M.: Diagnostic Veterinary Parasitology. Second edition, Mosby,USA, 1998.4. Kaufmann J.: Parasitic Infections of Domestic Animals. A diagnostic manual.Birkhauser, Verlag, Basel, Švicarska, 1996.5. Nobile L., Fiorvanati M.L., Vigraa., Canestritrotti G.: Aggiornamentu allafauna ixodologica della Sicilia. Nota 2. Atti SS Veterinaria, XLVIII, 2, 1297-1300, 1994. Italy6. Soulsby E.J.L.: Helminths, Artropods and Protozoa of Domesticated Animals. 7 thedition, Bailliere Tindall, Division of Cassell Ltd.London, Velika Britanija, 1986.7. Šibalić S., Cvetković Lj.: Parazitske bolesti domaćih ţivotinja. Beograd, Srbija,1996.8. Zuko Almedina, Omeragić J., Jaţić A.: Praktikum iz Invazionih bolestiţivotinja. Bemust d.o.o. Sarajevo, 2009208

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕZOONOTIC NEMATODES OF FISHĆirković M., Novakov N., Ljubojević D., Aleksić N. , Jovanović M.АbstractNematodes infect freshwater and marine fish species. Pathology normally occurs withinthe intestines but can affect all organs and substantial damage to the host can occur.Some nematodes cause high levels of fish mortality in wild fish populations. Nematodescan infect fish as adults but larval stages of nematodes infecting piscivorous birds,mammals or reptiles, or less frequently predatory fish, can also infect fish species. Somenematodes are zoonotic and include species such as Anguillicola, Philometra,Skrjabillanus, Eustrongylides and Anisakis. Ingestion of uncooked or undercookedinfected fish meat poses a zoonotic threat to humans. The presented paper givesnematodes that occur in freshwater fish of Serbia. The investigations were carried outfrom 2011-2012 on Danube–Tisa–Danube Canal in the territory of Novi Sad wherewere collected 21 samples of zander (Sander lucioperca) weighting 250-500 g and 52samples of European catfish (Siluris glanis) weighting 250-450 g. Postmortemexamination of abdominal cavity, digestive tract and other ventral organs wasconducted. Presence of nematodes in the abdominal cavity, musculature, in the lumen ofthe stomach and encapsulated in stomach wall was revealed in 4 individuals of zanderand 6 individuals of European catfish. The number of parasites per fish ranged from afew up to the 256. Relative parametars were measured and identification was performedusing Bauer (1987), Moravec (1994) and Anderson (2000) keys. Parasites weredetermined as Eustrongylides sp. - larval form. Samples for patohistologicalexamination were taken from muscles and nodules in stomach walls. NematodesEustrongylides sp. are parasites of piscivorous birds. Their life cycle require twointermediate hosts, aquatic oligochaetes and benthophagous fish. Human is not atypical host but may be infected if eats raw or insufficiently cooked or fried fish meat.Adequate preparation of fish meat is a very important as a precaution in human nutritionand to increase public awareness concerning the consumption of such fishes.Key words: nematodes, zoonosis, fish, Eustrongylidesdr Miroslav Ćirković, dr Nikolina Novakov, msc Dragana Ljubojević, Faculty of Agriculture , Novi Sad,Serbia, Trg Dositeja Obradovića 8. miroslavcirkovic@yahoo.com ; dr Nevenka Aleksić, dr Milijan Jovanović,Faculty of Veterinary Medicine , Belgrade, Serbia, Bulevar OsloboĊenja 18209

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYSЗООНОТСКЕ НЕМАТОДЕ КОД РИБАЋирковић М., Новаков Н., Љубојевић Д., Алексић Н. , Јовановић М.Кратак садржајНематоде могу инфицирати слатководне и морске врсте риба. Промене којеизазивају најчешће су присутне на цревима али могу бити присутне и на другиморганима и довести до значајних оштећења. Неке нематоде могу изазвати вискокморталитет, нарочито у дивљим популацијама риба. Ови паразити могуинфицирати рибе као адулти и као ларвени облици нематода чији су правидомаћини најчешће птице, сисари, рептили, а ређе могу бити и предаторске рибљеврсте. Неке нематоде могу бити зоонотске и најчешће врсте су из родоваPhilometra, Skrjabillanus, Eustrongylides и Anisakis. Ингестија пресне или слабослабо куване рибе представља значајну опасност за појаву ових зооноза код људи.У овом раду приказане су нематоде које се јављају код слатководних риба уРепублици Србији. Истраживања су спроведена у периоду од 2011-2012 године наканалу Дунав-Тиса-Дунав, у градском подручју Новог Сада. Прикупљен је 21узорак смуђа (Sander lucioperca) тежине од 250-500 g и 52 узорка сома (Silurisglanis) тежине 250-450 g. Урађен је постмортални преглед абдоминалне дупље,дигестивног тракта и других висцералних органа. Утврђено је присуство нематодакод 4 јединке смућа и 6 јединки сома у абдомену, мускулатури, лумену желуца ижелудачном зиду где су паразити били инкапсулирани. Број паразита по рибикретао се од неколико па све до 256. Релативни морфометријски параметри иидентификација паразита спроведени према кључевима Bauerа (1987), Moravecа(1994) и Andersonа (2000). Нематоде су идентификоване као Eustrongylides sp.-ларвени облици. Узорци за патохистолошки преглед узети су из мишића и нодулакоји су се налазили у желудачном зиду. Нематоде из рода Eustrongylides супаразити рибоједих птица. Њихов развојни циклус обухвата два прелазнадомаћина, акватичне олигохете и бентофагне рибе. Човек није типичан домаћинали се може заразити уколико једе сирово или недовољно термички обрађеномесо риба. Стога је адекватна припрема рибљег меса једна од најважнијих мераопреза као и подизање јавне свести приликом конзумације ових риба.Кључне речи: нематоде, зоонозе, рибе, Eustrongylidesдр Мирослав Ћирковић, редован професор; др Николина Новаков, асистент ; мсц Драгана Љубојевић,истраживач сарадник; Пољопривредни факултет Нови Сад, Трг Доситеја Обрадовића 8, 21000 НовиСад, Србија. miroslavcirkovic@yahoo.com; др Невенка Алексић, редован професор; др МилијанЈовановић, редован професор; Факултет ветеринарске медицине Београд, Булевар Ослобођења 18, 1100 Београд, Србија210

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕCOMPARATIVE STUDY OF NOSEMA PRESENCE IN BEES WITHCLASSICAL MICROSCOPIC EXAMINATION AND QUANTITATIVEMETHODS OF DIAGNOSINGManić Marija, Raiĉević Z., Plavša Nada, Prokić Nataša, Marić J.,Đuriĉić BosiljkaАbstractNosemosis is the most common disease of adult bees which is widespread in ourcountry and often causes severe damages to bee colonies. Described are two causativeagents of bee nosemosis Nosema apis Zander cause disease at European honeybees(Apis mellifera) and Nosema ceranae cause disease at Asian honeybee (Apis ceranae).Based on data from recent researches, the presence of N.ceranae is increasingly morefrequently revealed at European bees. Nosema species can be differentiated only bymolecular techniques, while the appearance of spores in native preparations, using lightmicroscopy, can´t make a difference between them. In the diagnosis of bee nosemosisOIE recommended classic native preparations. A rough estimate of the degree ofinfection is possible if the native preparation is always prepared with constant ratiobetween the number of bees and water. For accurate determination of infection degree,also can be applied quantitative methods. The aim of this paper is to describequantitative method for determining number of Nosema spores, as well as to showcomparatively examination of infection level using classical and quantitative method.The purpose of quantitative method is to determine level (degree) of infection, diagnosisand confirmation of identified infected bee colonies with the aim to timely implementappropriate measures disease control.*This study was supported by grant TR37015 from Serbian Ministry of Education, Science andTechnological DevelopmentKeywords: Nosema spp., quantitative methods, the level of infectionDVM Manić Marija, Research Assistant, DVM Prokić Nataša, Research Assistant, Dr vet. мed. Marić Jovan,Research Assistant, Prof Dr Bosiljka Djuriĉić, Professor, Department of infectious animal diseases anddiseases of bees, Faculty of Veterinary Medicine, Bulevar oslobodjenja. 18, Belgrade,; Dr Raiĉević Zoranvet.med. specialist epidemiology, Veterinary Specialist Institute, Milke Protić bb, Nis, doc. Dr. Plavša Nada,Assistant Professor, Department of Animal Husbandry, Faculty of Agriculture in Novi Sad, Trg DositejaObradović 8, Novi SadIntroductionNosemosis is a widely distributed disease of adult bees which causes severe damages inbeekeeping. Described are two causative agents of bee nosemosis Nosema apis Zandercause disease of European honeybees (Apis mellifera) and Nosema ceranae causedisease of Asian honeybee (Apis ceranae). Studies have shown that in last two decades,N. ceranae is present at European honeybees, as well. (12, 6, 9). Molecular methodPCR-RFLP confirmed the presence of N. ceranae spores in samples of bees from211

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYSdifferent countries, including the South Moravian part of Serbia in 2006 (10). It isconsidered that N. ceranae is much more aggressive than N. apis. Some studiessuggested a relationship between N. ceranae and rapid collapse of bee colonies (Colonycollapse disease - CCD) (6, 7). The importance of Nosema spp. is greater if taking intoaccount its relationship with some viral diseases of bees, such as virus black queen(Black queen cell virus - BQCV) and Apis iridiscent virus - 6 (Invertebrate iridescentvirus 6 - IIV-6). Mikrosporidia Nosema spp. along with the deformed wing virus(Deformed wing virus - DWV), Kashmir virus (Kasmir bee virus - KBV), black queenvirus (BQCV) and acute paralysis virus of bees (Acute bee paralysis virus - ABPV) cancontribute to a CCD syndrome (4). Although there is a positive correlation with viraldiseases it isn't known mechanism by which Nosema spp. could transmit the virus tohoneybees (3.1). There is also evidence that N. ceranae doesn't have great virulence andprevalence of Nosema is not related to CCD (5). Considering that clinical examinationcan only suspect on nosemosis, of exceptional importance is taking of adequate beesamples for laboratory diagnosis. Although the infection occurs all year round, the besttime for proving Nosema spp. spores in the bees colonies is onset of active season afterwinter (15). The only method that provides a definitive diagnosis of nosemosis,regardless of the level of infection, is the microscopic examination of bees sample orbee feces where is possible to reveal spores of causative agents (11).Materials and Methods - A total of 95 samples of bees who were taken from 13apiaries around Belgrade, Uzice, Sabac and Kucevo. Each sample was examined withclassical method, ie microscopic examination of native preparation which is prepared byhomogenisation of ten bees abdomens in one milliliter (1 ml) of distilled water. Theresults of microscopic examination of native preparations have been marked with one,two or three pluses which were determinate on the basis of following rule: + - native preparation in which can be seen one or several spores, but not inevery visual field; + + - native preparation in which can be seen one or several spores in each212field of view (up to 20 spores in the visual field);+ + + - numerous spores in the visual field.Then, each sample was examined by a quantitative method.To determine infection level, scientists use quantitative method to determine number ofspores of Nosema spp. Scientist Cantwell was the first who set up this model in 1970 th(2, 8).The sample was prepared by maceration of ten intestines or whole bees abdomens in 1ml of distilled water or physiological solution. Then, the homogenate was filtered outthrough two layers of gauze into centrifuge tubes and centrifuged 6 minutes at 800rev/min. Spores are precipitated at the bottom of the cuvettes. The supernatant wasrejected and sediment was re-suspended in 10 ml of distilled water or saline solution(one bee per ml).For quantitative method, spores of Nosema spp. were determined by using ofhemocitometar, most often by Neubauer. On hemocytometer is placed cover husk, usingpipette transfer a drop of exploring sample and wait about 3 minutes to appease theliquid. Then do microscopy with magnification of 400x. Spores of Nosema spp. are

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕcounted in the central square of hemocytometer which is divided into 16 smallersquares, within each of them is 25 squares. In order to obtain a good average, countspores in five bigger square or 125 squares. Since each square has a volume of 0.00025mm 3, or 1/4000 of 1 mm 3 , we should calculate the average number of spores in a singlesquare and multiply the resulting figure with 4 × 10 6 to get the number of spores percubic centimeter. This means that the number of spores in a single bee, calculated fromfollowing equation, is:number of sporesby bees6the totalnumber of counted sporesin 5 square (410)number of counted squaresIf infection level is less than 10,000 spores per bee, in the mesh they cannot be seen.That is why is important to have a seriously approach to diagnosis and to examine agreater number of bees from one hive (13). If spores are present in large number so thatthey can't count accurately, spore suspension can be diluted and the dilution factor needto incorporate into the equation (8).Results - Based on examination of 95 native preparation samples, 22 of them foundnegative and 67 were positive to Nosemosis. Positive samples were tagged as: one plus(+), two pluses (++) and three pluses (+ + +). In five native prepared samples sporesweren‘t found, while simultaneously use of quantitative method found one to threespores throughout the grid. In one sample of spores were found only in nativepreparation. Such preparations are marked with ±.Quantitative method showed that native preparation samples marked as + corresponds10,000 to 100 000 spores per bee, the samples marked with a + + are 100 000 to 1,000000 spores per bee, and samples marked with + + + are more than 1,000 000 spores perbee.During the examination we observed an increased presence of protozoan cysts ofMalpighamoeba mellificae Prell that causes bee amebiasis. It is believed that thisdisease does not cause serious damage to bee colonies, but can cause diarrhea and alsocontributes to weakening immune system of bees. The disease usually occurs incombination with Nosemosis as a secondary causative agent, but also can be diagnosedas a separate illness.Discussion and Conclusions - During our tests it wasn't found positive correlationbetween number of Nosema spp. spores and mortality rates for bees, but it certainlycontributes reducing of society resistance and extinction.Purposes of quantitative methods are:- Determination of infection degree with spores of Nosema spp.;- A positive diagnosis of clinical cases and the identification of infected bee colonies inorder to implement measures for disease control;- Monitoring the impact of Nosemosis in relation to the other factors that lead to a rapidcollapse of bee colonies;- Method has a special significance in determining the infectious dose for artificialinfection of bees for experimental purposes;213

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYS- Monitoring the effects of the means to combat Nosema spp.In our country, for control of Nosemosis still can be used antibiotic fumagillin, which isbanned in the EU since it has been shown that residues of antibiotics in honey may havegenotoxic effects that increase the risk of cancer and chromosomal anomalies inmammals (14).Great importance to prevent outbreak and spreading of Nosema spp. in bees have goodselection of sites for apiaries, providing fresh water, working with strong colonies andtimely diagnosis of Nosemosis.Literature1. Bromenshenk J. J., Henderson C. B., Wick H. C., Stanford F. M., Zulich W., А.,Jabbour E. R., Deshpande V. S., McCubbin E P., Seccomb A. R., Welch M. P .,Williams T., Firth R. D., Skowronski E., Lehmann M. M., Bilimoria L. S., Gress J.,Wanner W. K., Cramer A. R..(2010) Iridovirus and Microsporidian Linked to HoneyBee Colony Decline. PloS ONE 5(10): e13181. doi:10.1371/journal. pone.00131812. Cantwell GE (1970) Standard methods for counting nosema spores. American BeeJournal. 110: 222-2233. Cornman RS, Tarpy DR, Chen Y, Jeffreys L, Lopez D, et al.(2012) Pathogen Webs inCollapsing Honey Bee Colonies. PloS ONE 7(8): e43562. doi:10.1371/journal.pone.00435624. Higes M., Martín-Hernández R., Meana A. (2006) Nosema ceranae, a newmicrosporidian parasite in honeybees in Europe. J. Invertebr. Pathol. 92 (2006) 93–955. Higes M., Martín-Hernández R., Botías C., Garrido Bailón E., González-Porto V.Amelia, Laura Barrios, M. Jesús del Nozal, José L. Bernal, Juan J. Jiménez, PilarGarcía Palencia, Aránzazu Meana (2008) How natural infection by Nosema ceranaecauses honeybee colony collapse. Environ. Microbiol. (2008) 10, 2659–2669. doi:10.1111/j.1462-2920.2008.016876. Klee Julia, Andrea M. Besana, Elke Genersch, Sebastian Gisder, Antonio Nanetti, DinhQuyet Tam, Tong Xuan Chinh, Francisco Puerta, Jose Maria Ruz, Per Kryger, DejairMessage, Fani Hatjina, Seppo Korpela, Ingemar Fries, Robert J. Paxton (2007)Widespread dispersal of the microsporidian Nosema ceranae, an emergent pathogen ofthe western honey bee, Apis mellifera. J. Invertebr. Pathol. 96 (2007) 1–107. OIE (2008) Manual of Diagnostic Tests and Vaccines for Terrestrial Animals, Chap.2.2.4., Nosemosis of Honey Bees,http://www.oie.int/fr/normes/mmanual/2008/pdf/2.02.04NOSEMOSIS.pdf.8. Плавша Нада (септембар, 2007) Ноземоза, тихи убица пчелињих друштва. Пчеларчасопис из света науке и праксе у пчеларству ISSN 0350-431X. COBISS.SR-ID159132189. Stanimirovic, Z., Stevanovic, J., Bajic, V., Radovic, I. (2007) Evaluation of genotoxiceffects of fumagillin by cytogenetic tests in vivo. Mutation Research. 628: 1–1010. Traver E. Brenna, Matthew R. Williams, Richard D. Fell (2012) Comparison of withinhive sampling and seasonal activity of Nosema ceranae in honey bee colonies. J.Invertebr. Pathol. 109 (2012) 187–193214

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕSession 5FREE TOPICS – POSTERS –СЛОБОДНЕ ТЕМЕ – ПОСТЕРИ –215

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYS216

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕMYXOMATOSIS IN SERBIA AND WORLDWIDE - CURRENT EPIZOOTICSITUATION WITH REGARD TO IMMUNOPROPHYLAXIS *Marić J., Kneţević N., Nešković Milijana, Korytar L.AbstractMyxomatosis is an important viral disease of wild and domestic European rabbits(Oryctolagus cuniculus), caused by the myxoma virus (MV), which belongs to the groupof dsDNA viruses, family Poxviridae, genus Leporipoxvirus. Rabbits rarely get sick.Most often way of transmiting the virus is through the bite/sting hematofagous insects,mosquitoes and fleas. Natural hosts are two types of leporides: Sylvilagus brasiliensis inSouth America and Sylvilagus bachmani in California, where disease occurs in the formof benign fibroma, while the general symptoms of the disease can be found only in theyoungest category. Oposite to the natural hosts, their European cousins have moreserious situation and disease in this case runs in two forms: nodular (classical), andamyxomatous (respiratory). The virus was first detected in 1896 in Uruguay, where itquickly spread to all of South America and then in Europe and Australia. In manycountries the agent was used on purpose, in order to prevent unplanned reproduction ofrabbits (Australia 1950). However, biological control of rabbits population led to pointthat disease has spread to all continents. In recent years, it is registered many cases ofmyxomatosis in Serbia and the region. Myxomatosis is a worldwide problem and fromdata we can see that this disease is present in the southern parts of South America, alarge part of Western Europe, Russia, Australia, and rarely in some African countries.The likelihood that the agent is present also in some other countries but there is nocurrently available information. In prevention we use good zoohygienic practice, andvaccination. Two types of vaccines was used until the nineties: heterologous, prepared fromShop`s fibroma virus, and homologous, prepared from attenuated strains of MV, and recentlyrecombinant vaccine against myxomatosis and rabbit haemorrhagic disease. In our country since1983. both production Institute (Vetrinary Medicine Institute Zemun and Subotica) produced thelive freeze-dried vaccine against attenuated homologous virus of myxomatosis. In VeterinaryMedicine Institute Inc. Zemun for 26 years of production was produced 2,013.967 dose, total,which is the average dose of 77,460 / year. Due to new legislation and opinion of newowner of Veterinary Medicine Institute Inc. Zemun that economically is not worthrenewing and new registration of a vaccine, under the Law of drugs and medicaldevices, production of a vaccine was stopped during the 2009 th year, which represents amajor problem for growers and for lovers/owners of rabbits. Maybe the solution is thatthe vaccine is produced as "stables" of vaccines, or by recommendation ЕМЕА CVMP– Guideline on data requirements for immunological veterinary medical product forminor use or minor species /limited marcets /London 25. July 2008./.Key words: myxomatosis, Myxoma virus, rabbitsDVM Jovan Marić, research assistant, Faculty of veterinary medicine, University of Belgrade, BulevarOsloboĊenja 18; Dr sci. Nikola Kneţević, research associate, Veterinary Institute Zemun a.d. Belgrade,Батајнички друм 4, Земун; DVM Milijana Nešković, vet.specialist, Veterinary Institute „Zajeĉar―, Изворскипут бб, Зајечар; DVM Lubos Korytar, The University of Veterinary Medicine and Pharmacy in Kosice,Komenskeho 73, Slovakia217

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYSIntroduction - Myxomatosis is most important viral disease of wild and domesticEuropean rabbits (Oryctolagus cuniculus) caused by the Myxoma virus (MV), a memberof the Poxviridae family. Hares are rarely infected. Name of the disease comes from theGreek myxa - mucus. The natural hosts are two species of leporid: Sylvilagusbrasiliensis in South America (South American strains) and Sylvilagus bachmani(Californian strains) in California (6). In its natural hosts, the viral strains produce onlybening fibroma, generalized disease occurring only in juvenile animals.Clinical signs and treatment - In rabbits of the genus Sylvilagus (cottontail rabbits)living in the Americas, myxomatosis only causes localized skin tumors, but theEuropean rabbit (Oryctolagus cuniculus) is more severely affected, there are two formsof the disease have been identified to date: the nodular (classical) form and theamyxomatous (respiratory) form (5). At first, normally the disease is visible by lumps(myxomata) and puffiness around the head and genitals. It then may progress to acuteconjunctivitis and possibly blindness; however, this also may be the first indication ofthe disease. The rabbits become listless, lose appetite, and develop a fever. Secondarybacterial infections occur in most cases which cause pneumonia and purulentinflammation of the lungs. In cases where the rabbit has little or no resistance, deathmay take place rapidly, often in as little as 48 hours; most cases result in death within14 days. The most important route of spreading disease is over hematophage insects,like mosquitos and flies. There are no adequate therapy, only symptomatic treatmant.History and epizootilogy - Myxomatosis was first recognized as a virus disease when itkilled European rabbits (Oryctolagus cuniculus) in Giuseppe Sanarelli's laboratory inMontevideo, Uruguay,in 1896. After its discovery 1896 in imported rabbits in Uruguay,a relatively harmless strain spread quickly throughout the wild populations in SouthAmerica.In 1911, workers in the Oswaldo Cruz Institute in Rio de Janeiro observed thedisease in their laboratory rabbits and correctly classified the causative agent as a largevirus. Virus is identified as a poxvirus in 1927. Henrique de Beaurepaire Aragão,working at the Oswaldo Cruz Institute, showed that it could be transmitted mechanicallyby insect bite. In 1942, he showed that the reservoir host in Brazil was the local wildrabbit, Sylvilagus brasiliensis, in which the virus produced a localized nodule in theskin.In Australia, the virus was first field-tested for population control in 1938. A full-scalerelease was performed in 1950. It was devastatingly effective, reducing the estimatedrabbit population from 600 million to 100 million in two years. However, the rabbitsremaining alive were those least affected by the disease. Genetic resistance tomyxomatosis was observed soon after the first release and most rabbits acquired partialimmunity in the first two decades. Resistance has been increasing slowly since the1970s, and the disease now only kills about 50% of infected rabbits. Controversially,Myxomatosis was introduced to France by the bacteriologist Dr. Paul Armand Delille,following his use of the virus to rid his private estate of rabbits in June 1952 (Heinoculated two of the rabbits on his land). Within four months the virus had spread50 km; Armand suspected this was due to poachers taking infected rabbits from hisestate. By 1954, 90% of the wild rabbits in France were dead.218

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕFrom there, the disease spread explosively, in the next two years, trough the westernpart and partally central and southern Europe. Later the disease caught Northern Europe,and in the east it spread to Poland, the Czech Republic and Slovakia. It reached the UKin 1953, being illegally imported onto an estate in West Sussex. The governmentrefused to legislate to make deliberate spread of the disease illegal. By 1955, about 95%of rabbits in the UK were dead. Unfortunately, the disease has wider consequences apartfrom the death of rabbits. However, in 2005 the UK Land Registry conducted a surveyof 16,000 hectares of its land and reported that the rabbit population had increasedthree-fold every two years likely a product of increasing genetic resistance to the virus.The Spanish Imperial Eagle and the Iberian Lynx, among others, are now almost extinctbecause the decline of the rabbit population, which is about 80% of their diets, hascaused mass starvation.The development of resistance to the disease seems to have taken different courses. InAustralia, the virus initially killed rabbits very quickly, about 4 days after infection.This gave little time for the infection to spread. However, a less virulent form of thevirus has become prevalent there, spreading more effectively by being less lethal. InEurope, many rabbits are genetically resistant to the original virus that was spread. Thesurvival rate of diseased rabbits has now increased to 35% when in the 1950s it wasnear zero.Myxomatosis is world wide present problem. From OIE data we see that disease ispresent in the southern parts of South America, the largest part of Western Europe,Russia, Australia and rarely in some african countries. It is likely that the agent ispresent also in some other countries but information are not available (Tab. 1.).Table 1. Locations of myxomatisis occurence, 2005 – 2012YEARSCOUNTRY2005 Costa Rica Paraguay, Chile, Argentina Ireland, Portugal, Spain, France, Germany, Netherlands, Belgium,Germany, Poland, Czech Republic, Russia, Angola, Australia -2006 - Portugal, Spain, France, Italy, Ireland, United Kingdom, Czech Republic, Luxembourg, Germany, Poland,Netherlands, Belgium, Slovenia Australia2007 Panama Argentina, Chile, Paraguay Portugal, Spain, Italy, Ireland, United Kingdom,Czech Republic, Germany, Poland, Netherlands, Belgium, Slovenia, Romania,Denmark Tunisia Australia2008 Panama Argentina, Chile, Venecuele Portugal, Spain, Italy, United Kingdom, CzechRepublic, Luxembourg, Ukraine, Poland, Sweden Australia2009 Mexico, Panama, Venecule Argentina, Chile Spain, United Kingdom, Ireland, France,Czech Republic, Poland, Ukraine, Russia Australia2010 - Mexico, Panama Chile, Argentina Portugal, Spain, France, Italy, United Kingdom,Czech Republic, Russia, Sweden, Belgium, Serbia, Slovakia, Slovenia Australia2011 Mexico, Panama Argentina Portugal, Ireland, France, Germany, Poland, CzechRepublic, Greece. Italy, Russia Australia2012 - Portugal, Spain, France, Italy, Ireland, Netherlands, Czech Republic, Greece- AustraliaIn our country the disease has been present for a long time, but in a way it was keptunder control because there was a vaccine of Veterinary Medicine Institute Inc. Zemun,Myxovet (until 2009.). In 2010. numerous rabbits farms were closed, with tens ofthousands registered deaths, due to not implementing adequate prophylaxis; importedvaccine was used, which is more expensive and obviously not effective. Also, there is a219

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYSoccurrence of myxomatosis in 147 households in the city of Zajeĉar 2010, with 8 deathoutcomes (12).Apart from Serbia disease was registered in the rest of the Balkan peninsula. In theregion myxomatosis was reported in Bulgaria in 2001 (13), and in 2012, where wasperformed clinic-morphological and epidemiological studies on 3 non-professionalrabbit farms. The results show almost 100% morbidity rate and about 90% of death rate(9). Also there is report from Hungary, in 2003, of atypical myxomatosis in CentralEurope (1).Use of vaccine - In the prevention of this disease used good zoohygienic practice andvaccination. Two types of vaccines was used until the nineties: heterologous, preparedfrom Shop`s fibroma virus, and homologous, prepared from attenuated strains of MV,and recently recombinant vaccine against myxomatosis and rabbit haemorrhagicdisease.The vaccine is not allowed to be used in Australia because the live virus in the vaccinehas the potential to spread into the wild rabbit population which could result in wildrabbit immunity to myxomatosis. If this happened, there would be a dramatic increasein the number of wildrabbits in Australia, which would cause major damage to the environment and economiclosses. Many pet rabbits in Australia continue to die from the disease due to their lack ofimmunity.In Australia the Pest Animal Control funded some studies on novel vaccines againstmyxoma virus which were conducted at Commonwealth Scientific and IndustrialResearch Organisation (CSIRO) and the Australian National University from 2001 to2005. The aim was to develop a vaccine that could protect rabbits against myxomatosiswithout causing significant side effects but could not be transmitted by mosquitoes orfleas. Three different strategies were tried: DNA vaccines: these vaccines consisted of DNA plasmids containing particulargenes from myxoma virus that encoded proteins that potentially couldstimulate an immune response to myxoma virus. None of these DNA vaccinesprovided any protection against myxomatosis. Host-range defective vaccine: in this vaccine a gene was deleted in the viruswhich is essential for it to replicate in rabbits (making it impossible for thevaccine virus to spread to wild rabbits). Rabbits immunised with this vaccinehad very good short-term protection against myxomatosis but longer termprotection was not satisfactory with the dose and boosting regime trialled.Further work to define dose rates and boosting times would be needed todetermine whether this vaccine could be successfully used to protect rabbitsagainst myxomatosis. Live attenuated virus vaccines: three vaccines were constructed and testedusing a naturally highly attenuated Australian field strain of myxoma virus inwhich we inactivated one, two or three genes that are important for causingdisease. The virus with three virulence genes inactivated (UR-TKO) providedvery good protection against myxomatosis with few side effects in the220

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕimmunised rabbits. Trials in a small number of wild rabbits showed that thevaccine had very limited potential to transmit.Table 2. Homologous vaccines against myxomatosisVaccines ManufacturerMYXOVETKUNIVAKMYXOVACDERVAXIMYXO SG-33MYXOHIPRA-HVeterinaryMedicineInstituteZemunVeterinaryMedicineInstituteSuboticaPhylaxiaBudapestPhoneMeriuxHipraBarcelonaDose andmethod ofapplicationMinimum titer ina dose0.5 ml i/m >10 2 KID 50>10 3 KID 50VaccinationprogramBroile OffspringrOlder than 6 weeks;not recommended forgravid animals0.5 ml i/m - 3 months and older(not less than onemonth old, gravid isok)0.5 ml i/m - Older than 6 weeks,gravid os ok, butcarefully0.1 ml i/dDERMOJET0.5 ml s/cor 0.1 mli/dDERCUNIMIX Merial Lyon 0.2 ml i/d―in the ear‖or samedosis asdermojetNOBIVACMYXO-RHDIntervetInternationalBV ANBoxmeer>10 2 KID 50>10 3 TCID50Min 2.7log 10TCID 50lineageSG33myxomavirus(lyoph.)0.2 ml s/c LivemyxomavectoredRHDvirus str/009>10 3and 10 6FFUFirstvacc.28dayShope30.dayof life1.Shope 28day2.SG-33 6-8 week3.SG-33 6-7 moth2.5 monthrevaccinationRevaccination is notrecommended 45days before firstvaccination10 th week forprevention frommoratality…for bothdisease, gravid is okFrom week 5, yearsvaccinationVaccination is notrecommended duringfirst 14 days ofgravidity periodRemarks/CommentsIn infected area itis recommended touse 10 timesstronger dosis innext order:1. 28 day2. 42 – 45 day3. vaccinationevery 6 monthswith field dosis/Kneţević I sar.2002./Prestanakproizvodnje 2009.g.VHD immunityoccurs for a oneweek and lasts oneyaer, and formyxomatosis 4mothsimmunity occursin 3 weeks andlasts for a year* i/m = intramuscular, s/c = supcutaneus, i/d = intradermal, TCID = 50% of infective cultures,KID = 50% of rabbits infective doses, FFU = focus foming units, RHD = rabbit haemorrhagicdisease /live myxoma vectored RHD virus/In our country since 1983. both production Institute (Vetrinary Medicine InstituteZemun and Subotica) produced the live freeze-dried vaccine against attenuated221

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYShomologous virus of myxomatosis (Tab. 2.). In Veterinary Medicine Institute Inc.Zemun for 26 years of production was produced 2,013.967 dose, total, which is theaverage dose of 77,460 / year.Due to new legislation and opinion of new owner of Veterinary Medicine Institute Inc.Zemun that economically is not worth renewing and new registration of a vaccine,under the Law of drugs and medical devices, production of a vaccine was stoppedduring the 2009 th year, which represents a major problem for growers and forlovers/owners of rabbits. Maybe the solution is that the vaccine is produced as "stables"of vaccines, or by recommendation ЕМЕА CVMP – Guideline on data requirements forimmunological veterinary medical product for minor use or minor species /limitedmarcets /London 25. July 2008./.ConclusionsMyxomatosis is a world wide present problem. Only successful usage of zoohigienicmeasures combining with adequate program of vaccination can bring us positive results.In our country during the era of privatisations new leaders don`t see importance ofagriculture and veterinary services, and that type of thinking produce numerousproblems; in this case lack of vaccines.It is necessary to investigate every suspicious case of rabbits disease or death, actquickly and prevent any further spreading.* Paper is financied by the Ministry of Education, Science and Technological Development(Project TR37015)Literature1. Arguello Villares J.L. (1986). Contribución a la profilaxis de la mixomatosis delconejo mediante el uso de una ceba homologa. Medicina Veterinaria, 3, 91–103.2. Bertagnoli S., Gelfi J., Legall G., Boilletot E., Vautherot J.F., Rasschaert D.,Laurent S., Petit F., Boucraut-Baralon C. & Milon A. (1996). Protection againstmyxomatosis and rabbit viral hemorrhagic disease with recombinant myxomavirus expressing rabbit hemorrhagic disease virus capsid protein. J. Virol., 70,5061–5066.3. Bodiroga N. Jovanka: Atenuisanje i ispitivanje imunogenih osobina soja virusamiksomatoze. /doktorska teza/ , Fakultet veterinarske medicine Beograd, 1985.,str. 914. Carter, G.R. Wise, D.J. (2006): A Concise Review of Veterinary Virology,Poxviridae, Part 2, Chap. 10.5. Farsang, L. Makranszki, M. Dobos-Kovács, Györgyi Virág, Katalin Fábián, TímeaBarna, G. Kulcsár, L. Kucsera, F. Vetési, 2003: Occurrence of atypicalmyxomatosis in Central Europe: clinical and virological examinations, ActaVeterinaria Hungarica, 51(4):493-501.6. Fenner F. & Woodroofe G.M. (1954). Protection of laboratory rabbits againstmyxomatosis by vaccination with fibroma virus. Aust. J. Exp. Biol., 32, 653–668.7. Fenner F. (1994): Myxoma virus in Virus infections of Vertebrates, Vol. 5. Virusinfections of Rodents and Lagomorphs, Osterhaus A.D.M.E, ed. Elsevier ScienceB.V., Amsterdam, Netherlands, 59-71.8. Gorski J. & Mizak B. (1985). Polish vaccine against myxomatosis in rabbits. Med.Weter., 41, 113–116.222

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕ9. Iv. Dinev 2012: An outbrake of myxomatosis in rabbits in Bulgariaclinicomorphological studies, Trakia journal of Sciences, Vol. 10, No 1, 79 – 84.10. Jobert R. (1983). Contribution à l‘étude de la vaccination contre la myxomatose,vaccination à l‘aide du virusfibromateux. Thèse Doctorat Vétérinaire Toulouse n°82.11. Kneţević N, Ljiljana Paušak, Veljović Lj., Kozlina B (2002): ImunogenostMYXOVET vakcine u epizootiološki ugroţenom podruĉju. IV Jugoslovenskiepizootiološki dani, Mataruška Banja.12. Kneţević N. (1986):Adaptacija i umnoţavanje virus myxomatoseae na kulturitkiva. Veterinarski glasnik 40(11):801-807.13. Nešković Milijana, Ilić H., Đuriĉić Bosiljka, Videnović V., (2011): Prikaz sluĉajapojave miksomatoze kunića na teritoriji grada Zajeĉara, I Internationalepizootiology dazs, XIII Epizootiološki dani Srbije.14. Peshev, R., Alexandrov, M., Bostanijeva, R., Kostov, G., Ivanov, I. and Kamenov,P., Rabbit Myxomatosa Vet. Med., 1-2: 5-10, 2001.МИКСОМАТАЗА КОД НАС И У СВЕТУ – ТРЕНУТНАЕПИЗООТИОЛОШКА СИТУАЦИЈА СА ОСВРТОМ НАИМУНОПРОФИЛАКСУ *Марић Ј., Кнежевић Н., Нешковић Милијана, Korytar L.Кратак садржајМиксоматоза је важна вирусна болест дивљег и домаћег европског кунића(Oryctolagus cuniculus), проузрокована са Myxoma вирусом (MВ), који припадагрупи dsDNA вируса, фамилији Poxviridae, род Leporipoxvirus. Ретко обољевају изечеви. Вирус се најчешће преноси уједом/убодом хематофагних инсеката,комараци и буве. Природни домаћини су две врсте лепорида: Sylvilagusbrasiliensis у Јужној Америци и Sylvilagus bachmani у Калифорнији, код којих себолест јавља у виду бенигних фиброма, док се општа слика болести среће самокод најмлађих категорија. За разлику од природних домаћина, код њиховогевропског рођака ситуација је озбиљнија и болест у овом случају протиче у двеформе: нодуларна (класична), и амиксоматозна (респираторна).Вирус је први пут откривен у Уругвају 1896 године, одакле се врло брзопроширио на целу Јужну Америку, након чега и у Европу и Аустралију. У многеземље узрочник је унет намерно, да би се спречила непланирана репродукцијакунића ( Аустралија 1950.). Mеђутим биолошка регулација популације кунића једовела да је болест данас присутна на свим континетима. Последњих годинарегистровани су многи случајеви миксоматозе у Србији и региону. Што сераширености у свету тиче кроз године се види да је болест присутна у јужнимделовима Јужне Америке, великом делу Западне Европе, у Русији, Аустралији иретко у неким афричким земљама. Велика је вероватноћа да је узрочник присутани у неким другим земљама али тренутно нису доступне информације.У превенцији се користи добра зоохигијенска пракса и вакцинација. Додеведесетих се користилo два типа вакцина: хетерологна, припремљена од223

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYSвируса Шоповог фиброма, и хомологне, припремљене од атенуираних сојева МВ,а од скоро рекомбинанта вакцина против миксоматозе и хеморагичне болестикунића. У нашој земљи од 1983. г. оба производна завода (ВЗ Земун и ВЗСуботица) производили су живу лиофилизовану вакцину против миксоматозе одатенураног хомологног вируса. У ВЗЗ Земун за 26 година производње укупно јепроизведено 2,013.967 доза вакцине што просечно износи 77.460 доза/години.Због нових законских пропииса и процене новог власника ВЗЗ да се економски неисплати продужење регистрације и нова регистрација по Закону о лековима имедицинским средствима производња вакцине је престала 2009. године штопредставља велики проблем како за одгајиваче тако и за љубитеље/власникекунића. Можда је решење да се вакцина производи као „шталска― вакцина,односно по прeпоруци ЕМЕА CVMP – Guideline on data requirements forimmunological veterinary medical product for minor use or minor species /limitedmarcets /London 25. July 2008.* Рад финансиран од стране Министарства просвете, науке и технолошког развоја(Пројекат ТР37015)Кључне речи: миксоматоза, Myxoma вирус, кунићаДр вет. мед Јован Марић, истраживач приправник, Факултет ветеринарске медицине, Универзитет уБеограду, Булевар Ослобођења 18, jovan_vet@yahoo.com; Др сц. Никола Кнежевић, научни сарадник,Ветеринарски завод Земун а.д., Београд, Батајнички друм 4, Земун; Вет. спец. Милијана Нешковић,Ветеринарски специјалистички институт „Зајечар―, Изворски пут бб, Зајечар; DVM Lubos Korytar, TheUniversity of Veterinary Medicine and Pharmacy in Kosice, Komenskeho 73, Slovakia224

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕEPIZOOTIOLOGICAL SITUATION OF RABIES IN THE MUNICIPALITYLOZNICA -IMPORTANCE OF SHELTER FOR NON-OWNER DOGS INLOZNICAĐurić Ljubica, Elezović Radovanović Milica, Prokić Nataša, Pavlović V.Introduction: Rabies is a viral disease caused by neurotrophic virus of the fam.Rhabdoviridae, genus Lissavirus. Belongs to a group of zoonoses and from reservoirspecies in the wild is usually transmitted to humans through dogs and cats. Rabies isregistered on each continent in a greater or fewer numbers of cases. In Europe, rabies ispresent in the eastern part, while in Western Europe is largely eradicated. In ourcountry, disease is constantly present for a long time, with dominant sylvatic form. Atthe same time, due to irresponsible ownership, increases abandonment of pets, whichresults in a mass occurrence of stray dogs and cats, as well as the population that isoutside the control of health care.Given the current epizootic picture of rabies in Serbia, as well as in the municipality ofLoznica, a large number of stray dogs are epizootiologically problem and the danger ofthe spread of rabies in an urban environment.Aim: The aim of this paper is to present epizootic images of rabies in the municipalityof Loznica and in the municipalities with which Loznica borders; also, it presents workof shelters for stray dogs in Loznica and their role in solving the problems of non-ownerdogs that have potential links to transmit rabies.Materials and Methods: materials - data of Veterinary Station "Loznica" related to thevaccination program and marking of owner dogs and cats, data on care, immunization andlabeling of stray dogs; epizootiolocigal diaries of the Veterinary inspection in Loznica, data ofVeterinary Specialist Institute "Sabac" about number of issued rabies vaccines.Results: In the area of Loznica during the period 2007-2010. were registered 6 cases ofrabies in foxes, while in dogs during the same period there was no recorded cases ofrabies. The total number of dogs and cats vaccinated against rabies during this periodwas 20,386 dogs, with it that the number of vaccinated animals from year to year in theobserved period was increasing. Since January of 2010. year there were no cases ofrabies in the municipality of Loznica. In order to reduce the large number of stray dogsin the municipality of Loznica, in 2009. was built a shelter for dogs in which until theend of 2012. were housed 626 dogs. All dogs are marked with microchip, entered into acentral database, vaccinated against rabies, neutered and treated against parasites. Mostof these dogs were adopted.Conclusion: Epizootiological situation of rabies in the area of Loznica is in correlationwith rabies epizootic situation on the territory of Serbia. Building a shelter for straydogs in Loznica gave good results, because it has been removed a large number of dogsfrom the streets, that solved the problem of rabies control in this territory.Key words: rabies, dogs, shelterDVM Spec. Djuric Ljubica, DVM Pavlovic Vladimir, Veterinary station „Loznica―, Marka Radulovica bb,Loznica, ljubica.djuric@rocketmail.com; DVM Elezovic Radovanovic Milica, research assistant, DVMProkic Natasa, research assistant, Faculty of veterinary medicine, Bul. Oslobodjenja 18, Belgrade, Serbia225

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYSЕПИЗООТИОЛОШКА СЛИКА БЕСНИЛА НА ТЕРИТОРИЈИ ОПШТИНЕЛОЗНИЦА-ЗНАЧАЈ ПРИХВАТИЛИШТА ЗА НАПУШТЕНЕ ПСЕ УЛОЗНИЦИЂурић Љубица, Елезовић Радовановић Милица, Прокић Наташа, Павловић В.Увод: Беснило (Rabies) је болест вирусне етиологије коју изазива неуротропнивирус из фамилије Rhabdoviridae, род Lissavirus. Припада групи зооноза и одрезервоарних врста у природи најчешће се преноси на човека преко паса и мачака.Беснило се региструје на свим континентима у мањем или већем броју случајева.У Европи беснило је присутно у источном делу, док је у земљама западне Европеуглавном искорењено. У нашој земљи болест је константно присутна већ дугиниз година са доминантним силватичним обликом. Истовремено, збогнеодговорног власништва све чешће је напуштање кућних љубимаца, што има зарезултат масовну појаву паса и мачака луталица, као популације која је ванздравствене контроле. Имајући у виду постојећу епизоотиолошку слику беснила уСрбији, као и на територији општине Лозница, велики број паса луталицапредставља епизоотиолошки проблем и опасност од ширења вируса беснила уурбаној средини.Циљ рада: Циљ рада је приказ епизоотиолошке слике беснила на територијиопштине Лозница и на територијама општина са којима се Лозница граничи; као иприказ рада прихватилишта за напуштене псе у Лозници и улога прихватилишта урешавању проблема уличних паса који су потенцијална карика за преношењебеснила.Материјал и методе рада: Као материјал коришћени су подаци Ветеринарскестанице „Лозница― везани за програм вакцинације и обележавања власничкихпаса и мачака; подаци о збрињавању, вакцинацији и обележавању паса луталица;епизоотиолошки дневници Ветеринарске инспекције у Лозници; подациВетеринарског специјалистичког института „Шабац― о броју издатих вакцинапротив беснила.Резултати рада: На подручју општине Лозница је у периоду од 2007-2010. годинерегистровано 6 случајева беснила код лисица, док код паса у току истог периоданије било регистрованих случајева беснила. Укупан број вакцинисаних паса имачака против беснила у овом периоду је био 20.386 паса, с тим што је бројвакцинисаних животиња из године у годину током посматраног периода био свевећи. Од јануара 2010. године није забележен ниједан случај беснила натериторији општине Лозница. Ради смањивања великог броја паса луталица натериторији општине Лозница 2009.године је изграђено прихватилиште за псе укоме је до краја 2012.године збринуто 626 паса. Сви пси су обележенимикрочипом, убачени у Централну базу података, вакцинисани против беснила,стерилисани и третирани против паразита. Највећи број ових паса је удомљен.226

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕЗакључак: Епизоотиолошка слика беснила на подручју општине Лозница пратиепизоотиолошку слику беснила на територији целе Србије. Изградњаприхватилишта за напуштене псе у Лозници је дала добре резултате јер је саулица склоњен велики број паса и тиме решен проблем контроле беснила на овојтериторији.Кључне речи: беснило, пси, прихватилиштеДр вет. мед. спец. Ђурић Љубица, Др вет. мед. Павловић Владимир, Ветеринарска станица―Лозница―,ljubica.djuric@rocketmail.com, Др вет. мед. Елезовић Радовановић Милица, истраживач приправник,ДВМ Прокић Наташа, истраживач приправник, Факултет ветеринарске медицине, Булевар ослобођења18, Београд227

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYSROLE OF ZOOHYGIENIC SERVICE PUC "KOMUNALIJE" - SREMSKAMITROVICA IN PREVENTING OF SPREAD, CONTROL ANDERADICATION RABIES AND OTHER ZOONOSES IN STRAY DOGSĈupić S., Draganović N., Ćirić S., Vukelić Olivera, Marić Ј., Ristanović VesnaAbstractThe local government is by the city's decision entrusted the following tasks to sector of" Animal hygiene" the PUC "Komunalije" Sremska Mitrovica: capture, transport and care of abandoned and lost dogs in the shelter for strayanimals; transport animal carcasses from public areas; control and reduction population of stray dogs and cats.Sector "Animal hygiene" of the PUC "Komunalije", Sremska Mitrovica and Departmentof infectious animal diseases and bees diseases (Faculty of Veterinary Medicine,University of Belgrade), have signed a decision on scientific cooperation. Obtainedresults are processed with in the project of Ministry of Education, Science andTechnological Development, No.37015, "Environmental and virological investigationsof emeriging zoonozis in in Republic Serbia nature reserves".PUC "Komunalije" Sremska Mitrovica sector of "Animal hygiene" is in accordancewith the decision of the scientific cooperation required to provide a sufficient number ofsamples from stray dogs, blood sera that will be used for the identification of potentiallyzoonotic disease present in the city of Sremska Mitrovica.The aim of this cooperation is to prevent spread, control and eradication present diseaseand in the first place rabies in stray dogs, and other zoonosis in order to protect thehealth of people.It is necessary to continuously control stray dogs through programs envisaged by thedecision of the city and scientific - research cooperation.Key words: stray dogs, scientific and research cooperation, local governmentDr vet. med. Srećko Ĉupić, Dipl. engineer. noise. Ristanović Vesna, PC " Komunalije ", Sremska Mitrovica,sreckocupic@yahoo.com,; Dr vet. med. Nebojša Draganović, City Sremska Mitrovica; Dr vet. med. ĆirićSava, Republican veterinary inspection, Sremska Mitrovica district; Dr vet. med. Olivera Vukelić, Ministry ofAgriculture, Forestry and Water Management of the Republic of Serbia, Veterinary, Belgrade; Dr vet. med.Jovan Marić, Research Assistant, Department of Infectious Diseases, Faculty of Veterinary Medicine, Bulevaroslobpdenja 18, Belgrade228

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕУЛОГА ЗООХИГИЈЕНСКЕ СЛУЖБЕ ЈКП „КОМУНАЛИЈЕ“ – СРЕМСКАМИТРОВИЦА У СПРЕЧАВАЊУ ШИРЕЊА, СУЗБИЈАЊУ ИИСКОРЕЊИВАЊУ ЗАРАЗНЕ БОЛЕСТИ БЕСНИЛА И ДРУГИХ ЗООНОЗАКОД ПАСА ЛУТАЛИЦАЧупић С., Драгановић Н., Ћирић С., Вукелић Оливера, Марић Ј., РистановићВеснаКратак садржајЛокална самоуправа је градском одлуком сектору ―Зоохигијена― при ЈКП„Комуналије― Сремска Митровица поверила следеће послове: хватање, превоз и збрињавање напуштених и изгубљених паса луталица уприхватилиште за животиње; транспорт лешева животиња са јавних површина; контролу и смањење популације напуштених паса и мачака.Сектор „Зоохигијена― при ЈКП „Комуналије―, Сремска Митровица и Катедра зазаразне болести животиња и болести пчела (Факултет ветеринарске медицине,Универзитет у Београду), су потписали одлуку о научној сарадњи. Добијенирезултати се обрађују у оквиру пројекта Министарства за науку и технолошкиразвој, бр.37015, „Еколошка и вирусолошка истраживања присуства емеригингзооноза у резерватима природе Републике Србије―.ЈКП „Комуналије― Сремска Митровица, сектор „Зоохигијена― је у складу саодлуком о научној сарадњи у обавези да обезбеди довољан број узорака од пасалуталица, односно крвих серума који ће послужити за идентификацијупотенцијално присутних зооноза на територији града Сремска Митровица.Циљ ове сарадње је спречавање ширења, сузбијање и искорењивање присутнихобољења, на првом месту беснила код паса луталица, али и других зооноза у циљуздравствене заштите људи.Неопходно је у континуитету вршити контролу паса луталица и њиховогздравственог стања кроз програме предвиђене градском одлуком и научноистраживачкомсарадњом.Кључне речи: пси луталице, научно-истраживачка сарадња, локална самоуправаДр вет. мед. Срећко Чупић, Дипл. инж. шум. Ристановић Весна, ЈКП „Комуналије―, СремскаМитровица, sreckocupic@yahoo.com; Др вет. мед. Небојша Драгановић, Град Сремска Митровица; Дрвет. мед. Сава Ћирић, Републичка ветеринарска инспекција, округ Сремска Митровица; Др вет. мед.Оливера Вукелић, Министарство пољопривреде, шумарства и водопривреде Републике Србије, Управаза ветерину, Београд; Др вет. мед. Јован Марић, истраживач приправник, Катедра за заразне болести,Факултет ветеринарске медицине, Булевар ослобођења 18, Београд229

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYS230QUARANTINE OF SEMEN AND SPERM IN DOMESTIC ANIMALS -EPOZOOTIOLOGICAL SIGNIFICANCEProkić Nataša, Milovanović A., Barna T., Rogoţarski D.ApstractQuarantine is anti-epidemic measure which serves to isolate and monitor people,animals, products and raw materials from animals as well as objects that are suspectedto be infected with causative agents of especially dangerous infectious diseases.The need for the implementation of quarantine, which serves as a measure of generalprophylaxis, aims to prevent the introduction of disease to uninfected territory.Otherwise, it may cause health and economic damage with huge consequences for thelivestock of a country, and which is of particular importance, many of these diseases arealso zoonoses and therefore pose a threat to humans.Sperm and semen of domestic animals intended for artificial insemination (AI)nowadays are mass produced, mostly in artificial insemination centers, as well as onlarge farms. In our country, apart from domestic semen production it's more usedimported semen of all domestic animals, especially of bulls and boars. Knowing thatthere are a huge number of micro-organisms, potential causes of various diseases, whichcan be found in the sperm/semen, there is a need for particular attention to diseases thatcan be transmitted in this way. With epizootic aspect, this means that artificialinsemination is of great importance in the prevention and eradication of venereal andother diseases, because with the control of semen and timely detection of pathogens init, may take all necessary measures to prevent the disease.Quarantine system of sperm and semen is done in most countries of the world and inour country also. Quarantine inspection includes several methods of laboratory testing -macroscopic, microscopic, bacteriological, virological and toxicological testing. Onlyafter complex analysis that must be done quickly and obtaining of favorable test results,the semen can be released into the market.The aim of this paper is to highlight the epizootiological importance of conductingquarantine for male breeding animals from which semen is taken, also for importedsemen that is used in the artificial insemination of farm animals. In this paper specialemphasis was given on diseases that can be transmitted through the semen of bulls andboars, as well as current domestic and European legislation relating to this issue.Key words: quarantine, sperm, domestic animalsDr vet. med. Nataša Prokić, research assistant, Department Faculty of veterinary medicine, Bul. Oslobodjenja18, Belgrade, Serbia; Mr Aleksandar Milovanović, Senior Expert Assistant, dipl. vet. spec. Tomislav Barna,Senior Expert Assistant, Department for reproduction, „NIV― Novi Sad, Rumenaĉki put 20, Novi Sad;DrRogoţarski Dragan vet.spec., Head of Sector for animal health care, „VSI-Poţarevac―, Dunavska 89,PoţarevacIntroduction - Quarantine is anti-epidemic measure and measure of generalprophylaxis, which prevents introduction of causative agents of extremely dangerouscontagious diseases into new territory. The term "quarantine" was created in the 15th

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕcentury and comes from the Italian word "Quaranta" / forty / because at that timequarantine was 40 days long.The introduction of infectious agents into the territory of one country is likely to happenby accident and during the importing of: livestock and wild animals, animal feed, rawmaterials and animal products, biological products, then by infected transferors(arthropods), by migration of animals and birds, sick people and carriers. For entering ofcontagious diseases in the herd and on the territory of a country, infections that areclinically manifested aren't a problem. However, neither of them should not be ignoredowing to phase of incubation. There are a number of diseases in which animals areinfected and for a differently long period excretes pathogen agents into the environment,and at the same time showing no clinical signs of disease. It is supported by the fact thatmodern modes of transport (mainly air traffic) allows the transport of animals and theirproducts to any other territory for a time which is shorter than the length of incubationperiod of most infectious diseases. For similar reasons, the particular threat are thelatent infections and carriers phase. Since the presence of pathogens in all of thesesituations can be detected only by bacteriological and virological tests, they should beperformed under conditions of quarantine and immediately after arrival of the delivery.Only after obtaining a favorable result, shipments should be sent to the final destination.The biggest risk for the introduction of quarantine diseases pathogens in our country isrelated to the imports of ruminants and pigs (live animals, semen, raw materials, etc.)with respect to livestock industry development (4, 11). Before importing it is necessaryto do epizootic analysis of the country from which they are imported, as well as itsenvironment. Also in the requirement for import animals should demands that theycome from herds that are free from infectious diseases that are registered in theexporting country (3). An important role is played by veterinarians-epizootiologistswho, on the basis of their knowledge of the global epizootic situation of one countryand the region, will select and supervise imported animals and their products.Monitoring is carried out daily during quarantine, and includes clinical examination ofthe living animal and laboratory testing of blood samples, semen, raw materials, animalproducts, animal feed, etc.. with the aim of preventing occurrence and spreading ofdisease (4, 11).The legislation that regulate AI centers and import of semen and animals in ourcountry and in the European UnionAs everywhere in the world, same in our country, the issue of reproduction of domesticanimals, artificial insemination, production and storage of semen for artificialinsemination and fertilized oocytes is regulated by several laws, regulations and otherby-laws.Law of the measures for a improvement of livestock defines that semen and fertilizedova as well as breeding stock originating from imports, can be used only if theirproductivity traits are better than local and consent to their use in reproduction isprovided by the Ministry, who made the desicion based on the the council opinion .Article 30. of this law deals with conditions of placing on the market semen for artificialinsemination (13).Law on for Animal Health Care explains the measures for prevention, detection, controland eradication of infectious diseases. Also, the law provides that imported animals and231

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYSsemen for artificial insemination, importer after importation need to keep in quarantinefor examination. In addition, the place of quarantine, the type of diagnostic testing,public veterinary service which will perform testing, or the company that will performthe treatment in quarantine determines the Ministry responsible for veterinary medicine(14).Rulebook of the conditions and duration of quarantine for imported animals determinesthat quarantine for imported semen for artificial insemination and fertilized ova lastsuntil the end of the ordered diagnostic testing, but no longer than 21 days. There is apossibility to extend the quarantine on the basis of laboratory test, when there is asuspicion or proof for the presence of pathogenic microorganisms in the test material(7).According to Article 51. of the Veterinary Law was passed the current Rulebook ofestablishing programs of animal health protection measures for 2012. year. Rulebookprovides that all bulls in artificial insemination centres, as well as breeding bulls usedfor natural service, need to be tested twice a year for brucellosis, tuberculosis (TBC),enzootic bovine leukosis, campylobacteriosis, trichomoniasis, bovine viral diarrhea(BVD), infectious bovine rhinotracheitis and infectious pustular vulvovaginitis(IBR/IPV) and leptospirosis. Also, necessarily is to examine semen twice a year forBVD, Campylobacter fetus subspecies venerealis and Trichomonas fetus, and quarterlytesting for IBR/IPV. In terms of breeding boars in centers for artificial insemination ofpigs, for diagnostic testing are subject all breeding animals twice a year, for brucellosis,tuberculosis, Aujeszky's disease, leptospirosis and PRRS (porcine reproductive andrespiratory syndrome) (8).Despite existing laws, many procedures related to handling animals and sperm, which isreceived in AI centers, as well as the conditions of their import/export to our country arenot completely well defined, but are only approximately identified. In contrast, in thelegislation of the European Union (EU), everything is very precisely defined, especiallywhen it is about imported animals, animal products, semen, embryonated ova etc.The European Union has adopted a large number of directives based on fundamentalrecommendations made by the World Organization for Animal Health (OIE). Directivesprescribe that during import of domestic animals semen from "third countries", eachshipment must be accompanied by a Certificate of health status of the animals fromwhich the semen was taken. A certificate containing all the necessary information on asent item, as well as a special section that talks about the health status of the animalsthat are sperm donors.When talking about bull semen, it is required that the country of origin of the bull whois sperm donor has a status that is free from foot-and-mouth disease and rinderpest for aperiod of at least 12 months before taking the semen and in that country shouldn‘t beimplement vaccination against these disease. Also, artificial insemination centerscontaining bulls for a semen production for export, must be free from rabies,tuberculosis, anthrax and contagious bovine pleuropneumonia in 30 days before to 30days after sperm taking (1).When talking about import of breeding cattle, they must firstbe put into quarantine for 28 days, when a zero day is the day of blood sampling. Cattleare tested for the presence of the causative agents of tuberculosis, brucellosis, enzooticbovine leukosis, blue tongue disease, IBR / IPV, BVD, Campylobacter fetus subspeciesvenerealis and Trichomonas fetus (10).232

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕBoars semen in the EU may be imported from third countries if the exporting country inthe last 12 months before taking the semen had no reported cases of foot-and-mouthdisease, classical swine fever (CSF) and African swine fever, and if in that country wasno vaccination against this diseases. AI centres that takes semen intended for exportmust have a period of 3 months before taking the sperm to the date of export, were freefrom the appearance of foot-and-mouth disease, classical swine fever, African swinefever, swine vesicular disease, vesicular stomatitis, brucellosis and Aujeszky'sdisease. This directive requires that all animals before they reach the center for semencollection and begin to exploit, they must spend a minimum 30-day in quarantine,where they are tested for brucellosis (Rose Bengal test and cELISA or iELISA) andMorbus Aujeszky's disease (ELISA) (2). Quarantine is compulsory for all boarsimported from outside of the EU territory and for its duration, the animals are examinedto: brucellosis, foot-and-mouth disease, Morbus Aujeszky, transmissible gastroenteritis(TGE), swine vesicular enteritis, African swine fever, classical swine fever and porcinereproductive and respiratory syndrome (PRRS) (10).Epizootic significance of artificial inseminationSince the early 20th century to the present day, as one of the key factors that contributedto the development of modern animal husbandry is the application of artificialinsemination (AI). In addition to fresh (native) semen insemination, in used is chilledand frozen semen. Using of the methods for short-term or long-term preservation ofsperm at the same time ensuring favorable conditions for various lengths of survival ofspermatozoa, were created equally good conditions for survival of causative agents ofinfectious diseases in semen, both viral and bacterial etiology. This means that artificialinsemination with epizootic aspect is of great importance in the prevention anderadication of venereal and other diseases. Doing control of semen and timely detectionof pathogens, may be taken all necessary measures to prevent the disease. Also, it ispossible to continuously improve the genetic characteristics of breeding animals, whichreflects zootechnical aspects of the application of artificial insemination. Comparedwith natural mating, much less males are needed to artificially inseminated the samenumber of females and produce the same number of offspring. However with theapplication of artificial insemination, there are also risks related to the potentialexpansion of genetic anomalies and cause infectious diseases among animals, bothwithin a country and outside its borders (5).Testing of semen health safety need to be carried out in two ways: by controlling of theend product or continuously by checking the health status of males in the AI centersbefore and after taking of sperm, whereby a lack of both pathogens and specificantibodies need to be determined (12). Before introducing in AI centers animals shouldbe kept in quarantine with the application of strict biosecurity measures, where wouldbe performed initial medical examinations. In this way, commercial AI centers ensuregetting the correct product-semen without the presence of specific pathogens (6). Incontrast to this method, the first listed method of testing involves the testing of semenfor the presence of pathogens, which means that the complete quality assessment isbased on just one examination, in which case the key role is sensitivity and specificityof the method used in testing (12 ). For this reason, programs that are included in testingmust be constantly improved and modified based on the latest knowledge in the field of233

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYSepidemiology, related to the pathogenesis and control of common diseases. Emergenceof new infectious diseases give rise to new challenges and risks that must be met (5).Conclusion - Keeping in mind that fresh and preserved sperm (semen) provide optimalconditions for survival of pathogenic micro-organisms, it can be said that this route oftransmission of infectious diseases from the point of epizootiology is very important.Therefore it is important that in each country exists continuous and detailed control ofthe health status of animals used for breeding, as well as products that come from them.A large role in this have legislation that should define in details all proceedings duringmanipulation with live animals and their products. However, in our country, the currentlegislation relating to the issue of semen for insemination of farm animals, as fresh andchilled/frozen semen and fertilized ova, is just in tenet compatible with Europeanregulations (4). It is necessary to harmonize the existing and if necessary, adopt newregulations modeled on Directives from the European Union, which are based on therules set by the OIE. Only with respecting of uniform evaluation system of livestocksemen quality, Serbia can provide a good genetic potential of farm animals and theimprovement in livestock production.AcknowledgementsThis paper was supported by grant TR37015 from Serbian Ministry of Education, Science andTechnological DevelopmenLiterature1. Council Directive 88/407/EEC laying down the animal health requirementsapplicable to intra- Community trade in and imports of deep-frozen semen ofdomestic animals of the bovine species, 1988, OJ L 194, p10–232. Došen R., Lalić M., Prodanov Jasna, Gagrĉin M., Orlić D., 2002. Najĉešćazdravstvena problematika u karantinima i prometu svinja u Vojvodini, Vet.Glasnik 56 (3-4) p219-253. Đuriĉić Bosiljka, Trkulja R., Radojiĉić Sonja, Radenković-Damjanović Brana,Subotin L., 2001. Karantin i karantinske bolesti i njihov znaĉaj u epizootiologijizaraznih bolesti domaćih ţivotinja, Zbornik nauĉnih radova Instituta PKBAgroekonomik, vol. 7, No.1, p317-27;4. Eaglesome M.D. & Garcia M.M., 1997. Disease risks to animal health fromartificial insemination with bovine semen, Rev. sci. tech. Off. int. Epiz., 16 (1),p215-2255. Maes D., Nauwynck H., Rijsselaere T., Mateusen B., Vyt P., De Kruif A., VanSoom A., 2008., Diseases in swine transmitted by artificial insemination: Anoverview, Theriogenology, vol. 70, p1337–456. Pravilnik o uslovima i trajanju karantina za uvezene ţivotinje, „Sluţbeni listSFRJ―, br.6/88, 19887. Pravilnik o utvrĊivanju programa mera zdravstvene zaštite ţivotinja za 2012.godinu „Sluţbeni glasnik RS―br. 21/12, 20128. Pravilnik o utvrĊivanju programa mera zdravstvene zaštite ţivotinja za 2012.godinu „Sluţbeni glasnik RS―br. 21/12, 20129. Terrestrial animal health code, 2012, 21 st edition, World Organisation for AnimalHealth (OIE), Paris, France234

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕ10. Trkulja Rodoljub, 1999. Epizootiološki znaĉaj i metode laboratorijskog ispitivanjaduboko zamrznutog semena bikova za vreme karantina, magistarska teza, Fakultetveterinarske medicine, Katedra za preventivnu veterinarsku medicinu, zaraznebolesti ţivotinja i bolesti pĉela, Beograd11. Wentinka G.H., Frankenab K., Boscha J.C., Vandehoeka J.E.D., Th. Van denBerga, 2000., Prevention of disease transmission by semen in cattle, LivestockProduction Science 62, p207–22012. Zakon o merama za unapreĎenje stočarstva „Sl. Glasnik Republike Srbije―, br.61/91, 1991.13. Zakon o zdravstvenoj zaštiti ţivotinja „Sl. Glasnik Republike Srbije―br.37/91,1991КАРАНТИН СЕМЕНА И СПЕРМЕ ДОМАЋИХ ЖИВОТИЊА –ЕПИЗООТИОЛОШКИ ЗНАЧАЈПрокић Наташа, Миловановић А., Барна Т., Рогожарски Д.Кратак садржајКарантин је противепидемијска мера којом се на одређено време изолују инадзиру особе, животиње, производи и сировине од животиња, као и предмети закоје се сумња да су инфицирани узрочницима нарочито опасних заразнихболести.Потреба за спровођењем карантина, који служи као мера опште профилаксе, имаза циљ да спречи уношење болести на незаражену територију. У супротном, могунастати здравствене и економске штете са огромним последицама по сточни фондједне земље, а што је од посебног значаја, велики број ових болести суистовремено и зоонозе, па самим тим представљају опасност и за људе.Сперма односно семе домаћих животиња намењено за вештачко осемењавање се уданашње време масовно производи и то најчешће у центрима за вештачкоосемењавање, као и на великим фармама. У нашој земљи се осим семена домаћепроизводње много више користи увозно семе свих домаћих животиња, а нарочитобикова и нерастова. Знајући да постоји огроман број микроорганизама,потенцијалних узрочника разних обољења, који се могу наћи у сперми/семену,јавља се и потреба за посвећивањем посебне пажње болестима које се могупренети на овај начин. Са епизоотиолошког аспекта, то значи да вештачкоосемењавање има изузетан значај у сузбијању и искорењивању полних и другихзаразних болести, јер се контролом семена и правовременим откривањемпатогена, могу предузети све неопходне мере како не би дошло до појаве болести.Систем карантинирања семена и сперме врши се како у већини земаља света, такои код нас. Карантински преглед обухвата неколико метода лабораторијскогиспитивања – макроскопско, микроскопско, бактериолошко, вирусолошко итоксиколошко испитивање. Тек након комплексних анализа,које се морају радитибрзо и добијања повољних резултата испитивања, семе се пушта у промет.Циљ овог рада је да укаже на епизоотиолошки значај спровођења карантина замушке приплодне животиње од којих се узима сперма, као и за увозно семе које235

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYSсе користи у вештачком осемењавању домаћих животиња. У раду је посебанакценат стављен на болести које се могу пренети путем сперме бикова инерастова, а обрађени су и актуелни домаћи и европски законски прописи који сеодносе на ову проблематику.Кључне речи: карантин, сперма, домаће животињеДр вет. мед. Наташа Прокић, истраживач приправник, Катедра за заразне болести животиња и болестипчела, Факултет ветеринарске медицине, Булевар Ослобођења 18, Београд;; Мр АлександарМиловановић, виши стручни сарадник, дипл. вет. спец. Томислав Барна, виши стручни сарадник,Одељење за репродукцију, „НИВ― Нови Сад, Руменачки пут 20, Нови Сад;; Др Рогожарски Драганвет.спец., Руководилац сектора за здравствену жаштиту животиња, „ВСИ-Пожаревац―, Дунавска 89,Пожаревац236

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕPARASITES FAUNA OF SHEEP AT NEW ESTABLISHED FARM INHABITWITH SHEEPS ORIGINATED FROM WARIOS AREA IN SERBIAStokić Nikolić Slavonka, Pavlović I., Dobrosavljević I., Ilić Z.AbstractPasture way of breeding enable to sheep great posibility to infection with intermediatehost, larvae and eggs of helminths. In case when the confound animals originated fromwarios area we had a posibility to cros infection especially during greasing season-Those case we had at one new established farm formed of animals from warious districtof Serbia. During parasitological examination of that flock performed during winterperiod we established presence of coccidia E.ovinoidalis (E.nina-kohl-yakimovae),E.ashata, E.parva and E.ovina, helminths Moniesia expansa, Skrjabinema ovis,Oesophagostomum spp. and metacercarija of Fasciola hepatica.Key words: sheep, gastrointestinal helminths, coccidiosisSlavonka Stokić Nikolić,BSc,DVM, Ivan Dobrosavljević, PhD,MSc,DVM,research assistant, VeterinaryInstitute Poţerevac; 2 Ivan Pavlović, PhD,MSc,DVM,scientific advisor, Scientific Veterinary Institute ofSerbia, Belgrade; Zoran Ilić, DVM, Veterinary Station Homolje Vet, ŢagubicaIntroduction - Sheeps play important role in Serbia in providing animal protein for dietespecially for those people who live in the vilage. They are usually kept under extensiveconditions and graze or brows on any land that is not being cultivated. Aftherharvesting, the animals are turned onto wheat and barley stubble from which theyobtained nourisment. Way of breeding usually at sheep breeding had prerequisite to alot of infections including parasitoses. Pasture breeding make possible contact withinanimals and eggs, larvae stages and intermediate host of parasites. Those induce thatthere are no one sheep without parasites.At one farm at Braniĉevo district was formed flock of sheep originated from variousarea in Serbia. Sheep originated with various parts of country had a difference in itsparasites fauna. Established herd, brought with them their parasite so that thecohabitation possibility of cross infection caused by parasites. This interaction waspresent of our examination.Material and methods - During study we collected fecal samples at monthly intervals.A total of 40 fecal samples were analyzed using standard coprological techniquesDetermination of adult helminthes and eggs and oocysts of parasites were done by keysgiven by Euzeby (1981) and Pavlović and AnĊelić-Buzadţić (2010).Results and discusion - During parasitological examination of that flock we establishedpresence of coccidia E.ovinoidalis (E.nina-kohl-yakimovae), E.ashata, E.parva andE.ovina, helminths Moniesia expansa, Skrjabinema ovis, Oesophagostomum spp. andmetacercarija of Fasciola hepatica (picture 1.)237

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYS238Picture 1. Metacercaria of Fasciola hepaticaExamination were performed during winter period when the animals are in stable andwhere the coccidiosis normaly occured. At same time helminth species were in latentform of infection and we not excretion of its eggs by faeces.Examination were performed during winter period when the animals are in stable andwhere the coccidiosis normaly occured. Occured coccidia species are usualy find atsheep in Serbia. Most pathogen species are E.ovinoidalis (E.nina-kohl-yakimovae),followed E.parva by and E.ovina. Coccidia are everywhere; it is nearly impossible tofind a sheep without some coccidia. However, the presence of coccidia in the intestinesof an individual does not mean the animal is actually suffering from coccidiosis.Coccidia only cause disease when their numbers become so great that pathologicaldamage is done to the host. Usually poor management is the reason why coccidianumbers increase excessively; thus, coccidiosis may be considered a man-made disease.The parasite causing Coccidiosis is passed through fecal to oral contact. While adultsheep can contract Coccidiosis (particularly does that have recently lamb their bodiesare under stress from the demands of nursing multiple lambs), young lambs immatureimmune systems make them susceptible to this disease.At same time helminth species were in latent form of infection and we not excretion ofits eggs by faeces. Display of some parasites species depended of geographicalconditions, vegetation and hidrobiological term in same part of district. At flat andmoisture plain of district liver fluke infection is predominant Fasciola hepatica, but inthe higher plain most prevalent infection caused by Dicrocoelium dendriticum.Moniezia infections were seen mainly in young animals, at all parts of Serbia.Usually in Serbia, most prevalence species of nematode are Trichostrongylus andOesophagostomumspecies. Although most of the gastro-intestinal species appear tofollow this general pattern of seasonal distribution, some variations in intensively and

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕduration of these characteristics with different worm species occurred. Thus withOesophagostomum species infection at mature sheep the spring peak was morepronounced that the autumn infection. This is a main reason why we occuredOesophagostomum spp. during our examination. Occurrence of eggs of othergastrointestinal helminth species we may be found at spring time, when the animal go topasture and when the start the biological circle of that parasites. During examination ofseason distribution of gastrointestinal helminths of sheep in various parts of Serbiaestablished that the first occurrence of Skrjabinema ovis we had in June andOesophagostomum spp.in July and that those species had a permanent presence in sheepfaeces during winter time.Conclusion - Completely pictur of parasites fauna of goats helmint at examined farmswe had a during greasing seasons when we had a „spring rise―phenomen, when theexcretion of helminth eggs are permanent and had a specifical season distributiondepending of helminth species.References1. Abdirahman, O.M., Abdi,B.H., Ahmed,M.H., Elmi,L.M. 1989. Pathological findings inthe liver of sheep and goats in Somalia, Bolletino Scientifico della Facolta dio M Zujo.Zootecnia e Veterinaria Universiteta Nozionale Somalia 8, 39-432. Bahgat A.M., Nagi A.A., El-Mashad A. (1988): Pathological studies on same parasiticlesions in the liver of sheep. Egyptian Journal of Comparative Pathology and Clinicaltand number of Pathology 1, 1-11.3. Euzeby J. 1981. Diagnostic experimental de helminthoses animals", ITVC, Paris.4. Jovanović, D., Ilić, G., Nešić, D., Pavlović, I., Valter, D. 1991. Parasitoses of sheep inTimok district during 1986-1989. Proceeding of 1 th Internationaln Summer Conferencefor Advancement of Sheep and Goat Production, Ohrid, Macedonia, 383-385.5. Jemli, M.H., Rhimi, J., Jdidi, A., Mastouri, L. (1991): Fasciolosis in sheep in theSejnane region of Northern Tunisia. Revue de la Medicine Veterinaire 142, 229-235.6. Karanfilovski, G. 1991. Stete od parazita u ovcarstvu, Pljevlja, 125pp.7. Lepojev, O. 1970. Helminti ovaca sa podruĉja Homolja i mere za njiihovo suzbijanje.Veterinarski glasnik, 12, 1001-1015.8. Pavlovic,D. 1975. Uloga razliĉcitih starosnih kategorija ovaca u kontaminaciji pasnjakai odrzavanju i sirenju infekcija zeludacno-crevnim stronrgilidama tokom godine naplaninskim pasnjacima Sare. Veterinarski glasnik 2, 127-135.9. Pavlović,I., Kulišić,Z., Nešić,D., Romanić,S. 1995. Endoparasites of sheep and goats inPrizren district. Proceedeing of 3 rd International Conference of Sheep and GoatsProduction, Ohrid, Macedonia, 106-11010. Pavlović, I., Jakić-Dimić, D., Ivanović, S., Ţujović, M. 2003 a. The effect of parasiticinfection on sheep body weight. Biotechnology in Animal Husbandry 19,145-14811. Pavlovic, I., Ivanovic S., Zujovic, M. 2003 b. Moniezioza ovaca na podruĉjuDimitrovgrada. Zbomik referata simpozijuma V epizootioloski dani sa medunarodnimucecem, Subotica, 140-142.12. Pavlovic, I., Savić B., Ivetić V., Radanović O., Ţutić M., Jakić-Dimić D., Bojkovski J.(2009) The effect of parasitic infections to production results of sheep Proceeding of IVBalkan Conference of Animal Science BALNIMALCON 2009, Challanges of theBalkan Animal industry and the Role of science and Cooperation, 14-16.5.2009. StaraZagora, Bulgaria, 389-391239

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYS13. Skernan, K.P., Hillard, J.J. 1966. A Handbook for Studies of Helminths parasites ofruminants. Near East Animal Health Istutute Handbook, FAO, Beirut, Lebanon.14. Vujić, B., Antić, N. (1958): Prilog poznavanju steta od subklinickih parazitoza ovaca,Veterinarskl glasnik 8, 604-609.AcknowledgmentPaper is accomplished as a part of scientific and technological project BT 31053 of theMinistry of Education, Science and Technical Development of Republic of SerbiaПРИКАЗ ПАРАЗИТСКЕ ФАУНЕ НА НОВОФОРМИРАНОЈ ФАРМИОВАЦА ПУЊЕНОЈ СА РАЗЛИЧИТИХ ПОДРУЧЈА ТЕРИТОРИЈЕ СРБИЈЕСтокић Николић Славонка, Павловић И., Добросављевић И., Илић З.Кратак садржајПашни начин исхране омогућава овцама сталан контакт са прелазнимдомаћинима, јајима и ларвеним облицима паразита, тако да не постоји овца којаније инфицирана макар једном паразитском врстом. Мешањем животиња изразличитих подручја долази до могуће унакрсне инфекције која ће уследититоком пашне сезоне, када почне секреција јаја парзита и контаминација пашњака.Овај случај имамо на једној фарми оваца која је формирана од животињапореклом из стада из више региона у Србији. Прелиминарним истраживањемрађено током зимских месеци устанивљено присуство ооцисти E.ovinoidalis(E.nina-kohl-yakimovae), E.ashata, E.parva и E.ovиna и јаја Monиesиa expansa,Skrjabиnema ovиs, Oesophagostomum spp. и метацеркарије Fascиola hepatиca наприсутним влатима сена које се налазилу уз изметКључне речи: овце, желудачно-цревни паразити, кокцидиједр вет.мед. Славонка Стокић Николић, вет.спец., Др Иван Добросављевић, истраживач сарадник, ВСИПожаревац, Пожаревац; Др Иван Павловић,научни саветник Научни институт за ветеринарствоСрбије, Београд; др вет.мед. Зоран Илић, Ветеринарска Станица Хомоље вет, Жагубица240

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕPARASITES FAUNA OF GOATS AT NEW ESTABLISHED FARM INHABITWITH GOATS ORIGINATED FROM WARIOS AREA IN SERBIAPavlović I., Stokić Nikolić Slavonka, Dobrosavljević I., Ilić Z.AbstractGoats production at last decade had revitalisation in Serbia. After Now we had anumerous of small flocks with tendence to formed a larga aglomerationa and intensiveproduction.From these reason at one farm at Braniĉevo district were formed flock of goatoriginated from warious area in Serbia. Cohabitation with these animals enable crosparasites infection betwen animals.During parasitological examination of that flock we established presence of coccidiaEimeria hirchi and E.nina-kohl-yakimovae and helminths Moniesia expansa,Oesophagostomum spp. and Dicrocelium dendriticum.Examination were performed during winter period when the animals are in stable andwhere the coccidiosis normaly occured. Completely pictur of parasites fauna of helmintwe had a during greasing seasons - „spring rise―phenomen, when the excretion ofhelminth eggs are permanent and had a specifical season distribution depending ofhelminth species.Key words: goats, gastrointestinal helminths, coccidiosisIvan Pavlović, PhD,MSc,DVM,scientific advisor, Scientific Veterinary Institute of Serbia, Belgrade; SlavonkaStokić Nikolić,BSc,DVM, Ivan Dobrosavljević, PhD,MSc,DVM,research assistant, Veterinary InstitutePoţerevac; Zoran Ilić, DVM, Veterinary Station Homolje Vet, Ţagubica241

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYSПРИКАЗ ПАРАЗИТСКЕ ФАУНЕ НА НОВОФОРМИРАНОЈ ФАРМИ КОЗАПУЊЕНОЈ СА РАЗЛИЧИТИХ ПОДРУЧЈА ТЕРИТОРИЈЕ СРБИЈЕПавловић И., Стокић Николић Славонка, Добросављевић И., Илић З.Кратак садржајКозарска производња тек задње деценије доживљава своју ревитализацију натериторији Србије. После више од пола века систематског истребљења коза оне суконачно доживеле рехабилитацију крајем прошлог века када се прво скромно аонда мало агилније кренуло у занављање стада коза у појединим регионимаСрбије. Дошло је до формирања малих стада која ће послужити као нуклеус занеку већу производњу (у наредних стотинак година ако се настави овим темпом).Да би се формирала већа производна целина на једној фарми из Браничевскогокруга формирано је стадо откупом коза из различитих подручја Србије.Формирано стадо, донело је са собом своју паразитофауну тако да је укохабитацији настала могућност унакрсне инфекције паразитима.Паразитолошким прегледом новонасталог стада утврђено је присуство ооцистиEimeria hirchi и E.nina-kohl-yakimovae и јаја Moniesia expansa, Oesophagostomumspp. и Dicrocelium dendriticum. С обзиром да је преглед рађен током зимскихмесеци, нормално је да су доминирале кокцидије чија је динамика појављиванајвезана за сатјско држање. Установљене врсте хелмината су честе код коза иустановљене су код коза у више региона у Србији. Праву слику паразитофаунеовог стада имаћемо након пролетњег прегледа по изласку на пашу када отпочињетакозвни „спринг рисе― феномен – када долази до повећаног развоја адултапаразита и њихова екскреција јаја којима се контаминира пашњак. С обзиром напорекло коза које су са различитих подручја за очекивати је више врстажелудачно-цревних хелмината, што ће бити тема нашег истраживанај упредстојећем периоду.Кључне речи: козе, желудачно-цревни паразити, кокцидијеДр Иван Павловић,научни саветник Научни институт за ветеринарство Србије, Београд; спец.дрвет.мед. Славонка Стокић Николић, Др Иван Добросављевић, истраживач сарадник,Ветеринарски специјалистички институт Пожаревац, Пожаревац; ДВМ Зоран Илић, ВетеринарскаСтаница Хомоље вет, Жагубица242

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕCASE REPORT OF AMEBIASIS IN HONEY BEES COLONIES FROM ONEFARM IN WESTERN SERBIALazić M., Manić Marija *Introduction: Amebiasis is disease of adult bees caused by protozoa Malpighamoebamellificae, which is parasite of Malpighian tubules. The parasite is present in healthybees in certain number. Increased reproduction has been observed in situation whenexternal conditions are bad, or in presence of some other disease such as Nosemosis.Then a large number of amoeba cysts are produced, goes in colon and with feces inenvironment. When bees clean the hive, they ingest infected cysts from which areformed trophozoites in their guts, who moves with pseudopods to Malpighian tubules.Parasites destroys epitel and this leads to the disorder in hemolymph filtration andexcretion of harmful metabolism products. Large amount of cysts can cause obstructionof Malpighian tubules. In one bee more than 500000 cysts can be formed. Bees aregetting weak, and die in the end. Disease can cause diarrhea at infected bees. It'sconsidered that illness in not causing great damage to the bees colony.Аim: The aim of this paper is to present a case of amebiasis in bees colonies on onefarm in western Serbia.Material and methods: Samples were taken from one farm in Okletac village inWestern Serbia where 15 bees colony has died. From five beehives individual sampleshas been taken, and one collective sample from the other ten beehives. Samples wereexamined by method of native preparate under microscope magnification of 400.Results: Examination showed the presence of numerous cysts Malpighamoebamellificae in all samples. Spores of Nosema spp. weren‘t found. In all samples has beenobserved presence of a small number of Varroa destructor.Conclusion: Increase in number of bee colonies with amebiasis requires additionaltesting and the use of modern diagnostic techniques in order to determine details ofepizootiologic significance of this disease. This is supported by the fact that amebiasisin the form of mono-infection is becoming very common in our country.Key words: amebiasis, samples, microscopic examinationLazić Marko, student, DVM Manić Marija, Research Assistant, Faculty of Veterinary Medicine, Belgrade,Bulevar osloboĊenja 18, marko.lazic.ue@gmail.com243

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYSПРИКАЗ СЛУЧАЈА АМЕБОЗЕ У ПЧЕЛИЊИМ ДРУШТВИМА СА ЈЕДНОГГАЗДИНСТВА У ЗАПАДНОЈ СРБИЈИЛазић М., Maнић Марија *Увод: Амебоза је обољење одраслих пчела изазвано протоозоом Malpighamoebamellificae, која паразитира у Малпигијевим цевчицама. Узрочник је у одређеномброју присутан код здравих пчела. Појачано умножавање примећено је приделовању неповољних фактора средине, али и код појаве других обољења попутноземозе. Тада се ствара већи број циста амебе које доспевају у дебело црево ипутем фецеса се избацују у спољашњу средину. Приликом чишћења кошнице,пчеле уносе цисте из којих се у њиховом цреву стварају трофозоити који помоћупсеудоподија доспевају у Малпигијеве цевчице. Паразити уништавају епител штодоводи до поремећаја у пречишћавању хемолимфе и екскреције штетних материјаиз организма. Велики број цисти може довести до опструкције и некрозеекскреторних цевчица. У једној радилици се може образовати и до 500000инфективних цисти. Амебоза може да изазове дијареју код пчела, слабљењеотпорности и заједно са другим факторима (неповољни фактори средине,присуство других инфективних агенаса итд.) може да доведе до угинућапојединих пчела, па чак и читавог друштва. Сматра се да амебоза самостално непричињава велику штету пчелињим друштвима.Циљ: Циљ рада је приказ случаја амебозе у пчелињим друштвима на једномгаздинству у Западној Србији.Материјал и методе: Узорци пчела су прикупљени са једног газдинства у селуОклетац у Западној Србији на коме је угинуло 15 пчелињих друштава. Из петкошница је узоркован појединачан узорак, а из преосталих десет узет је збирниузорак. Узорци су прегледани методом нативног преперата на увеличањумикроскопа x400.Резултат: Прегледом је утврђено присуство великог броја цисти Malpighamoebamellificae у свим узорцима. Споре Nosema spp. нису пронађене. У свим узорцимаје запажено присуство мањег броја крпеља Varroa destructor.Закључак: На основу анамнестичких података закључили смо да је на пчелињакубило утицаја људског фактора који је допринео паду отпорности пчела услед чегаје дошло до повећаног размножавања амебе. Пoвећање броја друштава оболелиход амебозе захтева додатна испитивања и примену савремених дијагностичкихпроцедура како би се детаљније утврдио епизоотиолошки значај овог обољења.Овоме у прилог иде и чињеница да се амебоза све учесталије дијагностикује унашој земљи.Кључне речи: aмебоза, узорци, микроскопски прегледЛазић Марко, студент, ДВМ Манић Марија, истраживач приправник, Факултет ветеринарскемедицине, Универзитет у Београду, Булевар ослобођења 18, marko.lazic.ue@gmail.com244

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕIMPACT OF BIODIVERSITY CHANGES ON HUMAN HEALTHHajzler Ivana *AbstractMaintaining biodiversity underpins the stability of ecosystems, and services that theysupply to community (food, raw materials for medicines, control of disease) areessential for human health. The species diversity of intact ecosystem can protectmankind against the emergence and spread of infectious disease. Disease transmissioncycles are generally kept in equilibrium by population limiting process (acquiredimmunity, predators, food competition), but alternation of natural ecosystem throughhuman activity influences distribution and incidence of vector born diseases such asmalaria, west Nile virus, leishmaniosis, tick borne encephalitis, lyme disease, yellowfever, avian influence and many others. Causative agents of these diseases which arepresent all over the world, are protozoa, bacteria and viruses, and its‘ vectors aremosquitoes, ticks, mammals, birds. By urbanization as well as direct impact on waterand landscape, humans affect natural habitat of vectors, leading to the new ways ofdisease spreading. Pathogens mutate, adapt to new hosts, creating a highly pathogenicstrains and make it difficult the eradication of these diseases. Prevention of infectiondiseases and biodiversity conservation must be considered together. The MillenniumEcosystem Assessment (2005) revealed a need to understand the relationship betweenbiodiversity and ecosystem functioning as well as the consequences of biodiversity losson human health. Studies of this kind will certainly be given more time in the future.Key words: biodiversity, infectious disease, human healthHajzler Ivana, student, Faculty of Veterinary Medicine, University of Belgrade, Bul.oslobodjenja 18245

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYSУТИЦАЈ ПРОМЕНА БИОДИВЕРЗИТЕТА НА ЉУДСКО ЗДРАВЉЕХајзлер Ивана *Кратак садржајОчување биодиверзитета је темељ стабилности екосистема и заједници обезбеђујематерије есенцијалне за људско здравље (храну, сировине за лекове, контролуболести). Разноликост врста интактног екосистема може заштитити човечанствоод појаве и ширења инфективних болести. Начини преношења болести сууглавном у равнотежи дејством ограничавајућих фактора (стечени имунтет,предатори, компетиција за храну) али променом природног екосистема људскомактивношћу утиче се на учесталост појаве и распрострањеност инфективнихболести као што су маларија, вирус западног Нила, лајшманиоза, лајмска болест,енцефалитис изазван уједом крпеља, жута грозница, птичији грип и многе друге.Узрочници ових обољења, која су распрострањена широм света, су протозое,бактерије и вируси, а вектори комарци, крпељи, сисари, птице. Урбанизацијом,као и утицајем на воде и изглед земљишта човек утиче на природну срединувектора доводећи до формирања нових начина ширења инфекција. Узрочницимутирају, прилагођавају се новим домаћинима, стварају високо патогене сојеве иотежавају ерадикацију ових обољења. Превенција ових болести и очувањебиодиверзитета морају се заједно разматрати. Миленијумска процена екосистема(2005) показала је потребу разумевања односа између биодиверзитета ифункционисања екосистема, као и последица губитка биодиверзитета на људскоздравље. Истраживањима ове врсте свакако ће се посветити више времена убудућности.Кључне речи: биодиверзитет, заразне болести, људско здрављеХајзлер Ивана, студент, Факултет ветеринарске медицине, Универзитет у Београду, Булеварослобођења 18246

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕOCCURENCE OF PARASITE Philometra cylindracae IN FISH FROM DANUBERIVERŢivojinović Milena, Lazić Milica, Dobrosavljević I., Stokić NikolićSlavonka,Rogoţarski D., Stojiljković LJ., Ţivojinović S., Pavlović I.IntroductionPhilometra cylindracae is a nematode parasitizing the body cavites or tissues of fish.Larval stages of this worm migrate to the final resting sites in the subcutaneus tissues (fins, head and body) or body cavites of predatory fish. The migration of parasite withinthe host can result in inflammation of visceral organs, mechanical demage of bloodvessels with hemorrhaging amd destruction of skeletal joints resulting in poor growthand emaciation.AimDescription of case of parasite Philometra cylindracae from fishes in Danube river onepizootiological area of VSI Poţarevac.Material and methodsCorpses of fishes: Perch (Perca fluviatilis), Zander (Sander lucioperca), Asp (Aspiusaspius) from Danube, near setlement Ram, Veliko Gradiste (N 44º48´49.30", E21º20´03.74"). Parasitological examination.ResultsThere are no visible clinical sign of sickness, accept poor growth and emaciation ofinfected fish, depends of degree of infestation and environmental conditions. In thebody cavities and subcutaneous tissues there are juvenile or adult worms Philometracylindracae. Also, migration of parasite cause mechanical damage of blood vessels withhemorrhaging. Many nodules after dissection released long, smooth, red colored worms.This nematoda has two lifecycle, intermediate host is Copepod and predatory fish is thefinal host.ConclusionsFishes from Danube are infected with parasite Philometra cylindracae. The mainconsecquence is poor growth of sick fish. Philometra is not human health concern.Key words: parasite, Philometra cylindracae, fish, DanubeMr Milena Ţivojinović, DVM sc. Milica Lazić, Dr sci Ivan Dobrosavljević, DVM sc. Slavonka StokićNikolić, Dr sci Dragan Rogoţarski, Mr Ljubomir Stojiljković –Veterinary Institute Poţarevac, Dunavska 89,12000 Poţarevac; DVM sc. Slobodan Ţivojinović-PVA Veterinarians, Cane Babović 11, 12000 Poţarevac;Dr sci vet Ivan Pavlović, Veterinary Research Institute Belgrade Belgrade, Vojvode Toze 14, 11000 Beograd247

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYSПОЈАВА ПАРАЗИТА Philometra cylindracae КОД РИБА ИЗЛОВЉЕНИХ УДУНАВУЖивојиновић Милена, Лазић Милица, Добросављевић И., СтокићНиколићСлавонка, Рогожарски Д., Стојиљковић Љ., Живојиновић С.,Павловић И.УводPhilometra cylindracae је нематода која паразитира у телесној дупљи риба.Ларвени облик мигрира до поткожног ткива (пераја, глава и тело) или телеснојшупљини риба грабљивица. Миграција паразита у организму домаћина доводи дозапаљенских реакција у висцералним органима, крварења и механичка оштећењакрвних судова скелетног везивног ткива, што има за последицу слаб раст рибе иисцрпљеност.Велики број врста слатководних и морских риба, укључујућиСалмониде су пријемчиве.Циљ радаПриказ случаја појаве паразита Philometra cylindracae код риба изловљених уДунаву на територији епизоотиолошког подручја ВСИ Пожаревац.Материјал и методеЛешеви угинулих и жртвованих риба: Бандар (Perca fluviatilis), Смуђ (Stizostedionlucioperca), Буцов (Aspius aspius) из Дунава, код насељеног места Рам, ВеликоГрадиште (Н 44º48´49.30", Е 21º20´03.74"). Паразитолошки преглед риба.РезултатиКод оболелих риба споља нису уочене видљиве промене, осим слабијеухрањености код појединачних случајева, што је у директној зависности одстепена инвазије и услова околине. Код појединих риба је уочена надутостстомачног дела услед нагомилавања већег броја паразита у телесној дупљи.Поткожно су уочена оштећења, са хиперемјом околног ткива, настала каопоследица миграције паразита.У телесним дупљама и у поткожној регији главе и пераја изловљених риба,утврђено је присуство великог броја одраслих облика Philometra cylindracae.Уочен је већи број чворастих накупина, које приликом расецања ослобађајувелики број дугачких, глатких, кончастих, црвено обојених облика паразита.Развојни пут ове нематоде се одвија преко прелазног домаћина рачића (Cyclops).Главни домаћин су рибе месоједи, које се заражавају или конзумирањем рачићаили већ зараженим рибама. Човек није пријемчив.ЗакључакУ рибама Дунава утврдјено је присуство паразита Philometra cylindracae.Присуство овог паразита угрожава нормалан раст риба, што за последицу има248

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕзаостајање у расту. Ова нематода нема зоонозни карактер, тако да је рибазаражена овим паразитом, безбедна као намирница намењена за људску исхрану.Кључне речи: паразит, Philometra cylindracae, рибе, ДунавМр Милена Живојиновић, Вет.спец. Милица Лазић, Др сци вет Иван Добросављевић, Вет спец.Славонка Стокић Николић, Др сци вет Драган Рогожарски, Мр Љубомир Стојиљковић -ВетеринарскиСпецијалистички Институт Пожаревац, Дунавска 89, 12000 Пожаревац; Вет. спец. СлободанЖивојиновић-ПВА Ветеринари, Цане Бабовић 11, 12000 Пожаревац; Др сци вет Иван Павловић, НИВСБеоград, Војводе Тозе 14, 11000 Београд249

THIRD INTERNATIONAL EPIZOOTIOLOGY DAYS and XV SERBIAN EPIZOOTIOLOGY DAYSLeptospira Hardjo- RESULTS OF SEROLOGICAL ACTIVE SURVEILLANCECONDUCTED ON CATTLEMaric Jelena, Ilic Tanja, Brkic Z. *AbstractThe paper presents the results of active serological surveillance, during which it wassearched 3413 bovine sera for the presence of specific antibodies to Leptospirainterrogans serovar hardjo.For research purposes a commercial ELISA test has been used. The survey includedcattle with in 19 epizootic whole territory, whereas 59 animals was detected on thepresence of antibodies to Leptospira interrogans serovar hardjo.On the basis of the above, we want to point to the need for more detailed research giventhe importance of this serovar in cattle in terms of health, economic aspects and itszoonotic potential.Key words: Leptospira Hardjo, ELISA, serologyМSc Jelena Maric, spec. Tanja Ilic, Zoran Brkic DVM, PI Veterinary Institute of the Republic of Srpska;, DrVaso Butozan‖ Banja Luka, Branka Radićevića 18,78 000 Banja Luka. jelena.maric@virsvb.comLeptospira Hardjo-РЕЗУЛТАТИ АКТИВНО СПРОВЕДЕНОГ СЕРОЛОШКОГНАДЗОРА КОД ГОВЕДАМарић Јелена, Илић Тања, Бркић З. *Кратак садржајРад приказује резултате активног серолошког надзора при чему је претражено3413 серума говеда на присуство специфичних антитијела за Leptospirainterrogans serovar Hardjo.У испитивању је кориштен комерцијални ELISA тест,а обухваћена су говеда сатериторије 19 епизоотиолошких цјелина, при чему је код 59 грла детектованоприсуство антитијела за Leptospira interrogans serovar Hardjo.На основу наведеног указујемо на потребу детаљнијег истраживања обзиром наважност овог серовара код говеда у смислу здравственог, економског аспекта алии његовог зооностског потенцијала.Кључне ријечи: Leptospira Hardjo, ELISA тест, серологијаMр Јелена Марић, спец. Тања Илић, Зоран Бркић ДВМ, ЈУ Ветеринарски институт РС ;;ДР ВасоБутозан‖ Бања Лука, Бранка Радићевића 18,78 000 Бања Лука. jelena.maric@virsvb.com250

ТРЕЋИ ИНТЕРНАЦИОНАЛНИ ЕПИЗООТИОЛОШКИ ДАНИ и XV ЕПИЗООТИОЛОШКИ ДАНИ СРБИЈЕ251