You also want an ePaper? Increase the reach of your titles
YUMPU automatically turns print PDFs into web optimized ePapers that Google loves.
OJIBWA TEXTSPART I
PUBLICATIONSof theAmerican Ethnological SocietyEdited by FRANZ BOASVOLUME VIIPart IOJIBWA TEXTSCOLLECTEDBYWILLIAM JONESEDITED BY TRUMAN MICHELSONE. J. BRILL, LIMITEDPUBLISHERS AND PRINTERSLEYDEN, 1917G. E. STECHERT & Co., NEW YORK, AGENTS.
AM *v-7-VPRINTED BY E. J. BRILL, LEYDEN (HOLLAND).
OJIBVVA TEXTS.CONTENTS.PREFACEPageixPART I.-- NANABUSHU TALES.SERIES I. Nos. 1-18.i. The Birth of Nanabushu32. The Theft of Fire 73. Nanabushu slays his Younger Brother 154. Nanabushu kills Another Brother 235. Nanabushu and the Winged Startlers 41 -6. Nanabushu and the Dancing Bullrushes . <457. Nanabushu, the Sweet-Brier Berries, and the Sturgeons. .498. Nanabushu and the Wolves 73 -9. Nanabushu and the Wolves, Continued 8510. The Death of Nanabushu s Nephew, the Wolf 8911. Nanabushu breaks the Necks of the Dancing Geese . . . 101 -12. Nanabushu eats the Artichokes 11313. Nanabushu and the Cranberries 117 -14. Nanabushu and the Caribou 11715. Nanabushu flies with the Geese 1271 6. Nanabushu and the Buzzard 13317. Nanabushu pretends to be a Woman 1391 8. Nanabushu slays Toad-Woman, the Healer of the Manitous . 145SERIES II. Nos. 19-32.^i0. Nanabushu and the Caribou 15920. Nanabushu breaks the Necks of the Dancing Geese . . .16921. Nanabushu and the Cranberries 17922. Nanabushu and the Dancing Bullrushes 18123. Nanabushu eats the Artichokes 185[v]430019
VI24. Nanabushu and the Winged Startlers 187qA 25. Nanabushu and the Great Fisher 19326. Nanabushu and Windigo 19727. Nanabushu comforts his Grandmother 20328. Nanabushu swallowed by t^he Sturgeon 20729. Nanabushu, the Sweet-Brier Berries, and the Sturgeons.Page.21530. Nanabushu and the Wolves 23531. The Death of Nanabushu s Nephew, the Wolf 25132. Nanabushu slays Toad-Woman, the Healer of the Manitous . 261SERIES III. Nos. 33-38.33. Nanabushu feigns Death to marry his Sister . 27934. Nanabushu is fed Meat from the Back of a Woman .- 35. Nanabushu and the W T. .299oodpecker 30536. Nanabushu is Miraculously fed Bear-Grease 311i ,37. Nanabushu and the Mallard 31738. Nanabushu isgiven Power by the Skunk, but wastes it . . 321SERIES IV. No. 39.39. Nanabushu and Soaring-Eagle 331SERIES V. Nos. 40-42..40. Nanabushu isMiraculously fed Bear-Grease 341^ 41. Nanabushu and the Mallard 351_ 42. Nanabushu and the Woodpecker 357SERIES VI. No. 43.43. Nanabushu hunts Buffalo with his Younger Brother .. .363SERIES VII. Nos. 44-56.44. Nanabushu and the Wolves 373^ 45. The Death of Nanabushu s Nephew 389,46. Nanabushu slays Toad-Woman, the Healer of the Manitous . 39947. The Scattering of the Animals and the Regulation of Nature 40748. Nanabushu breaks the Necks of the Dancing Geese . . . 40949. Nanabushu and the Little Fishers 41350. Nanabushu and the Ruffed Grouse 41551. Nanabushu and the Moose-Head 415^52. Nanabushu is Miraculously fed Bear-Grease 42153. Nanabushu and the Woodpecker 42354. Nanabushu marries 42355. The Origin of Likenesses of Nanabushu 42956. Nanabushu flies with the Geese 433
VIISERIES VIII. Nos. 57-63.57. Nanabushu and the Fish-Trap 43758. Nanabushu obscenely jests with his Grandmother .... 44759. Nanabushu finds Cranberries and Big Cherries 44960. Nanabushu is made to fast by his Grandmother, and revengesHimself . .4516 1. Nanabushu swallowed by the Sturgeon 46762. Nanabushu slays Hewer-of-his-Shin 48363. Nanabushu leaves his Brother, and also his Grandmother . .495
PREFACE.THE material contained inthe present volume representspart of the results obtained by the late William Jones inhis work undertaken under the auspices of the CarnegieInstitution during the years 1903, 1904, and 1905. Duringthis period Dr. Jones was research assistant at the CarnegieInstitution, and he was charged with the study of theOjibwa tribes. Most of his investigations were carried onnorth of Lake Superior. During the year 1906, when hewas stillengaged in working up the results obtained duringthe journeys undertaken for the Carnegie Institution, heaccepted a position in the Anthropological Departmentof the Field Museum of Natural History, Chicago.He was immediately sent to the Philippine Islands tocollect and study on behalf of the Museum. He tookhis manuscript material along, hopingto work on it inspare moments. During his researches in the PhilippineIslands he was killed by the natives, and the manuscriptmaterial lay for a long time buried in Manila. Finallythe Field Museum of Natural History sent a member ofits staff, Mr. S. C. Simms, to rescue Dr. Jones s collections.He also found the manuscript which, at the request ofProfessor Boas, was turned over to him by the CarnegieInstitution for the purpose of reporting on its condition.An agreement was reached between Professor Boas andthe Carnegie Institution byto contribute to the expense of printingwhich the Institution undertookProfessor Boas also obtained the co-operationIXthe collections.ofthe
American Ethnological Society, and the editorial work onthe collections was entrusted to the undersigned.In the papers left by Dr. Jones the following prefatorynote was found, which explains his plan of publication."The work presented in the following pagesis the translation of a body of material that was taken down in textfrom several dialects of an Algonkin people called theout thisItOjibwa. was originally the purpose to bringtranslation at the same time with the text, but circumstances of various sorts have interfered with this :plan inconsequence the offer of the texts for publication will bepostponed.It is the plan to present with these texts alinguistic introduction dealing with the phonetics, morphology, and syntax of the Ojibwa language, together witha dictionary of stems to the same. Much work has alreadybeen done toward the fulfilment of this end, but it is notyet in a form to justify its publication."With this translation is an introduction treating of thematerial culture of the : itOjibwaswill serve as a meansof rendering the narratives more intelligible.The narratives contain myth, primitive lore, sayings, and a gooddeal else bearing largely on the religious sentiment ; theyalso contain traditional matter, some of which may beclassed as historical. On account of the heterogeneouscharacter of the work, it is hardly possible to present itin an orderly sequence. The plan of the present arrangement has been to group together as near as possible theparts that have an intimate connection ; as, for example,tales that are variants of one another, or that have elementsof a similar character, or that belong psychologically ina class by themselves. For this reason it has seemed bestto break up some of the long narratives as given by theinformants, and to mass together such parts of them as
XIdeal with the same episodes. This arrangement readilyoffers means for an immediate comparison of the variousforms in which a common tale is told."The work is to be taken largely as an attempt to getat the religious ideas of a people from their own pointof view. As this point of view can be expressed onlyin terms of their own language, naturally the linguisticmethod had to be employed in the investigation. Aspeaker s own words were put down in text ; and, sincethe object was not to find how well a narrative could betold, never was a version repeated a second time by theone who gaveit. The form of the story in the text isthat which the speaker told but once,at the first dictation.Simplicityis a characteristic mark of the narratives:throughout they run along with such an even, quiet pace,that they leave an impression of dull monotony. Theyare told off in a matter-of-fact way, and conscious effortat rhetorical effect is feeble. The rare use of figures ofspeech, and the sudden turning of phrases for springingsurprise, are suggestive facts, especially from the point ofview of the form and construction of a narrative. Repetition isfrequent, not only of an idea, but of an expression :stereotypedphrases constantly recur, verbs of saying,quotatives, and introductive adverbs being especiallycommon. Quotatives have been in some cases difficultto handle, and equally as much trouble was given byintroductiveadverbs."Thelanguage of most of the material is conversational;the periods are short; sentences colloquial, seldom sustained,and often loose and incoherent. Vagueness of referenceis common. The unconscious assumption on the part ofthe narrator that one is familiar with the background ofa narrative, is one cause why so many of the statements,when taken as they stand, are unintelligible. This vague-
XIIness of effect ishelped along by the tendency to abbre- -viated expression, such as the frequent occurrence ofa quotation without mention of the speaker, and thepresence of subjects and objects without verbs,- -thusrendering sentences often extremely elliptical."Other causes have operatedin rendering the senseuncertain; such, for instance, as the interruption of thesequence of a passage, the interruption being due to thesudden appearance of persons for one cause or another,or whose presence was desirable, or to the response ofsome call, domestic, social, or ceremonial. In a lessdegree, the uncertainty of the sense of a passage hasbeen due to the delay in translation."Thelanguage is spoken in word-sentences, and therendering in English is generally longer. In a passagecapable of more than one rendering, preference is givento the shorter. The inchoative character of a verb isalways present, despite the fact that it may not be explicitly expressedin the stem. This inchoative sense is notalways brought out in the translation ,in particular, if theomission is not likely to interfere with the general meaningof a passage. As already stated, the English equivalentisgenerally longer than the original, and it has been theobject to keep the length of the translation back as nearas possible to that of the original. Frequently, however,the inchoative would be superfluous in the English idiom,hence in such instances it is left unexpressedin the translation. A common peculiarityis met with in the inceptionof an inchoative, a beginning-to-do or a beginning-to-be.It isenough in English to say that he commenced his work,or that he started to grow in stature: but it is commonoin Ojibwa to say that he began to commence his work, orthat he began to start to grow in stature. The inceptionof this inchoative is seldom expressedin the translation.
XIII"It was the plan to have the translation run as near aspossible with the order of the ideas of the text ;but thiscould not be maintained except within approximate limits.But with few exceptions,it was possible to keep theof the translation close to that of the text.grammarWhere there was departure from the grammatical structureof the original,it was in cases where the sense wouldhave been left in doubt if fidelity to syntax was adheredto :as, for example, the matter of plurality, which theOjibwa often expressed by the use of singular nouns andverbs, but which in the translation are rendered accordingto sense;or when a passive could best be rendered byan active form, a personal by an impersonal, a transitiveby an intransitive. Furthermore, the inchoative characterof verbs is not always shown in the translation."Thelanguage contains grammatical gender, animate andinanimate. Itmay be said, that, as a rule, the animateof life and moverefers to everything having the qualityment while the inanimate refers to all; things withoutthose qualities. Being or creature would be a generalrendering of the animate, while thing would express theinanimate. It has been found best in the translation toexpress gender somewhat as follows : animate as masculine,unless from the context the gender is feminine; and inanimate as neuter."Pronouns of the second person singular are renderedaccording to the English idiom ; viz., thou and thineinto you and yours. The form of the verb with thepronoun youis made to take the place of the moreconsistent thou."Theplural of the first person in isOjibwa treated differently from the way it is in English.In it isOjibwaexpressed in the terms of relationship which the speakerbears to the other two persons: hence there are two sets
*XIVof forms, - - one including the first and second persons;and another, the first and third persons. This distinctionis not maintained in the translation :it has not seemednecessary exceptin a few instances, for purposes ofclearness."Theparagraphs of the translation correspondto thosein the text. Punctuation in both text and translation isthe same for periods, colons, semicolons, and interrogationsigns,but irregular for commas and exclamation-marks.It has been found necessary, for purposes of clearness, touse commas in the translation where they are absent inthetext.the translation as free as"An effort was made to keeppossible of Ojibwa words but this could not be done;absolutely, on account of the doubtful meaning of manyterms (such as proper names) ;and in the introduction itwas found necessary to give names of places, people,groups of people, and the like. The spelling of Ojibwawords in the translation does not always conform exactlyto the orthography here shown. The vowels are aboutthe same, but the consonantal sounds are about as theywould generally be expressed in English.VOWELS."The vowels have their continental values, and theirquantity is indicated by symbols. Thus :-u . . . . like u in /////.u . . . .long, like the vowel-sound in loon.o . . . . like o in fellow.o . . . .long, like o in no.a .... like the vowel-sound in hut.a .... like the vowel-sound in not.a .... long, like a in alms.a .... broad, like a in all.a . . like the vowel-sound in sham.
XVe . . . . like e in men.e . . . .long, like the a in tale.... like z in sit.i .. i . . . shorter than the i in sit.1 .... long, like the vowel-sound in see.DIPHTHONGS."The combination of two vowels into one sound is notfrequent. There are probably but two clear -:diphthongsai .... like the diphthong in my.au . . . . like the diphthong in shout."The movement of the voice off a long vowel is downward;hence o and ~e sometimes sound as if they mightbe o u and e 1 where o u would be almost like the, diphthongin toe, and ~e l like the diphthong in day.CONSONANTS.2.... a soft glottal stop..... a Greek spiritus asper denoting a whispered/i, k, t and p.h . . . . like h in hall.....-. like h, but with a whisper preceding..... like the /-sound in call./&.... like k, but with a whisper before articulation....; like g in go.x . . . . like ch in German Bach, but less feeble.j...-.. like sh in j//.continuant before. . . like the French / in jour.s . . . . like the sound in English, but made with the tongue against thelower teeth.5 . . . . like the z in zero,tc . . . . like ^ in charm,dc . . . . like / in June.t . . . . like / in tea.V .... like /,but with a whisperd .. . . like d in day.;/.... like the same sound in English.p.. . . like p in pen.before articulation.
XVI/.... like p, but with a whisper preceding.b . . . . like b in boy.m . . . . like the sound in English.y like y in . . . . jy<?&.w . . . . like w in war."The consonants can be graphically shown in tabularview thus :UI am indebted tomany who have lent aid in furtheringthe work, - - to many Ojibwas, among whom mayfirstbe mentioned the names of five whose narratives are herein translation. By accident they all happen to be of theBull-Head totem. First is Mrs. Marie Syrette of FortWilliam, Ontario. She grew up at Lake Nipigon, wheredwell Ojibwas of Lake Superior, arid to which place comethose that live on the height of land and along the riversflowing towards Hudson Bay. She is well versed in the1The nasal of this series is found only before g and /,and hence transcribedby the dental nasal, n. Nasal vowels are indicated by a superior n. The Ojibwasurds are not aspirated as in English. Superior vowels following other vowelsindicate weakly articulated sonant vowels. T. M.2 Better dj. T. M. 3 Better dz. T. M.
XVIIlore of all these people. In Ojibwa she is called Kiigigepinasikwa (Forever-Bird-Woman ).Next isJohn Pinesi(Penessi, Penassie), chief of the Fort William Ojibwas.No name is better spoken of or more widely known bythe Canadian Ojibwas than that of this fine, old man.His surname comes from an abbreviation of his Ojibwaname, which isKagige pinasi ( Forever-Bird ),and bythat name he is more familiarly known. He knows theOjibwas from Manitoulin Island to the Sault, and all thatlivealong the north shore of Lake Superiorto GrandMarais. He has been among those who live on Rainy-River, Lake of the Woods, and those who live on theheight of land ;but he is more familiar with the Ojibwasthat inhabit the shore country between Kanustiquia Riverand the Sault, for it was in this vast region that lay thescenes and experiences of his life, from childhood to oldage. The third isWasagunackang ("He-that-leaves-the-Imprint-of-his-Foot-shining-in-the-Snow"). He is now anold man, bent with age, living at Pelican Lake, near theBois Fort Reservation, in Minnesota. He grew up onRainy River, Rainy Lake, and the Lake of the Woods.The fourth is his nephew, Midasuga n j (Ten-Claw ), livingat Bois Fort. He visits with the Red Lake Ojibwas onthe west, and with those of Rainy River on the northand east. He is a man of middle age, of strong physique,energetic, well built, intelligent,and of the number frequently called upon to take leading part in ceremony.The last isMadcfgabo ( Begins-to-Rise-to-his-Feet ).Heis chief of the Bear Island Ojibwas of Leech Lake inMinnesota. Unfortunately but two of his narratives appearin the collection. His help was utilized in another way, -ingoing rapidly over the whole collection to see whatwas familiar to his group of Ojibwas, and what was not.To be mentioned with him in this connection isNigani-
XVIIIpinas (*Bird-on-Ahead ),the head chief of the PillagerOjibwas, of Leech Lake, Minnesota. He is better knownby the whites under the name of Flat-Mouth, thename of his father, who was one of the great chiefs otthe Ojibwas. He is also of the Bull-Head totem. Flat-Mouth was exceedingly helpful. It can be said that foracquaintance and knowledge he is to the Ojibwas westand northwest of Lake Superior what Forever-Bird is tothose of the north shore of Lake Superior. He isprobablymore familiar with the Ojibwas south of Lake Superiorthan Forever-Bird is with the Ojibwas of Manitoulin Islandand thereabouts. He has journeyed back and forth foryears between Leech Lake and the Lake of the Woods,stopping for long periods at a time at Red Lake, RainyRiver, and Rainy Lake. He practises magic, soothsaying,and is one of the foremost members of the mysticrite.He was acquainted with all the materials of the text, andwas familiar with the various peculiarities of dialect. Textsfrom him and Begins-to-Rise-to-his-Feet would have completed the circuit I had set out to make, - - a circuit thatwould have contained practically all the important talesknown among the Ojibwas, wherever they are found ;but, under circumstances of the moment,I had to restcontent with the service which they kindly gave in checkingup what I had already gathered."To three English-speaking OjibwasI am under obligationsfor the help they gavein a more restricted sense, - - toMrs. Milise Millet, the daughter of Mrs. Marie Syrette,of Fort William, Ontario to ; Joseph Morrison of WhiteEarth (?) ;and to William Butcher of Leech Lake, Minnesota. The aid rendered by them individually was notquite the same in each case. Mrs. Millet was quick atsyntax. Morrison was proficient in throwingEnglish the meaning of an Ojibwa passage.into idiomaticIn this partic-
XIXular sense, he isprobably the ablest interpreter of Ojibvvanow to be found. Butcher sfamiliarity with the life ofthe old-time people and with the background of the materialof the text was of great assistance. It was of a worldthat he knew well, and for which he had a sympatheticitfeeling (inhe had been reared), and of which he hadbecome so much a part that it was easy for him tointerpret in terms of that experience."I take this opportunity of acknowledging the manycourtesies extended me byofficials of the Canadian Pacific,Great Northern, and Northwestern Railroads. To Dr.George A. Dorsey, Curator of Anthropology of the FieldMuseum of Natural History at Chicago, and to Dr. ClarkWissler, Curator of Anthropology of the American Museumof Natural History at New York,I am indebted forgenerous assistance kindly given at various times in variousIways. cannot leave unmentioned the name of the lateWilliam Wells Newell, who watched the work with livelyinterest from itsvery beginning.It was his desire thatthe work be brought out by the CambridgeBranch ofthe American Folk-Lore Society, on account of the factthat in the texts were the myths from which Longfellowderived the materials for the Song of Hiawatha/ I amunder special obligations to Professor Franz Boas of Columbia University for his constant assistance at all times,and for the kindly interest he took in the work from thevery beginning. He pointed out the field, suggested linesof investigation, provided means for carrying on the work :hence to him islargely due whatever results the workmay have for the scientific study of the lore of a primitive people."Circumstances have forced me to modify Dr. Jones soriginal plan. It has seemed best, after long delay, to
XXbring out both text and translation, and to postpone avocabulary and grammatical discussion till a future time.The editor decided to abandon the arrangement of thetales according to the method suggested by Dr. Jones,and to give the tales rather in the order in which theywere told.By doing so, the individuality of each narratorcould be brought out more clearly. So far as is at presentknown, the provenience and authorshipas follows -:Series i(Nos. 1-18). Bois Fort: Wasagunackank.Series 2(Nos 19-32). Bois Fort: probably Midasuga J.of the tales areSeries 3 (Nos. 33-38). Bois Fort: probably Midasuga j.Series 4 (No. 39). Bois Fort :Wasagunackank.Series 5 (Nos. 40-42). Bois Fort :probably Wasagunackank.Series 6 (No. 43). Leech Lake :Madcigabo.Series 7 (Nos. 44-56). Fort William: Penessi.Series 8 (Nos. 57-63). Fort William : Mrs. Syrette.It should be expressly noted that Dr. Joneshad contemplated publishing the Indian text later, not in conjunction with the English translation. Doubtless he wouldhave revised it;for a critical examination shows that theseOjibwa texts are especially valuable for their literary, andless so for their phonetic, accuracy. Yet, on the whole,it seemed entirely feasible to print the texts as he left them.Itmay not be inappropriate to outline here my task.The firstthing to determine was what Indian originalscorresponded with the English translations ; and, secondly,to harmonize their paragraphing and punctuation, for itappeared Dr. Jones s plans regarding them (vide supra)had not been carried out. I have revised the Indian textof Part II and inserted the proper diacritical marks onthe basis of Dr. Jones s field-notes, as it was apparentthat the typewritten copy was made by a person whohad no knowledge of Ojibwa. Where these field-noteshave failed me (happily, in only a few instances), I have
XXIrelied on Ojibwa informants and my own slight knowledgeof Ojibwa. Here and there some phrases which wereleft untranslated by Dr. Jones have been translated byme on the basis of Dr. Jones s note-books. Where I amwholly responsible for the translation, a footnote willshow it.The contents of Part I contain little, if any, new materialfor Ojibwa mythology. The works of Schoolcraft, Kohl,Radin, De Jong, cover more or less the same ground.Skinner s "Notes on the Eastern Cree and Northern Saulteaux"should also be mentioned in this connection.Part II of the"OjibwaTexts" is in press, and it ishoped that it may be issued soon. Another volume,dealing with Ojibwa ethnology, is being prepared by mefor publication by the Bureau of American Ethnology.The following papers have been issued, based on Dr.Jones s manuscript material :Notes on Fox Indians (Journal of American Folk-Lore, Vol. XXIV,pp. 209-237).Ojibwa Tales from the North Shore of Lake Superior (Ibid., Vol. XXIX,pp. 368-391)-Kickapoo Tales (Publications of the American Ethnological Society,Vol. IX, 143 PP-).Washington, D.C.,November, 1916.TRUMAN MICHELSON.
OJIBWA TEXTSBYWILLIAM JONESEdited by TRUMAN MICHELSONI PUHL. AMER. ETIIN. SOC. VOL. VII.
I.-NANABUSHUTALES.SERIES I. Nos, 1-18.i. THE BIRTH OF NANABUSHU.Uwlgiwamiwag anicinabag, mindimoya 11 udanisan uwidigaman.Ninguting uganonan Ini /u udanisan : "Ambasanonindanis aiyangwamizin. Wlnondawicin ka/rninan. Kagiitsaningitciku tatc, kinanlsananimin. Kagu wl ka ijitcika kan5 owiti nlngabra nung tciinasamapiyan saga a-man. 1Kagoklga iji a ya klcpin i^widi inasamapiyan. Mri wisa ajinamsananiminan.Aiyangwamisin 4 c /u i inongumaninan tcri jiotcigayan ; kiga i niga ton klya /u . Mlsai i u aninan."Anic misagui u ,anic misa ka^a t aiyangwamisigobanan10 4 a c a /u 4i kwa wackinlgi kwawit. Kawm 2 wi ka ininiwan pacu 7oglwabamasin. Ningutingigu ka/i ciwaniwisit a 11 uckinlgikwa;mldac a l pl saga a mugubanan ka-ijii*nasamabit nmgabla nung mldac a pl nondamugubanan pldwawayanimatinig.Kaijiki kandank ta kacit i i widi osaga a mowining. 31-Saga a man, "when you go a out," euphemistic expression.Wackimgi kwawit, was "who a or "a womanmaiden," youngin years."W
I. NANABUSHU TALES.SERIES I. Nos. i-iS.i. THE BIRTH OF NANABUSHU.In a wigwam lived some people,an old woman withher daughter dwelt. Once she spoke to her daughter,saying:"Ibegof you, my daughter, be on your guard.I would have you listen to what I am going to tell you.Verily, am Igreatly afraid, I am in fear for you. Neverbring to pass when you go out l that you sit facing towardthis westward way. Somethingwillhappen to you iftoward that way you sit facing. That is what causes meto entertain fears for you. Be careful to giveheed tothat which I now tellyou to do ; (or else) you will bring(an evil) fate upon yourself. Now that was what I hadto tell you."Now such was the way it was, for it was true that atthe time heedful was this woman who was a maiden. 2Never with men had she intimate association. But onceon a time unmindful became the maiden;so when outof doors she went (and) afterwards sat down facing thewest, then heard she the sound of wind cominghitherward.When she felt it,she was chilled there at theplace of the passage out. 3Accordingly she quickly leaped3Osaga a-mowining, "at the place of the passage out," a euphemistic expressionfor the vulva.[3]
Mldac ajipasigundcisat. "Nimama, nackaginm, ka ijra/yayanmlganabatc ka/i jiyan!ajra/yayan."Ka ijikanonat a*a u mindimoya lni /u udanisan: "Mamindagagigrrniga ton klya /u ." Anlc misa u icigwa gimawit5 au "Anlcmindimoya. mlgu u i nindanis, Iniga toyan klya /u .Nackaguta ka ijiwabisiyan. Awiya klpindigawag klyawing,mlgu iu nindanis, Inigasiyan. Kawm anicinabawisiwag kapindigawadimasa giyawing. Kawln wasa u itcinlgiwad.uNa, mldac Igi kagusagwa."10 Anlc nackadac kumagu ya pi misagu kinondawat a*a wisa-mindamoya awlya madwagi kandinit. Uglki kanima anamayartanwawataminit. Midac 11mojag klmawit aV mindimoya. Mldac kagat i i ma klkwaya kwanimat tcipimadisisinitIni /u ;udanisan. Anlc oglnondawasa ga kandinit,15 iYma umisadaning tanwawataminit.lO 8 o / widac madwaikidowan: "Nlnlningasazi kis."c /ui i"Kawin,"madwai kito pa e jik blnicigu i kido au pa e jik :"Kawln kidazazlkisisl. Ninisa ningasazikis.Anlc mlsa pana mawit au mindimoya pisindawat Wu20 ga kandinit. Uglkikanima a 11 mindimoya iY 11 watacinit4^/uu- o-cica n ya 8 .Na, mldac i i /u a kidowat nagawabinitlwat (ayani) anawisagaa-mowat. Igiwidac anind anugrr kitowag:"Kagupina! kiga i niga a-nan kuca kimamanan. Wawani pinagu25 saga a nda,"anirr kidowag.1Ningasazikis, "I wantto be the firstbrought forth;"more literally,"I wantto be the eldest."
"to her feet. "Omy mother, behold the state that I amin ! Itmay be that what youwithme."told me of is the matterThen spoke the old woman to her daughter, saying:"Exceeding harm have you done to yourself."So therefore then did the old woman weep."Nowtherefore, mydaughter, have you done yourself a hurt. You shall learnwhat willhappen to you. Certain beings have enteredinto :your body therefore, my daughter, you are in apitiable state.They are not human beings that havegone inside of you there. The time is not far distantbefore they will be born. Therefore it was they whomIfeared."Now, lo, in the course of time did the old women hearthe sound of beings that were quarrelling one with another.She knew by the sound of their voices that they wereinside. And so without ceasing did the old woman weep.It was true that then was she sure that her daughterwould not live. Now she heard them quarrelling onewith another, there in her (daughter s) belly the sound oftheir voices could be heard. This was what one washeard to say:"Iwishto be the firstbrought forth." 1"No,"one was heard saying, even did one say, "youcannot be the first-born. I am the one to be the eldest."It was natural that all the while the old woman shouldone with another.weep as she listened to them quarrellingKnowledge of them had the old woman as to how manywould her grandchildren be.Hark ! this was what they said as they pushed oneanother back from the place where they tried in vain togo out. But others of them tried, but to no purpose, tosay:"Don t, please! We shall surely do injuryto ourmother. In proper order please let us go out," (thus) invain they said.
,"ugri""Kawmdac ijiminwadanziwag igi/uwasazi kizitcig. Midacc /u i i a/kidowat cigwa anotcigu wrrjisaga armowad. Pajikugiwabandan wasa kunanig."Anlc mrrma kwaya k nlnwa/ijayan."Midac a pi klkagwatanimitiwad awanan a 115 ni tam kasaga a nk, mldac u /ui ka ijiplguckawawadiniumama i wan. 1Wi kagu ningutci papai nabit mindimoya ugimi kanmiskwi pang!. Mlsa wlgwas ajipapagunang. Midac imal ska ijia^tod wlgwasing /u i i miskwi ka ijikackackwamaginang,misa / ka ijinainang. Anlc pltcmag ugiwabandan.Ningudingigu apackwamaginang uglwabaman abinodciyan,mlgu 4 8 /u iklkanonigut, o*o*dac :ogri gon "No komis,"ogri gon a pi kanonigut. Anlc mlsa cigwa ugrrgon:"Giki kanimna ayawiyan? Nlnisa Nanabucu.2. THE THP:FT OF FIRE.15 Anlc mlsa u icigwa klni tawigra t 4a 8 a /u mindimoya.Mlsa u icaylgwa ugri*nan ini /u o^umisan : Kawminaningutci anicinabag kiki kanimaslg tci a*yawat?"8"Aye gon Ini o kumisan. O widi 7 "O agamiki tcigamiayawag Igi /uanicinabag.20 ka "Kunaga udayaslnawatug l s /ui i ickuda?"I 8 /u i i8"Aye,"ugriickuda."gon Ini 11 o kumisan; "Kaga t utaiyanawa"Ambasano, ninga-O O widac ugri nan Ini /u o kumisan :nasi kan8 /ui i ickuda," ugi nan i Ini/u o kumisan. Oo widac25 ugri gon Ini /u o kumisan : "Kawln kidakackitosm. Kaga t1It is said that four was the number of them that thus came forth :Nanabushu,
7But not content with the idea were they who wishedto be the eldest. Therefore then they said that now fromdifferent places they wished to goout. One saw wherethere was light. "Now, straight by this very way do Iwish to go."And so while they were debating amongthemselves as to who should be the first to go out, thenwas when they burst 1open their mother.After a while at a certain place where round about theold woman was looking she found a clot of blood. Thereupon some birch-bark she began peeling (from a tree).And now, after she had put the blood upon the bark, shethen folded the bark over it,and laid itaway. Naturally,by and by she looked at it. Now, once when she openedthe bark she beheld a babe, whereupon she was addressed,and this is what she was told: "Omy grandmother!" shewas told at the time that she was addressed. So nowthis was what she was told: "Doyou know who I am?Why, Iam Nanabushu."2. THE THEFT OF FIRE.So accordingly then did the old woman bring him up.And so by and by he said to his grandmother: "Don tyou know of a place where there are some people.""Yes,"he was told by his grandmother."Inyonderdirectionon the farther shore of the sea are some people.""I amcurious to know ifthey do not possess fire.""Yes,"he was told by his grandmother; "truly, theydo possess some fire."Now, this was what he said to his grandmother:"Pleaselet me go fetch the fire,"he said to his grandmother.And this was what he was told by his grandmother:the deer, the chickadee, and the Sun. It is said that the deer was one of the veryfirst animals to be created.
." Amc8la pidci oganawandanawa rrwisa andawat. A kiwa n zl rrmaaya. Mlgu a pana tasing kljigatinig asabin t.ujra Kawinwf ka ningutciijasi, mlgu a pana ima pmdik ayat. Nl n jiwas idacl s /ui i otanisa e ,miyata i u mojag agwatcing ayanit."5 O O widac ugri nan !ni /u o kumisan :ogri nan ini/u o kumisan."Ma^u ninga ija,""Awawa," ugri gon !ni/u o kumisan.Amc misa a pl cigwa ka i^kidut: "Ambasano tagackatin^o^ ki tcigami, wlgwasabakwang tawlaprtadin 0*0 ki-10 tcigami."Misa gagat ka ijiwabatinig iwisa ka-i kidut."Ocrwidac ninga ijinagus,"ki i^kido; "Nindawa ningawaboson si umisa kaga ka t ijinagusit. Misa cigwaklmadciyataga kwat. Misa kaga t kawln krtwajinsl. Anic15 misa ugiki kaniman ma i i ayanit 4 8 /u i anicinaba 8 . Midacima ka ijitagwicingi i ma wanda iblnit, crcrwidac kri nandam:"Ambagicsa pinibinatit a a wi kwa," kri nandam.O O widac ki ijitciga iima wa u gwabaiminit I 9 /u i inibi, midacka/i ji a*gwawaba irgut I 8 /u ki i itcigami mri man klti tipa u gut20 mrrma mi kwawan ka u ndcigwaba i-bmit. O O widackli kido : "Ambasanoningawawiyatanimik." Anic misaa kawabamat tcibinasiblnit.Kunlgimn, kaga t uglwabamanpldasamusanit.Midac cigwa ima n tagwicinbn imasa ayat, cayigwa ugl-25 gwaba*a*mini.4Ka ijimrkawabamigut misa ka pri zitapipinigut. Midacs /u i i ka ijisfkoplginigut ka i jiklwawinigut o O widi ka i ji-
""Not willyou be able to succeed. Truly, a very carefulwatch do they keep over it there where they dwell. Anold man at the place abides. And all the while, as oftenas the day comes round, upon a net he works. Neveranywhere does he go, but always there indoors he remains.Now, two are those daughters of his, and only they arecontinually out of doors."And this he said to his grandmother: "Nevertheless Iwill go,"he said to his grandmother."Very well,"he was told by his grandmother.Now, this was what he then said afterwards :Iwillthat the sea shall freeze, as thick as the birch-barkcovering of the lodgeso let this sea freeze."It was true that ithappened accordingas he had said."Now, this is the way I shall look,"he said. "I willthat I become a hare." So accordingly that truly was theway he looked. Thereupon he then started on his wayover the ice. It was true that he did not break through(the ice).Of course it was so that he knew that atyonder place the people were abiding. And so after hewas come at the place where they drew water, this thenhe thought:"Iwishthat for water some woman wouldcome,"he thought. And this he did there where sheintended to dip up water: that after he was washed upby the waves of the sea, then he was tossed rolling tothe place from which the woman was to draw water.And this he said: "I wish that she would take me for aSoplaything." thereupon he layin wait for her to comefor water. Lo, truly he beheld her walking hitherward.Thereupon soon was she come at the placewhere hewas, at once she dipped out the water.As soon as he was discovered, forthwith was he seizedupon. And after the water had been rubbed from him,then was he taken over there to her home in the bosom;
10plndomowint l u iwlya /u . Mlsa,ka rjipindiganigut kaga/toglwabaman a kiwa^ziyan namadabinit.cKaga t asabi kawan.Ocvwidac ogrrnan Vawi kwa ini /u omisayan: "Nackiiginm,"ugrrnan klmodc ini /u !:omisayan. "Nackaginm wa -a* u5 kami kawag, wabozons. Arnba a tata; wawiya tatagusiwa 8 a u wabozons! Ambasano kaya gin wawiyatanim nimisa 11wa*a wisa wabozons."Oo widac ugri-gonini /u :umisayan a "Klga yawigunankosinan klga U nsumigunan," ugri gon Inomisayan ;kimo-10 dcidac ugri gonIni /u omisayan.Mldaclc /ui i ka ijinandobagwid ka-ijipagitinigut rrmatclgickuda wl pangwawasagut. Mldac ^-i -v pa piwad Igi /uikwawag wawlyadanimawat Ini /u wabozonsan.Ajiki kanimiguwat mi /u osiwan."Kitomblgisim," ugri gu-15 wan lni /u osiwan.O^widac ogi i-nawan Ini /u osiwan: "Nackaginin," oglinawan."Nackakinln wa s a 11 wabozons.""Ca!"ugliguwan Ini /u osiwan. "Kawlninakigmonta n zlmIgi /u manitog 4 8 /u iginlgiwad? kanaml a 11 pa e jik awizltug.20 Awra-sik," ugri guwan !ni /u osiwan."Kagatsa klgaglbatisiml e xi i wisa kro ta pinag."O O widac krr kito awi kwa :"Atatakucanlwawiyatanimaa^aVisa wabosons." O o widac ogli nan Ini /u osan : "Anmkagl i jinagwa k 2 i^wisa kawabosonsiwit C a 8 a /u manito?"25 ogri-nan Ini /u osan.O 8 owidac kri- kido :"Kagatsakawin kini tanondazl.Kawlnina kiwabamisl a pitcinagusiyan?"1Ka-i-jipindomowint i u \vlya /u ,"in the bosom of her garment she put thecreature;" literally, "in the bosom of her garment was put its body."
"1 1of her garment she 1put the creature. And after he hadbeen carried inside, truly he saw an old man that wasseated (there).Sure enough, he was at work making a net.And this said the woman to her elder sister :Isay,"said she in secret to her elder sister,"see this creaturethat I have found, a little !bunny Oh; such a cunningthing is this dear little Ibunny! wish you would alsothink itcunning, elder sister, this little bunny."Now, this was she told by her elder sister "We shall:be scolded by our father, on account of it shall we betaken totask,"she was told by her elder sister; and insecret she was told by her elder sister.Accordingly, after she had searched in the bosom ofher garment, then was he placed there beside the fire, thatfrom the heat his hair might become dry. Thereuponlaughed the women as they made a pet of the littlebunny.Then they were found out by their father. "You aretheir father.noisy," they were told byAnd this they said to their father: "See this," theysaid to him, "see this little bunny!""Beware!"they were told by their father. "Have younot heard of the manitous how they were born ?Perhapsthis might be one of them. Go put it where you got it,"they were told by their father. "Truly, indeed, were youfoolish to take it."And this said the woman: "Such a precious pet do Ithink this little bunny!"And this she said to her father:"How is itpossible for 3 a manitou to be a little bunny?"she said to her father.And this he said: "Truly, indeed, you are not heedfulof what is told you. Do you not behold me, how far inyears I am?"2Anln kagi i-jinagwa k,uhow is it possible for . . . ; more literally,"how wouldit look or seem for . .
"Ambasano12Oowidac klicitciga aV11Ini /u wabozonsan;4wisa wl pangwawaswat kaTJikwa kwakicimatsi iima tclgickuta.ikwa, nawandicigu ogra biswanOcrwidac krrnandamla c a /u Nanabucu :"Mlmawlnrr 115 cigwa pangwawasowanan."Amc/uopa pra wan IgiiO kwawag.O widac kl i nandam :Ka e galtajipa kinazut. Ka/ijinawatisut kaijisagitcikwaskwanit.ningapa kinas."10 widac krr kitowag Igi/uikwawag. "Nackaginln,osagitcipatwatanl c /ui i ickuta!" utinawan Ini /u osiwan.11"AT!" kri- kito aV a kiwa l n zl; tsa kawln kini-"kagatanonta^im kago anu iguyagin. Kana mlya s a u ( a a* u )pa e jik manito l pama kaminank i u kitickutaminan." Ka i15 jipasiguntcisat a c a /u a kiwa l n zlanugl mawinatangIiutciman. Anugri-jimatablwapinang, midac ka-ijimi kwamlkanig.Midac anicagu ka iciganawabamawat micawikitcigamiani O cawackwa kunanit, midac pmic ka/ijipickwapamawat.Anlc klgwinawiijitcigawag.-5:i /u20 Midac cigwa otababandan andawat 2 wu u o*widac ogri-nan Ini /u o kumisan tcibwamadcat :"Acwm, magica ka e ga c tpltoyanl c /ui iickuta," ogri nan Ini /u o kumisan. Ka/rjikanonata pltababandank l s /u i iandawat, o c 5 ogi nan a i pipandigasat Ini /u o kumisan : "Atawapicin nintcagis, no ko !"25 Midac ka e ga t ka iji a- tawapinat a c a /u mindimoya.1Miya au pa e jik manito, "it is one of the manitous;"more literally,"it iscertain manitou."
""Rubthey13Now, this the woman did : in spiteof what she wastold, she exposed the little bunny to the heat of the fire ;that she might dry its hair, she turned it over with itsother side near the fire.And this thought Nanabushu :I be dry from the heat.""Bythis time surely mustYet at him laughed the women.And this he thought: wish a spark would fallupon"Ime." Sure enough, a sparkfellupon him. After he wasset on fire, then out of doors he leaped.And this said the women: "Look at him, out of doorsis he running with the fire !"said to their father."Too bad!" said the old man."Truly, indeed, are youunheedful of what is told you. Doubtless it is one of themanitous l that has come to take awaythis fire of ours."Then, leaping to his feet, the old man ran to his canoe,but it was of no avail. He flung his canoe into thewater;but it was of no use, for it was frozen with ice. Andall they could do was to watch (the hare)far out on thegreat expanse burning with a blue flame, (watching him)tillthey beheld him pass out of sight.Of course theywere helpless to do anything.And then presently he was comingin sight of hishome. 3 Now, this he had said to his grandmother beforehe started :away Be preparedifperchance I truly happento fetch the fire,"he (thus)had said to his grandmother.Afterwards he addressed her when he was coming in sightof their home, and this he said to his grandmother whenhe came flying in :the fire off from me, amI!"burning up, my grandmotherWhereupon truly off from him did the old woman rubthe fire.*Andawut, "his home;" literally, "where they dwell."
,"ogri,"ogriO^oogrrnari14Mldac 4 8 i /uima kauntinamowatC 8 /ui iickuta.Oo widac krr kito a 8 a /u Nanabucu: "Mlsa i u ka ijinagusita 8 a /u wabos 4 8 i /u tcinlbink." l3. NANABUSHU SLAYS HIS YOUNGER BROTHER.Anlc mlsai i u cigwakro tickutamiwat. Anlc misai5 ka ijiwawltigamatIni /u o kumisan win kawi ka pizan krayasinon wu 8 6 ki tcigami. Wabos namatapit ijini katatugwo 8 o ki tcigami. Mldac a pana mojag 4 8 iwidi klaVinamatapit.Oo widac ogii nan Ini /u o kumisan :no ko, ml-f* 11 mini k kawabo n kMldacsoyan."1 -"Ambasano,is>rwidi10 yanayabi kagwan, mldac widi i i ugitapi k pana kl u-nabit.Mldac ka-i-cinagwa k 4 8 /u i asin. Mldac ka i- kitut : "Wabosnamadabit ugai cini katanawauoguanicinabag."Anlc misa i u clgwa kra-nicinapawit. Kawm kayab1kra binotci rwisl. Wircr ugri nan lni /u o^kumisan :ki tci-"Kigi-15 kanimina ayawiyan?""Kawm," ogri gon mi /u o kumisan."Ninisa Nanabucu ninta u ."oglinanIni /u o kumisan :"Kuniga mlgu i^ 11 ajipajiguwanan!"Ini /u o^kurnisan.8"Aye gon ; "mlgu i* 11 ajipajiguyan," ogri gon20 o kumisan.O^o-widec ogri nan :Ini/u"Ambasano manu wlndamawicin,"ogrrnan ini/u o kumisan."Kuniga ningi O O simitug!"8I"kawln"Aye gon ;kmagusisl awagwan a 8 a /uka a O siyan," ogl i gon Ini/u o kumisan. O 8 owidac ogii gon1That is, as if he had been scorched by fire.
"5Therefore such was how they there came into possession of fire.And this said Nanabushu : "Therefore such shall bethe look of the hare in the summer-time." l3. NANABUSHU SLAYS HIS YOUNGER BROTHER.Now, therefore, were they then in possessionof fire.So now afterwards, while he lived with his grandmother,never still was this sea. Seated-Hare was perhaps thename of this sea, for it was always his custom to gofrequently over there and sit. And this he said to his:grandmother Now, my grandmother, it is now longenough that I have been a And hare." so at that placethere must have been a promontory jutting (out into thesea), and over there on the top was where he always sat.And now such was the way that rock looked. And thiswas what he said: "Seated-Hare shall these peoplecall it."So thereupon he now became a human being. Nolonger was he a child. This he said to his :grandmotherknow who I am?""Doyouhe was told "No," by his grandmother."I am indeed Nanabushu." This he said to his grandwonder if indeed I am an only (child)!"hemother. "Isaid to his grandmother."Yes,"he was told."Trulyare you but an onlyhe was told (child)," by his grandmother.And this he said to her: "I wish that you would pleasetell me,"he said to his grandmother.have had afather!""I wonderif Imay"Yes,"he was told."Theycould not see whoever hewas that was your father,"he was told by his grandmother. And this he was told by his grandmother: "Dead
!"utanugrii6Ini /u o kumisan :"Kinibu a f:a u :ogiyambanKawin kitagatarnosinon."ajiwlndamonan.O^ O widac ogri nan a 8 a /u Nanabucu :misaguir 11"Anln kakicinagwak kapaciguyan ? kagatamawiyan," ogri nan Ini/u cVku-5 misan. Mldac caylgwa kri- kitut: "Anln wandci-i-citcigiiyani^i 711 katamawiyan 4 8 iwisa ka ijiwabisiyang? Kawinpo tc niwanandazin i i wisa ka ijiwabisiyang. Ayawagisanintinandam ni n tcikiwayang. Mano taga wlndamawicini i wisa ka i jiwabisiyang."10 Mldac klsagimigut11aV mindimoya. O o widic ogri nanmi /u ocica n :yan "Anlc, kigawindamon, kae ltga kawin kiglpajikuziwisa i i klmgiyag. Ka^ga t kanangwanawm : wu*okigl i jiwapisim, kigmisawaKa e ga l tanica kami kwandamanl15 dac ka u ndcini k tawigi i*nan."la a u kigiwa l s u i i a pi naguyag.s /u i i wa ijitcigayan iYwisalij:i /uO o widac ogri nan Ini /u o kumisan n : "O, minangwanaC 8ka i i ijiwabisiyan/u !kamgiyan Anic, kawin nm ningmisasic a s a /u Mldac i ininga."ma kl i nandank. "Intawaningatawiwabamag,"ki i nandam;/unitcikiwa n yag.""Igi20 Na, midac a p! kri nat lni /u o kumisan. "Tndawaningatawiwabamaa c a /u lka klwaci it."7"Kagugon lni /u o kumisan. "Anln ka u-ndci-icictcigayan iY 11 l a c a /u kltcikiwa n zi i i wisa ka*u ndcinantopanltawatupan?"25 "Kawin," ogri*nan-, "potc nlwrijictciga."Mldac a pin 1 c is a free rendering of an adverbialKa ga tkanangwanavvin, "as true as I speak,"expression, but"perhaps," given in some such phrase as "truly,did the event orthing happen."
"7is she who was your mother : thatis all I can tell you.Not would I hide it from you."And this to her said Nanabushu : "How could itpossibly be that I should be the only (child)? You must behiding it from he saidme,"to his grandmother. Andthis now he said :Why do you behave in such a waythat you should keep from me that which has happenedto us? Inspite of all that, not am Iignorant of whathas happened to us. In existence somewhere I am sureare my brothers. Please do convey to me the knowledgeof what happened tous."Thereupon frightened became the old woman. So thisshe said to her grandson: "Well,I will tellyou about itOf a truth were you not alone at the time when you(and they) were born. As true as I speak, 1 this was whathappened to :you (and them) you (and they) killed yourmother at the time when you (and they) were born.Verily, had I not carried out the purpose 3 of my mind,I could never have reared you."And this he said to hisgrandmother: "Oh,so thatwas the sort of thing that happened to me when I wasborn !Why, it was not who I killed mother."my Whereupon he there made up his mind (what to do)."Therefore will Igo to see them,"he thought,"those brothersof mine."Accordingly, then was the time he said to hisgrandmother: "Therefore will I goto see him who mademe anorphan.""Don t!" in vain was he told by his grandmother."What is the reason of your undertaking that you shouldgo and seek for him ?""Nay,"he said to her,"rather am I determined to do2That is, of making him an instrument whereby a new order of things shouldcome to passmother earth.in the world. It should be borne in mind that the old woman is2. PUBL. AMER. ETHN. SOC. VOL. VII.
,"i8kimadci tatl s /u li i ubi kwa kon krirji tot. Mldac ka*i*jikiji tat,mldac a pi cigwa klmadcat ;mldac owidi kwaya k cawanungka i jimadcat. Anlc oglki kaniman iwidi ayanitwltcikiwa n yan. A pii dac rrwidi pajwandankiwidi andanitIni/u5 mwingidac ugi a santcigtinan Ini /u ublkwa kon. Mldac a pii*i*widika*i*ji o*tisat, mldac ka ijiplndigawat. OVwidacogri gon Nanabucu : "Mlsa 4 8 /u i ?"pinandopan^tawiyan"Aye8ogri nan."Anlc mlsa cigwa tcimadci kutatiyang."10 Anlc mlsa cigwa klmadcrkutatiwat, mlsa cigwa klpimutiwat.Aji a janici kawint l a s a /u Nanabucu ka i jiirdi tanklni /u ubi kwa kon,i i ma klpi a santcigut.Mri ma rninawaka u ndci a janici kawat, mldac plnic andanit ka/rjipagaminiskawat.Mldac ima mlnawa ka-u-ndcra janici kagut,15 mldac mlnawa ri widi klpra santcigut lni /u upikwa konka i jipagaminickagut. Mlsa minawa anugri jiacanici kawat,pacutac ogriji a-canicikawan. Mldac minawa ri ma kau-ndcia janici kagut, mlnawa ogluti tanan lni /u upikwa kon.Mldac i i ma krrnandank :"Mlmawin l e /ui itcimamacri o pfo-20 yan."Ka e ltga a pitci pangl udayananlni /u upikwa kon ;mldac a pitci angasl n natinik. Mldac cigwa klmawit, o o widackri nandam : kri nandam.s"Mlmawin /u i itcinisiguyan,"Midac ka piijikanonigutlni /u cingusan:"Aninandiyan?kwandigukuca kima/u , Nanabucu," ugrrgon lni /u cingusan.
19it." Sothereupon he then set to work making somearrows. And when he was prepared, he then set out; itwas off in this direction, straight toward the south, wherehe started for. Of course he knew that at the place wasthat brother of his. So when he felt that he wasabidingthen in four differentnearing yonder place where they lived,places he hid his arrows. And when over there he hadarrived, he then went into (the place) where the otherwas. And this was what Nanabushu was told: "And soyou have come looking"Yes,"he said to him.for me?""Then we might as well now begin fighting with eachother."So thereupon started they to fight with each other,and then soon were they shooting at each other. WhileNanabushu was being forced back, he came to where hisarrows were, there where he had concealed them. Thenin turn back from this place he drove the other, evenall the way to the place where the other lived he drovehim. Thereupon back from that place in turn was hechased by the other, and again back to where he hadconcealed his arrows when on hisway hither was hedriven. Then again he tried in vain to drive him back,but only a little distance he made him retrace his way.Whereupon in turn from that place was he driven back,once more he came to the place of his arrows. And sothere he thought:"It is possible that I may be vanquished."Truly, very few were the arrows he had ;for now veryfew they were. Whereupon he now began weeping, forthis he thought:"It is like enough that I shall be killed,"(thus) he thought.Thereupon came a Weasel, by whom he was addressed,saying:"What is the matter with you?It seems as ifyou have been crying, Nanabushu," he was told by the
2O"Kawin nino-utano o kigatisl. o Nacka kigawmdamon okadu-cictcigayan," ugri gon Ini /u cingusan. "Nackagutarrmaina-a/n," ugligon mi /u cingusan ; "pimutamawi i u osagipanwan."5 Midac a pl kisasa kwatla s a /u Nanabucu. Ningutingigumadcinicikawat Ini /u wltcikiwa n yan. Midac ka i jipimutamawatw fii iosagipanwanini. Midac acitcinkitcisanit. Acimawinanatl a c a /u Nanabucu, o 6 widac ugl i-nan :"Manu nibun!"O O widac ogri gon!ni /u wltcikiwa n yan:"Kagatsakitini-10 ga a* as a /u l pitcinag aV u kanipimadisit."Midac ka ijimawinit,ml I 9 /ui i kamawimat anicinaba c . Kawin anugri*-nanda n z! i^Visa tcinisint.A pitcidac kri*nandam wa c a /u Nanabucu wlnisat. Midacka/ijikacki tot kinisat Ini/u ucPmayan.15 Midac atcina klclpayantamon."Mackutklgamganis o 8f o witi ka i jawat ogo /u kanipimatisisigukmi i witi tci a*yayan, mri witi tcinlganisiyan."Anic midac ka e gakidiniga a"Mamindaga20 matisit."lt ka ijina kwa tawat mldac ka nat i ji i :1 ;a c a /u anicinaba pitcinag wanipi-cosamisa,"Ayetanonta mockina o^o /u a l ki. Anlndidackani o*ntatisit?tci-aya pan aVwisa anicinaba *a c a /u pitcinagMidac intawa l s /u i i ka irntci ijiwabisit l a s a /u anicinaba 4 R /uitcinibut. Na r ,ls /u i i wandcri citcigayani i^wisa tcinibut25 a c a /u pitcinag ka a-nimockinat o O man a kmg, o o ka irjitoyano a ki. Anawi kitakri si ijitcigamin /upanima kawlgikat tciglnibo pan, kawlndac ningutci ta*a*yasl wo^ o1Kitiniga-a- a e a u are , "you doing wrong to them." . . . The object of the verbis singular, but the sense is plural. The Ojibwais fond of this construction, andit is of frequent occurrence in the texts.
"21Weasel."Nothing (harmful) is going to happen to you.Listen !(and) I will advise you what you are to do,"hewas told by the Weasel. "Now, right at yonder place doyou shoot,"he was told by the Weasel. "Shoot at thewrap (of his hair-knot)."Thereupon was the time that Nanabushu whooped.Once as he began driving his brother back, he then shotat the wrap (of his hair-knot). Thereupon the other fellforward. Then to him ran Nanabushu, and this he saidto him: "Please die!"And this he was told by his brother: "Verily, you aredoing wrong to them : who in the future are to live."Thereupon he wept, as it was for these people he wept.Not was he willing that he should be killed.But thoroughly determined was Nanabushu to kill him.Whereupon he then succeeded in killing his younger brother.And so for a little while was the other out of his wits."Insteadyou shall be leader over there where will gothese who are to die;in that place shall you remain, inbe foremost."that place shall youSo then truly, after he gave him answer (and consented),this was what he said to him :brought upon the peopleParticular harm have youwho in time to come are to live.""Yea,overmuch (and) too soon will this earth fillup.Where will live the people who in after time are to beborn? Now, therefore, this is what shall come to pass,that people are to die. So, therefore, this is why I havebrought it about that they should die who in times tocome will fillup this earth, this earth which I have created.Although we could bring it to pass that not till they havereached old age they should die, yet nowhere would theyhave room if this should take place. Therefore this ishow it shall come to pass that while they are yet ininfancy they shall die. Such, therefore, is what I now
22Wuijiwaba k. I 8Na, midac ka/irndcri jiwaba ki imagwaabinodcri-wittcinibut. Na misa u i, wayabantaman,midac tibicko ka/rjiwabisit a 8 a /u pitclnag ka a ninibutItibickogu ka ijiwabisiyan. Anicasa tayanda kl owat 1 paji k5 a l ki.Ayayan tcinasi kawi k ka a-nri ckwayat."4. NANABUSHU KILLS ANOTHER BROTHER.Na, misa ka/ijictcigatIa 8 a /u Nanabucu. Na, midaccigwa kra-ndawabamat Ini/u o^kumisan. Midac mlnawakra wltci a-yawat. Nigutlngigu mlnawa ka i-ci i- kitut 4 8 i /uwinandunawat lni /u paji k wltcikiwayan, oPo dac ugri gon10 Ini /u o kumisan : "Kawm kidanisasl," ugri gon Ini /u o kumisan."Pa tanlnowan I 8 /ui ikanawanimigut. Midac ka irndcikaskitosiwamban.Nackaguta klgawmdamonka-i cinamambabanmisawa icayan, Amc minising aya a fi a /uluka kwan a 8 a /u tcaglga a nk. Nackadac, o O ma 11 nawiki-15 tcigami plgi /u ta kamakuntcin. Kawm kitakackitosm tcikapikawatipan misawa tclman anu a yoyan ; mlgo i ma 11ka kina kajaku kat kitcimaning. Na, ml^i 11 abitink kirrjinaman.Mlnawa paplmickaiyan misawa 4 8 ima n anigacki-Q-yan, mlnawa kago kigawabandan, cingwa k klgai nan-20 dam. Midac a s a /u ki s tci o ga omi s tciga kawabamimat.Kawln dac potc kitakackitosin misawa anawlwlmackawat.Na, misa i i ma n abitink 4 8 i /u sanagusiwin andaguk. Misawamlnawa rrma anikackioyan, kuma x tacigu a pl papimickaiyanklgatababandan ma i i ayat. Mldacigu pacuwabanda-25 man, klgawabamag was wag tciba ta rnowat. Midac kawm
23see. It is the same thing that willhappento them whoin the future are to live, and like unto what is now happening to you.It isonly a change of going from oneearth to another. To you where you are shall come theywho shall cease to live (here)."^^-4. NANABUSHU KILLS ANOTHER BROTHER.Such, therefore, was what Nanabushu did. So accordingly he went to seek his grandmother. Thereupon againhe went and staid with her. On another occasion whenhe said that he intended to goand look for another ofhis brothers, then this was he told by his grandmother:"You would not be able to kill him,"he was told by hisgrandmother. "Manyare they under whose watch he iskept. That is the reason why it will be impossible foryou to succeed. Give ear, and I will declare to you whatyou are likely to see should you by chance happen to go.Now, upon an island abides he that hews uponhis shin.And listen ! Out across the middle of this sea some pitchextends, floating upon the water. Not will you succeedin passing (by that place), even though you should try tomake use of a canoe;there on every part of your canoewill (the pitch) stick. So that is one of the things whichyou will see. Furthermore, as you go paddling along,should you by chance succeed in passing in your canoe,then something else will you behold, some pines youwillthink them to be. That is the Great Pike whose big finsupon the back you will see. Not at all will you succeedifyou wish to pass around. Therefore that is one ofthe difficult places lying in (your way). Should you againsucceed in passing the place with your canoe, and thengo paddling on a certain distance, you will come in sightof the place where he is. And as you approach theplace, youwill see some swans that will be in a swarm.
"24/>ukltakackitosm mlnawa anawi wlmackawatwa. Mri kanawanimiguta 8 a /u wanantunawat. Wo O widac klgatinawa 8 a /u wa 8 wa awagwanni tam kanontagusigwan: Cii!kigatina. Nacka a mackwat 11 wabisfpin, kigai na. Mldac5 ka/rjinlminamawat o o dac ta kito i wa8 a /u wa s wa : ^Nimal/ul!ni wabisipinln, a s a /u wa s wa ta i- kito. Misawadackamigmlnawa rrma anikacki o-yani i ma 11 mlnawa abiting kayabi.Mldac cigwa tcigl kabaiyani i ma ayat. Mldac anigu piyantmdisiwan nondagusinit. Tabltciba to, o o dac klgatcictcigit ;10 mi tigumin klganlminamawa. Mldac ka*i 4 kitut: Nima l 4 kamig7i ! mi 11 ltigumin a s a /u tindlsi tai kito. Midac mlnawa i i matclpitagwicing a^wisa i i ma ayat minising."O O widacogi i gon ini /u o^kumisan : Wantcita nawiminis tanandawabamat. Wa kwagan s /u *i i andat."la s a /u15 Na x midac a, pl kamadci tat l s /ui i ki uji tot ; 8 /ui i utclman.A pii dac ka klcitot mlnawa ka i cinantawabamat nlganiguwaninunit ini /u awaslyan. Ka iji u ci tot iYwisa pimitamlgu iu ka kina ka/rcina 8rnang /u i iwaya batci tot. Mlnawaugi a ndawabaman wabisipinln. A pi mlnawa kamamat20 lni /u wabislpinin. Mlnawa ogra ndawabandanan lni /u mi tiguminan.Anic mli^ caylgwa krkijftat. Mldac a c pi klmadcitat lni /u upi twa kon kruji tot. Mldac a pl kaklci totIni /u upi twa kon, "Anlc mlsa cigwa wlmadcayan," ogri nanIni /u o kumisan. Wo O widac ugii nan : "Anlc mlsa wlnan-25 topaniyan," ogri nan lni /u o kumisan. Oo widac kri- kito :tcra/cawa cryan o o"Nlyokun ningataci c -ta wo oki tcigami.Anlc mlgu i 11mini k ka a nwa tingi8^ 11 myokun," kri- kitoIa 8 a /u Nanabucu.Na r midac,cigwa klmadcat, kl pozit 4 8 /u i utclman.
25And now youwill not succeed again, even thoughit beyour wish to pass round them. So in the keeping ofthese is he whom you wish to seek. Now, this is whatyou will say to the Swan, whichsoever shall be the firstto make itself heard: Hist! you shall say to it. Look,here is inpayment a white potato, you shall say to it.Thereupon as you offer it (the potato), this is what theSwan will :say He istaking from me the white potato,the Swan will say. And ifby chance again through thatplace you succeed in passing with your canoe, there willstill remain one other (difficulty),and it will be where yougo ashore there where he is. And when you go up fromthe shore, a Bluejay will be heard calling.He will comerunning hitherward, and this is what youshall do : anacorn shall you offer to And it. this is what it will :sayHe istaking the acorn from me/ the Bluejay will say.So then next to the place will come he who abides thereon the island." And this was what he was told by hisgrandmother: the "In very centre of the island dwells theone whom you seek. At one end of it is his home."So thereupon he began upon the work of making hiscanoe. After he had finished it,he then sought for agame-being that was unsurpassinglyfat. After he hadmade the oil, he then put awayall that he expected touse. Next he sought for a white potato. After he hadobtained the white potato, he next looked for the acorns.So therefore was he now fully prepared. And then waswhen he started on the work of making his arrows. Now,when he had finished making his arrows, "Now, therefore,I want to be off (to war),"he said to his grandmother.And this was what he said to her: "Fourdays I shallspend crossing this sea, for the length of time that it willbe (calm will be) four days/ (so) said Nanabushu.So therefore he started away, he was in his canoe.
obri26Ningutingigu kae ga t papimickat ri wisa ki s tcigami cigwagaga/t oglwabandan kago ta kamakundanik."Anlc,"ogri gon lni /u o kumisan *o fi o /u "kawln;potc kitakackitosintciwlmackaman" ogri gon Ini /u o kumisan. A4pri*dac wadi-5 tawat Ini /u lpigiwan, mldac ka/rjiposinank /u i i utcimankaya 4 8 /u i utabwi;mldac ka i citca kisat, mlsa kakanagapangl kra gukaslwani i ma utcimaning kaya utabwlng.Na x ,mldac ka^gatwiwaylba klposinank ^Y utciman kayaW11utabwi. Mldac ajikackitot klgabi kawat Ini /u pigiwan.10 Mldac ka/i jimadcru-t. Ningutingigu mlnawa papimickatml cigwa gagatogiwabaman cingwa kwan kri nandam.Ajigwa ubacwabandan, kuninginln mlwa / nini /u ki tci o gawan.Ocrwidac ogri nan a piwadi tawat: "Ambasano kawa kunIgi /u kimistcigu t," ugrinan Ini /u tcro gawan.15 Mldac ka e gat ka ijictciganitini /u tci 6 gawan, mldacajikabi kawat. Mldac a pi kltababandank 4 c i /u wa ijat.Cigwa obacwabandan, cigwa kae ga t owabaman lni /u wa !:wan.Cigwa owabamigon Ini /u waVan, cigwa nondagusiwan."Ic!"ugri nan. Ka i cimminamawat Ini /u wabisipinin.20 Ci x gwa pitcipa towan."Ic,anln andiyan?"nani."Ka, nima^kamig c a c a /u wa s wa ini /u wabisipinin," ki ckitoiawa s wa. O 5 widac kri- kito : "Anln win kaya win manakackia t Ini /u wabisipinin?" oglprrgon.1125 Mldac anicikiwanit anlc ki kasu aV Nanabucu. Mldaca pl mlnawa kanicimadcat. Ka i cikabat mldac ima 11ka kina klnagatank Ini /u udabatcitciganan.
27Now, truly,once as he went journeying by canoe overthat sea, he now indeed beheld something lying lengthwiseupon the water across his "Toway. be sure,"he hadbeen told by his grandmother about "inthis; no waywillyou succeed in passing round he had been toldit,"by his grandmother. Now, when he was approaching thepitch, he then oiled his canoe and his paddle and when;he drove his canoe into (the pitch), not even a speck (ofthe pitch) was stuck to his canoe or his paddle. So it wastrue that every now and then he kept oilinghis canoeand his paddle. So thus he succeeded in passing throughthe pitch. Thereupon he continued his way. And anothertime as he was journeying alongin his canoe, he nowtruly saw some pines, he thought. Soon he got a nearview, and, sure itenough, was the Great Pike. And this"he said to it when he drew up to it : Please lower thefins of your back,"he said to the Great Pike.And then truly, after the Great Pike had done so, heover it. And then was when he cameaccordingly passedin sight of the place whither he was bound. Presentlyhe got a close view of it, now truly he saw the Swan.Soon was he observed by the Swan, then it was heardcalling."Hist!" he said to it,after which he offered itthe white potato.Then it came running."Hist! What is the matter with you?"to it said (themanitou) coming (to it)."Oh,from me is he taking the white potato!"said theSwan. And this he said:"Whyis he not himself ableto procure the white potato?"he was told bythe othercoming hither.Now, while the other was on his way back, in hidingof course was Nanabushu. And that was when he continued on. After he went ashore, he then left behind all
"AwlyasaMldac""i28cigwa kaga t anipapimusa/t. Kaga t owabamigon tindlsiwan; cigwa weyabamigut tmdisiwan ajinondagusinit. Ka/rjiniminamawati si /u mi tigumin, mldac ka/ijiklckuwanit.Cigwa mmawa kipitcipa tonit.Ic ! aninandiyan?"5 ogrrnan Ini /u tmdisiwan.O o widac kri kitu a c a /u I 8tindisi : "Nima i ikamig/umi tigumin."lA 8 a /u tindisi : "Anmogri gon win kaya winmanakacki totC 2 /ui i mi tigumin?" a pl mlnawa klniacakiwanit.Mldac cigwa mlnawa kimo kit a 8 a /u Nanabucu.10 Anic animamadcat, cigwa tababandamawanI8 /ui iandanit.Kaga t ki tciwaya kwagan. Mldac ajrcrdisat madwa i-gawani i-ma andanit. Mldac ka/rcita pabamat i i man andanit,kunigimn I 8 /ui i uka kwananan tcagika a-minit ! Mldac kanawabamat,kawin kanaga pmabislwan.15 Midac caylgwa kipasigwmit migui u aka i cawabisaniko katini;mldac ka/i jipasigwlnit migui u ka/i cicawabisaniko katini pimusanit. Kagagu po kusaniwan, kagasagu kawisawananicagu aswa kwlwan. Oo widac kri- kitowankanawabamat :k."ninganawabami Kri- kitoa20 mlnawa, o-o widac krr kito :Awlyasa undcita ninganawabami k." Mlnawa ka ijimadci tad kitcigika a-nk I 8 /u i iuka kwan. Ka ijipasigwlt mri gu u ci iajicawabisanik/uu katini; pimacigamaniti i-ma n andanit, ka/ijikawisanit."Kaga t nangwana awiya ninganawabamik."Ka pijii na-25 binit, pitclnag ka/ijiwabamigut 4 8 i /u ta pabamat ;o o widac
"Why2 9of his equipments. After he had gone up from the shore,he then truly went walking along. In truth, he wasobserved by the Bluejay; as soon as he was seen, theBluejay was heard callingout. After he had offered itthe oak acorn,it therefore ceased its cries.Now again came the other running."Hist! What isthe matter with you?"he said to the Bluejay.And this said the Bluejay:"He took from me the oakacorn." The Bluejay was told by the other :ishe not himself able to procure the oak acorns ?" Thereupon he was on his way back home. Then was whenagain Nanabushu came out of his hiding. Soon on hisway he slowly went, till presently he came in sight of thedwelling of the being.It was really a very long lodge.And as he was coming up to him, he could hear himpounding upon somethingin where he lived. And sowhen he peepedin at him there in his dwelling, behold,it was uponhis shins that he was hewing! And so hewatched him, but not a look did the other cast up at him.And now presently the other started to rise to his feet,whereupon his legs were bent and when he had risen to;his feet, then wabbling were his legs as he walked. Andnearly were they on the point of breaking, and almostwould he have fallen but for his holding on to something.And this he said as (Nanabushu) was watching him: "Bysomebody surely am I watched," he said. He spoke again,and this he said:"By somebody surely with a purposeam I watched."Again he went to work hewing upon hisshin. When he rose to his feet thereupon bending werehis legs as he walked beside; (the fireplace) there wherehe lived, he fell over. it is a fact that "Truly,by somebody am I watched." After he had looked up towards(where Nanabushu was peeping then in), (Nanabushu) wasseen peeping in at him and this was what was told;
wlndamonan."30a" : "Paogri gon Nanabucu, ugrrgon ka a kawa, pamaplndi^ka/kan1uoa iO Oofdn.Mldac ka rcikanawabamat cigwa mlnawa ugikanonigon,"Mri - 11ijipmdigan," ugrrgon. Mldac ka e ga l tajipmdigat.5 Anlc a picimonikawan ri ma tcinamadapit.tKaga mi i ma11ka i conabit o o*widac ogl gon i :"Kagatsa, Nanabucu,kimanito 1 klpigacki O yan wisa wf i i piwabamiyan. Kamawlnanica kipijasi," ugri gon.Ocrwidac ugiinan:10 Nanabucu."Anicasagu nibrija," ugri nan a c a /u"Kawm anica kibljasl," ugri gon.Anlc utanu a-gunwa tawan 4 8 i /u igut. "Anicasagu kipimawadisin,"ugri nan."Kagatsa kimanito 1 , Nanabucu," ugrrgon.15 Anlc misa pisani i ma kikakanonitiwat. Ocrwidacogl i nan :ugi i nan."Wagunankin kwa taman ks /ui ikanisigwiyamban?""Mlnangwana i u gagat anica prijasiwan," ugl i gon."Kawm," ugl*i*nan ;20 bamin idac," ugri nan."mini kina i u anica kitatacikanawa-8o,""Ayed dac ogli gon: "Iwa ojawaskwanwins upigwackunk kaya dac plwanak naba igank, mlsai tcinisiguyamban./>uNa, mri Kinidac, Nanabucu? Wagunanii ukanisiguyamban?"25 Wo 5 widec ugri nan :"Igi ublwayackinagtangickawagwa, mlgu iu tcinibuyamban," ugri nan./upangiguAnicadacugri nan. Kawm kaga t tcinibut, iwisa awa n sinini ikanisigut. "Anlc, misagu i xi umini k kakanoninan."8i /u
Nanabushu, he was told: "Waityet a while, by and bycome in,"he was told.And so after he had been watching him, then was henow once more addressed: "Now come on in,"he wastold. Whereupon trulyin he went. Now the other laida spread there for him to sit down upon. Truly, sat there, this he was told: "Quite true, Nanabushu, areyou a manitou being, since youas hewere able to come hereby canoe for the purpose of seeing me. I suspect thatyou have not come without a purpose,"he was told.And this he said to him: "For no special object haveIcome,"to him said Nanabushu."Not for nothing have you come,"he was told.Naturally he tried to disavow what was told him. "Ihave come only to make you a visit,"he said to him."Verily, indeed, you are a manitou being, Nanabushu,"he was told.So therefore in a friendly way they there conversedtogether. And this (Nanabushu) said to him: "What doyou fear that would kill he said to him.you?""It is quite evident that you have not come for nothing,"he was told.he said to "Not," him, so "for long a time would Imerely be watching you (if I had come for hemischief),"said to him."Yea,"and this(Nanabushu) was told: "It is a tinyblue missile upon an arrow, and a piece of flint fastenedon for a spear, by such should I be killed. Thus, therefore, have I told you. Now about yours, Nanabushu? Whatis it that would kill you?"So this he said to him :"If Ishould gently touch thosecat-tails with my foot, then would I die,"he said to him.Now, he was only deceiving him. He was truly notdestined to die, that was not the thing by which he would
"Mmangwana32jipasigwlt C a 8 a /u Nanabucu ka pri jimadcat rrma n utclmaning.Midac caylgwa krtrjrtat4 8 /u i kawlndaminit ui8kanisigunit. Mitac /u i iklpigwaku kat. Kaklci tot, midacsasa twat klmawinatank 4 9 /u iwlgiwam.5"Micanim!"ugri gon Nanabucu.gaga tpinantupanftawit," ugri gon. Minangwana gu i u ka pisaga*a-nkmadawananigubanan 4 8 i /u uplwayackina 8 ; klpincligananiti i*man andanit. Amc midac cigwa pacwabandank4 8 i /u wlgiwam, midac sagisltagogubanan. Midac ka ijipim-10 wat upi kwananing, wantcitagu na U pikwan ugrrninawan.8Midac kanljicawabipitonit /u i i ubikwa k, midac ka/rjigwaniblt;midac wmi tam ka*i jipimmija irgut, wlni tam ka i jipimugutnaarpi^kwan. Amc midac kaya win ka/rcicawa-I 8 /u i i ubikwa kuni.bipitot15 Midac rrma 11 klwam kat8 i iuta, ningutci ki a- tosigi i wisa uta. Amc mrrma n pitclnag klmi kwandank i i wisaningutci tcigra- topan i O ta. Midac kaijimadcinija i gat ;midac a pl ani a timat, ka ijipimwat. Midac wlni tamka pii ci u cimut. Midac a timigut ki pimugut. Anic m igu ku20 ka todank c s /u i ikljababitot c c /u i i ubikwakuni. Anic wmi tamka*i*jimadcinicawat. A pri dac ani-a tamat ka ijipimwat.Amc mlgu kljababitonit.Anic misa cigwa minawa wini tam kipiminica*u gut, cigwaminawa uglpimwugon. Midac caylgwa anawi anagucini-25 nigubanan. Midac inandamitgubanan: "Mlmawln u i tcimamajikri nandam. Anic i t," cigwa upiminicawan, midacminawa kra wipimwat. Anic mlgu ku kato taminit cawaba-
33be killed. "Now, this is all that I have to say to you."After which to his feet then rose Nanabushu, who cameaway to the place of his canoe. Whereupon he beganpreparing what the other had said would kill him. Andso he made the arrows. When he had finished them, hethengave a whoop as he made a rush upon the wigwam."You wretch!" was said to Nanabushu. "It is reallytrue that he has come to war against me,"was said to(Nanabushu). Now, just as soon as (Nanabushu) had goneout, then was when he began drawing the cat-tails he;had taken them inside of the place where he lived. Now,when (Nanabushu) approached the wigwam, he then ranout. Whereupon (Nanabushu) shot him in the back,squarelyin the middle of the back he hit him. Andafter he had pulled out the arrow, then (Nanabushu)retreated;it was then his turn to be pursued, and histurn to be shot in the middle of the back. So thereuponhe also had to pull out the other s arrow.And so there (Nanabushu) forgot his heart, somewherehe had put that heart of his. Now, it was at that verymoment that it occurred to him that he should have putaway his heart. Thereupon he rushed to the attack and;when he caught up with (the other), he then shot him. Andthen it was his turn to run away. And when he was overtaken, he was shot. Now he did what he had done before,which was to pull out the other s arrow. So then in turnhe pursued him. And when he overtook him, he shothim. So then the other pulled out (the arrow).So then another time was (Nanabushu) pursued,nowagain was he shot. It was now, to be sure, growingevening. And this was his thought at the time: "I believethat he will overcome me,"he thought. So, then, now hechased after him, and then again he went and shot him.Now, that which the other kept on doing all the while was3 PUBL. AMER. ETHN. SOC. VOL. VII.
34bitonitls /u i iubigwa k. Midac mmawa prircimut. Midacri ma pimawit.midac wandcisagisit. Ocrwidac ugrrgonIni /u Maman :Amc mra/ tanijininigIni /uubigwa kon,"Aninandiyan?" ugrrgon ini /u Maman."Kwandigtikuca5 kimawi Nanabucu?"8anic misa 7 "Aye ,nibuyan, nicimisa.""Anin ka tiyan kanibuyan? O*o* icitcigan ;kawmkitanisaslrrma n wlyawing anuglpimwat. Nacka,i i ma icipimwatusagipinwaning."10 Mldac ka e ga l t ka ijicictcigat.O 5 widac a pianiatimatI8 /u i ika-ijipimwat, kagagu uml kunamawan I 8 /u i iusagipanwanini,mldac kaga ka i jipangicininit. O O widac ogrrgon:"Anlndi a ka ana*a-yan, Nanabucu?"ttAye s ,"ogrinan. "Ta^wanrnac i pitawan lni/we anwm15 magadingin."Mldac ka rcigwanipit. Mldac a ta pacigwaninig4 8 /u iubigwa k mldac manu wasa ugra^ pa a-n.Cigwa minawa /uuglpimwugon, kayabi pa tanma tiniwan lniupigwa kuni. Mldac ka-ijiabami tawat midac manu; pacuka i ci u ndinawat. Mldac ka i jimicutamawat l s /ui i utaski-20 bawanansan. Mldac ka ijipangicininit ka ijisasa kwat.Kapangicininit, mldac ajimawinanat ka ijitangickawat ;ka a i-ji capa tot. Minawa ka/rjimawinanat minawa kltangickawat;minawa ka i jia japa tot;minawa ka-i^jima/rnanat;minawa ka ijitangickawat ;minawaka/rjrajapa tot;25 minawa ajimawinanat, ka/ijitangickawat."Misa u i ka ijitcigata s a /u anicinapa tci-a^ni-a^kiwang misa niywing;kitangickawat misa u i mini k ka U ndiniit a 8 a /u inini;i i wisa tcimigatit."
"35to bend the arrow. And so again (Nanabushu) ran away.And then to yonder place he came weeping. Now therewere but two of his arrows left, and that was the reasonwhy he became afraid. Now, this was he told by theRed-headed Woodpecker: "What is the matter with you?"he was told by the Red-headed Woodpecker. "Is it possible that you are really crying, Nanabushu?""Yes,for now am Igoing to die, mylittle brother."Why is it that you should die This ? you should do ,not could you kill him if you should shoot him here in thebody (as you have been doing). But rather, the place foryou to shoot him is in the wrap of his knot of hair."Therefore truly that was what (Nanabushu) did. Andnow when he overtook him, he shot him, and he nearlyhit the wrap of his hair-knot, whereupon the other almostfell. Then this was he asked bythe target you are trying to hit, Nanabushu?"the other: "Where isare arrows"Yea,"he said to him. "Inmany a placelikely to fall during a battle." Thereupon he turned andfled. And since there was but a single arrow left, hethen with good reason ran a long way off. Then againwas he shot by the other, who yet had many arrows.Thereupon, turning about, he chased him; and then afterhe ran as close as possible upon him (tomake sure ofsuccess), he then shot, hitting his small head-gear. Andas he fell(Nanabushu) whooped. After he had fallen,then (Nanabushu) rushed upon him, and kicked him ;thenhe ran back. Again he rushed upon him ; again hekicked him; again he ran back ; again he rushed uponhim; again he kicked him ; again he ran back ; again herushed upon him, (and again) he kicked him. "Thus shallthe people do till the end of the world ;thus four timesshall they kick (an enemy); thus shall the number bewhen men obtain (honor) from one another in war."
"Kri^kitowag"36Mldac a pl 4 8 /u ika/rjimadci tat klpa kunang I 8 /ui iutuctigwanim.Mldac ka/rjipasank 4 8 /u iutuctigwanim. Mldaca pl kapa tanig 4 8 i /u utuctigwanini mldac a pl clgwa ka piklwat.Mldac clgwa mmawa kf pra cawa irt 4 8 i /u ki s tcigami.105 Kawlndac kayabi oglwabamasln!ni /u Tmdlsiwan kayaIni /uWa 8 wan, mldac ka pljiniminawa-ut;kawln kayapi ugiwabamasmIni /u Ki s tci O gawan kayasagu Ini /u pigiwan. Kawinisagukago oglwabandazin 4 8 i /u mini k ka a ni ijatanimadcat.A pl dac pagawat, mldac ciofvva kri nandank :JT IT O OlYwisa ka ijictcigatIa 8 a /u anicinapa tci-a ni a kiwank,"kri kito. Midac a l pl patagwicing, "Amantcigic ka ijayan,"skrrnandam. i iOgiwabama /u anicinaba 8 udanawi tonit,mldac kaga/tci x gwa wlnasi kawat 8 /u i i anicinaba 8 . Mldac15ka/i jra ca tat. Kago nangana utAiyan. Anlc mldac ka iji-I 8ki kiwa/u-ni kat midaci i uta n siyanic kanima kwa a nk.Mldac ka/rjrrnacit anicinaban ayanit. Mldac kaanrrjinagamut,anlc wu*o- kiinandam :Wagutugwanigic ka/irmbiigogwan wa 8 a /u anicinaba? Mlsa o ka U mbri gut, ka kinapamadisit uga crmbrrgun," kri il kito. Na, mldac a l pi cigwa820 bacwabamat /u i ianicinaba", mldac cigwa klanimadciyank ;o*o*widac krrna*a/m anlc miguna i u utaciyanic kanagamatot :"Wagunan wagunan wayaninabigamug?Ya aha yo hu yointca.25 Wagunan wagunan wayaninabigamug?Ya aha yo hu yointca."Mldac ka/rciwabamigutIni /u anicinaban. "Mlmawin ( a c a /uNanabucu !"kinawa kitinandam30"MlsaIlgi /u anicinabag. "Wagunani8i /u panlma kwa a nk? 58 /ui i, nintinandam, udaciyanic kamma kwa a-nk.""Anlc, kaya i-i man tabajlc kago uglnlma kwa a nini !"
"Why,37Thereupon he then began removing the skin from thehead of his (slain).And then he dried that one s head.And after that one s head was dry, he then started backhome. So now back he came over the sea in his canoe.And not again saw he the Bluejay and the Swan, sothen straight out to sea he went;and not again saw hethe Great Pike and also the pitch. And nothing elsehe saw of the many things that had been in his way ashe went along. And while he was on his homeward way,this now he thought:"This is what the people shall dotill the end of the world," he said. And when he was"Iarriving home, wonder if I should go thither," he thought.He saw where some people were living in a town, whereupon truly he then desired to go where the people were.Thereupon he turned back. Not a thingdid he have.So when he made a flag,it was his old soiled clout thathe had raised upon a staff. And then, carried along withwere. And as hethe wind, he went to where the peoplewent along, he sang, for this he thought: wonder what"Iwould rouse the feelings of these people? Bythis shallthey be aroused, all that live shall be stirred,"he said.So while he was now approaching the people, he thenbegan singing and this he; sang, for it was to his oldsoiled clout that he sang:"What,what is that which suspended from two corners hangs so limp?Ya aha yo hu yointca"What,what is that which suspended from two corners hangs so limp?Ya aha yo hu yointca."Thereupon he was seen by the "Thatpeople.mustbe Nanabushu!" said the people."What do you imaginethat is which as he comes he has raised upon a staff?""Thatupon ais,staff."I think,his old soiled clout which he has raisedthere below is something else he has uponthe staff!"
38Kunigimn, a pl rrma agwa-acinit Ini /u Nanabucuwan,kuniginln anicinaba uctigwan uglnlma kwa a-mlni. Mldacka-i- kitot: "Mlsa o 8 o ka-o mbrrguyag anicinabatug."IMri dac kaga/t ka/rciwabatinig. Kawm ganaga pang!5 klnibaslwag cigwa klki kino a maguwat 4 8 /u ikatijictcigawat.lO 8 owidac krr kito waV u Nanabucu : "Misawa ki tcikackandanka 8 a /u anicinaba mlgu i u ka-ijipapagwadandank,taya pa kawizl. Mlsa iu ka ijictcigatla s a /u anicinaba10 Mldac a pl cfgwa klmadcat kra-ndawabamat !ni /u o kumisan;ci r gwa ugl u disan Ini/u o kumisan, o o widac ogri nan:"Ha l a /n ,no ko, mamawicin, no ko!"MldacMldacka e gaka-i- l kitotct ka todank I a 5: a /u mindimoya.Ia 8 a /u Nanabucu: "Mlsa u i katotatit15 l a s a /u anicinaba tci-a-ni-a^klwank; kaga t ogasagi ton aV 11anicinaba 4 8 /u i tcrafni-a^kiwank;misawa ki tcikackandank,mlgu u tciwabinamowind W u agackandamowin wabandanki4 8 /u i anicinaba uctigwan. Misawa kago papamandasik,po tc ka kina awiya agacopi gun I 8 /ui i inindicictcigawin.20 Kaga t ugapapagwatcri gunawa Igi /u krr kitoanicinabag,"a 8 a /uNanabucu.Wo o ugri gonIni /u o kumisan: "Mamindaga kigri*nigapaa 8 a /u pamatisit 4 8 /u i tcitotatit. Nacka s *i /u i wantcrrninan.Nacka u i kimawinanat wa s a u kitcikiwa n l si isi,kimawinanatI25 l s i iwidec tcitotatit a 8 a /u pitclnag kanipimatisiti iVidacl 8wandcri-ninan; Igi /u abinotciyag, na, mlwagugi /u anigi a twa.Na x ,misa u i nln ajiwabandaman," ugri gon Ini /u o kumisan.
"39Lo, when to yonder shore drifted Nanabushu, behold,a hitman head he had upon a staff.Thereupon he said :"Nowby this will you be stirred to feelings of joy, O yepeople!"It was true that was what happened. Not for a momentdid they sleep while they were being- taught the thingswhich they were to do. And this said Nanabushu: "Eventhough grievously sad the people may be, yet they willfind consolation in this, they will cease from their sadness.Therefore this shall the peopleworld."do till the end of theSo thereupon he started upon his way to find his grandmother;soon he came to where hisgrandmother was,and this he said to her :Come, my grandmother, relieveme of this, my grandmother!"It was true that was what the old woman did.And this was what Nanabushu said: "This is what thepeople shall do to one another till the end of the world ;truly, the people shall be fond of (doing)it till the endof the world;no matter how bitterly sad they may be,yet they will be relieved of sadness when they behold theof theirhuman head. No matter what may be the objectin thisconcern, yet of necessity all are bound to find joythat I have done. Verily, from all their cares will thepeople be relieved by said Nanabushu.it,"This was he told by his "Vastgrandmother: harmhave you wrought upon the living of the future by causingthem to do such a thing. Listen to the reason why Itellyou. On account of that act of yours when youattacked your brother, that by your attacking him soshould the living to come do to one another,is the reasonwhy I tell you this ;the children,Isay,are the oneswhom you have harmed. Such, therefore, is the way Ilook upon it,"he was told by his grandmother.
"Midac4o8,""Aye ugri-nan a 8 a /u Nanabushu. "Anlc kawm nindakackitos!4 8 /u itciminutcigayamban. Anlc, aja nlngipatatcigals /u i inangwana 4 8 /u ikltotaman," ugrrnanini/uo kumisan. "Anlc, m n gaglbatis magwa apinotclwiyan,"5 kri- kito wa s a /u Nanabucu. Krr kito :ningltananagatawata n zl. Ka e gaa kitoyan,"ogi i nan mi /u o kumisan."Anic kawm atataltkitabwe, no ko,ls /u i iMl a kawa ka i nat mi /u o kumisan. Midac a pi karnadcat,mldac rrma n kiundcimadcat idac anodcigu kipapa i -10 jitcigat.Mldac miziwa kl ijat o s o /u a ki. Nackadacka ijictcigat o*o ma n a king.5. NANABUSHU AND THE WINGED STARTLERS.Mldac caylgwa anibapimusat ningutingigu oglwabamanawiya ukucininit. "Kuniga?"klwPsumwatug ugrrnan/uifi liwayabamat. "Mlnanga," ugrrgon ; "o o* ninticini kasomin,15 kuckungasinag, nindigomin."ka i ci-"Kagatsa, minangwani u i !"acinikasoyagmltcinat, o^oMac ka/rcrrnat : "Wa 8 a u kucaya ta kuckungasi,ugo kucaya ta," ugri nan. Mldac kanijimadcat, kra -nibapimusat. Ka icimatapit I 8 /ui i ki tcigami, uglwabandan20 ki tciklckapi kanig ; inapit, kaga t nawinagwatini iwidinibl l kang. Undcitamawm ninda i cikwackwan i^kwatugabating; a pitcigu tata kuntclgwanat. Undcitamawln nin-
"Yea,"to her said Nanabushu. "So I have not succeeded in bringing (them) a source of joy. Now completely have I erred, though no harm was intended inwhat I he said to his did," grandmother."Thus I wasexceedingly foolish while I was yet a child,"said Nanabushu. He said: "Of course I did fully realize the effectof my act. Of a truth, you are in the right, my grandmother, concerning what you say,"he said to his grandmother.This was what he first said to his grandmother. Andso then was the time that he started away,and fromthere he travelled about doingall manner of things. Andnow everywhere over the earth he went. For look andsee what he has done here upon earth.5. NANABUSHU AND THE WINGED STARTLERS.*And now, while -he was walking along, he suddenly sawsomething lying [together] in a heap. should like to"Ihave a name?" he said to theknow ifperchance youcreatures which he saw. "To be sure,"he was told-,"this is our name, little winged startlers, such are wecalled.""Oh, indeed, so that is what you are called!" Whereupon, after he had eased himself upon them,said to them :this he then"This is really the only winged startler,this is the only thing,"he said to them. Thereupon onhisway he started, on his way he went walking. Whenhe came out upon the sea, he saw a very highcliff withsteep sides ;. as he looked, trulyfar seemed the distancedown to where the water was. "Withgood reason wouldIleap down if a woman were up for a prize, particularlyif she were short from knee to groin.With good reasontFor another version see No. 24.
gunan.42:taijikwackwan ^wagwan ka/rjikwackwanigwan? i^kitung.Undcitamawm ninta ijikwackwan." Migirrma a kuklbabikanignlbawit. Oo dac totam, mlzan ajiwaninigatanit.Mldac clgwa kru disat a a wati kamldcinimint mri/<u5 umtcanisa 8 . "Anm ka tiyag?"udina 8 4 8 i /u umtcanisa s ."Ka,nangwana Nanabucu ninglmldcinigunan."10"i"Ningutanomawm inawaguban.""Kawm,"kri* l kito l a s a /u paji k i-i man mowingusibi tot."Kaga t ningagwatcimigunan, ;Anm ajini kasoyag? ningl-O 5 widac ningrrnanan, Kuckungasmagnintigomin,ningri-nanan. Oo widac kri* ( kito : Nabisakuckungasi!ningri gunan ;mldac ka ijimamackitciciyangit,mldac ka a nicimadcat."Wa a widac wanitcanisit ka icikislbiginat ka i ckwa kisl-;"Micanim!"15 blginat, clgwa ka/ijimadcat. ugri nan Nanabucuwan.Mldac ka i cra dimat i i ma n kickabi kang, mldacpacu uglunsabaman. Mldac ka i nanimat :mlnawa tawaninigatani.""WrkagasaClgwa kaga t umbigatani Nanabucu. "Undcltasa20 ninta i jikwackwan ningutwa kwa a/gan a kwutclngwanata tating."Mldacka ijipasigwa u tla c a /u pina, mldac ka ijikwackwaninitrrma n kickabi kang. Mldac i i-ma ka-i ciponltkanawabamat animibisu^iit;mldac i i witi nibrkang ka iji-25 pangicininit. Mldac rrma n ka u nsabimat, kaga t kabaya rkri nandiwan rrma n nibrkang; wi ka ayagosit. Undcimokisawan,mlguiwiti kabmabinit;o o widac ogri gon:
43would Ileapdown if some one should ask: Who willjump down? With good reason then would I leap down."There on the very brink of the cliff he stood. Now, thishappened to him : as he started to jump, he lost his footing.And so in the mean time (the mother) had come towhere her young had been eased upon."What has happened to you?"she said to her children.eased"Why,upon."it was by that old Nanabushu that we were"Something or other must you have said to him."said one"Nay," moving about there in the slush of thedung. we were"Truly, asked, What isyour name? wewere told. And this was what we said to him, Littlewinged startlers are we called, we said to him. And thishe said: Like the deuce (you are) littlewinged frighteners!we were told by him ; whereupon he squirted at us, afterwhich he went his way."Then the mother washed them with water;andaftershe had finished washing them, she then started away."Confound him!" she said of Nanabushu. And so aftershe had overtaken him yonder at the cliff,then close byshe took a peep at him. Now, this was her thought ofhim: "Iwishthat again he would swinghis leg."Now, sure enough, up Nanabushu raised his "Forleg.a purpose would Ileap if the object of the prize measuredone span of the hand from groin to knee."Thereupon as up flew the ruffed grouse, then (Nanabushu) leaped off the steepcliff. And so after she hadalighted there (on the edge), she watched him as he wentfalling and then yonder into the water he fell. And so;from there she kept watch of him, truly a long while washe gone in the water ;a long time was she perched upthere. When he came to the surface, straightway atyonder place he cast a look now this was she told; by
44"Kagatsa kikuckungasP," ugrrgon. Mldac ka rciklwatla s a /u pina mldac; kayawln ka-rcimadciyatagat, mlsa ka/rcia-gwa ; tat.Mldac mlnawa kra-nimadcat.6. NANABUSHU AND THE DANCING BULLRUSHES.Ninguting papimusat, "Anln?" kri nandam. "Kunigii?"5O o widac krrnandam :"Kunigakawm ningakackitosin."Ningutingigu papimusat, uglwabama s /u *i i ininiwa c ki s tciosamininit wlnlmi i tiwa 8 . O o widac ogri gon!ni /u :pacig"Anln ?"kaya klnina, Nanabucu, klgamm uglgon.8nisimsa "Aye , nmganim kayanm," ugri nan.10 Ka kina pingwacagitiwa8,mldac ka kina acrirnit i iupapikwangana pata kibinwa irnit. klnina klwlnim ?""KayaIkrrna a 8 a /u Nanabucu. i"Minaguu itug cigwa wlwitokasoyan?Kinondamina mini k iYwisa mini k wanlmrrtink?Nicwasuginwlnimi i tim."15 Mldac kaya win ka rcrirt, kipata kibinwa U t. Mldaca l pi madci tanit, nawayal ka ijocigabawit kayawln klnlmit.Mldac a l p! kimadci tanit, anic mlsa gaya win ri man ka-i n-daciwacimut; babanaginanga ina kamigisiwa 8 .Kagatsaki s tcinlmiitiwa i*i ma n . Mldac i*i ma n andaciwacimut, nlyo-20 gun kanlmit. Anic rrrna" wldci a t xwisa kanro i i guna-
"Wonder"WhatNow,45him: "Of a truth, you are a winged startler," she wastold. Thereupon back home went the ruffed grouse and;as for himself he started swimming inshore, after whichhe then went out of the water. Thereupon again hestarted on his way.6. NANABUSHU AND THE DANCING BuLLRusHES. 1While he was once walking along,thought.(whatit can ?"be)thought:"Iwonder(is it)?" heif I am unable to do it!" Andthis heashe was once walking along, he saw some men gatheredin a throng to dance together. And this he was askedby one of them: "You too, Nanabushu, are you goingto dance?" he was asked."Yes, my little brother, I too am going to dance," hesaid to him.They were all naked; and the only dress theyall hadwas a feather, with all but the top stripped from the shaft,standing perched upon their heads.- "And do you alsowish to dance?"they said to Nanabushu. "Without doubtit must be your wish to participate? Have you heardhow many days they will be dancing? Eight dayswillthey be dancing."Thereupon he himself dressed in the same costume, hehad a feather standing upon his head. Now, when theybegan,in their midst was where he stood and also danced.Now, when the others began (dancing), thereupon thenand there did he dance;a rousing time did they have.Of a truth, a great dance they had together there. Andnow, there where he was dancing, four days did he dance.So there he helped them for a space of four days. AndtFor another version see No. 22.
ka"4 6gatnik. Mldac a pl krrnint : "Ambasano ayangwamisin,"kri-na a u Nanabucu. nonda"Kagu a-nicrtangan."Mldac a pl cigwa krtrjrirnit-, ijimiskwa kwiyuwanit,anlc mlgu gaya win ka/ijru t Ia 8 a /u Nanabucu. Kinani-5 mit ml i ma, anlc kawln anawi maci ayakusisl. Mldackaga t anigu k nlminit. Aba pic kaningutwasugunagatinik,mldac a pl aniwabaninig, cigwaki kandank aya kusit.Mlgu u i ajislgisanig uckmcigun. Kagatsa nanontantam tcibwawabininig.Kaga pri gu ki tcimawi I 8 /ui i a pl tcitibi katinig.10 Mldac I 9 /u i i tcl i ckwanlmi itlng aniwabaninig. Misa 7 agawaugacki ton anummit, anlc aya kuzi. Cayigwa anawi pltabanini,mlsa caylgwa nanawatcimunit. Mldac anawi cigwapiwabaninig, anlc mlgu i u ajinasina mawit, a pltci aya kusit.Ningutingigu, ackwawabiniganit, klnlbawi magwa caca-15 ganacku ka, anlc ka icinaguskank lni/u cacaganackan mlnangwunalni /u ka ijinank. Mldac kagat nanondantamtcibwawabaninig, mldac acimawit, a pltci aya kusit. Ningutingigul s /ui i a kawabandank tcibiwabaninig, cigwa kagatowabandan piwabaninig. Mldac ka rnandank :Ambagickipimipaga kabank." Mri dac kaga t cigwatibickotcayaT pimra- kwabanini. Anlc mlgu u i mo kwicimut.Mldac inabit;kaga rrma t mbawit, kuniginln magwalcacaganagucku ka klnlbawi. Mlsandawa acinatagama a-yat.20 ka-i-citina
47that was when they said to him: "Webeg of you, displayyour zeal," they said to Nanabushu. "Don t let up beforethe affair is over."Now, that was when they began to paint themselves;after they were painted red, then the same to himselfdid Nanabushu. He kept right on dancing there at theplace, for not even yet was he weary. And so truly withmuch fervor he danced. By the time the sixth day wasup, and when the light of morning was coming on, hebegan to realize that he was growing tired. Thereuponthe tears streamed from his eyes. In good earnest washe anxious for the morning to come. Then at last hewept aloud for that the night was yet far from spent.And now the dance would be over during the coming-onof the morning. And so hardly was he able to dance,for he was tired.By and by, nevertheless,the dawnbegan to break, whereupon the others then began whooping.In spite of the breaking of the dawn, he was neverthelessweeping all the while, so verytired was he.Now presently, after the others had ceased with theirmusic, there he was standing inamongst the bullrushes,for what he had met with was the bullrushes, whichhe had supposed (to be people dancing).It was truethat he had grown restless before it was morning, andso he was weeping, he was so tired. But of a sudden,while waiting for the morrow, he then truly saw the comingof the morning. And this is what he thought:"Wouldthat at once the full light of day might appear!"Whereupon truly now straight overhead had come the line ofthe morning light. Now, by that time he was tired outby reason of the dance. And so he looked ; truly, therewhere he was standing, to his surprise, was inamong thebullrushes. On recognizing (what he had been dancingwith), he made hisway close to the shore. Thereupon
Mldac nangwanaIni/u ka*i4 8jinank cacaganackon anicinabankka/rjinank. Minangwana iya plku 4 8 /u i kra nitagwagikI 8i iminangwanaklki tcinanotink. Minangwana Ini /u kakrrcinank!ni /u cacaganackon. Na, mldac inangwana5rrma wawiyacki i ciwabisit.7. NANABUSHU, THE SWEET-BRIER BERRIES, AND THESTURGEONS.Anic, mlsa kani i cimamadcat. Ningutingiguka i ciwabamat4 s i /u anicinaba wltagwagicinit, mldac ka i cri nat :"Ambasano, niclmisa," ugrrnat8 /u i i anicinaba 8 .Uglwabamankigo^kanit, anic mldac kaya win rrma wra yat,10 o O widac ugri nan : "Ambasanokawltcitagwagicimin.""Awawa,"ugri gon.Mldac ka/rciwitigamat. Anic unisawa 8 kl n go n ya 8 itagwagiciwat. Aba pic cigwa kackatininig, anic mlsaH-ma n piboniciwat. Anic ayawa 8 unldcanisiwa 8 l. Aba pic15 cigwa gatamwawatC8 /u i iuglgo n imiwa. Mldac o-o- ka i*natIni /u :uwldigamaganan"Indawa sana, kini /utamawa lgikigl n gonimiwa klgagitamwananig ; pamadac nmawint ickwatcklgatamwananig."Midac gagat ka rcictcigawat. Anic mlsa 7 kaga t ka i ji-20 -a/mwawat 4 8 /u iugigo n 8i mini. Aba pic kadamwawat /ui ikl n go n ya 8 . Mldaca pl ka kidamwawad Ini /u uwldigamaganan oglgoirnini, iniwisa utagamida kawaganan, anic mlgalkina 4 8 /u iuglgo n imini mldac kai; ciniskadisltawat, mldac
49it became a fact that he had taken the bullrushes forItpeople. happened to be in the autumn, during- theseason when there was always a strong wind blowing.It was true that such was the way he had seen the bullrushes.Therefore that was a time when he had a jokeplayedon him.7. NANABUSHU, THE SWEET-BRIER BERRIES, AND THESTURGEONS. 1Well, accordingly then went he slowly along his way.And once after he had seen where some people were"Iintending to spend the autumn, he then said to them :beg of you, my younger brothers," he said to the people.He saw them engaged in catching fish, so naturally desiredto remain there too, and this he said to them: "Ithat you let me spend the autumn with you.""Youmay,"he was told.begThereupon he abode with them. Now they killed fishthere where they were spending the autumn. In thecourse of time (the lake) was frozen over, so thereuponthere they spent the winter. Now they had some children.As time went on, they ate up (all) their fish. Thereuponthis was what (Nanabushu) said to them with whom helived :aNow, therefore, we will eat your fishes first ;andthen afterwards, when they are gone,then our fish willwe eat."And so truly that was what they did. Now,it wasate the fish of the others. In course oftrue that theytime they ate up (all)the fish. And so after they hadeaten up the fish of his companions, they that were onthe opposite side of the (lodge) fire, then gone were allthe fish of the other; thereupon he became angry at them,1For other versions see Nos. 28, 29.4 PUBL. AMER. ETHN. SOC. VOL. VII.
,""50ka rjikusit. Pangi upimayari kri cikabaci, anlc mldacrrwiti iciwinat lni /u ugl n gd n rman. Anlc misa pa kadanitIni /u ka kidamawat Ini /u ugl n go n imini. Anlc mldac l a s a uinini anica uginln wandcipimadcra/t 4 8 /u i unldcanisa 8 .5 Ningutingigu tagwicing a 8 a /u inini.damang," ugri nan !ni /u wlwan.MlmawlntcigawananaMimawmi i- uugri gon.Mldac cigwa mlnawa aciwabininig mlnawa animadcanandawabamat Ini /u uginln. Ningutingigu anipimadaga kut10 sagai ganing, anitcatclkawat, ningutingigu kago uglnondammadwasininig miciwa kung. Ugiwabandan a tanig, mldacka-rcinasi l kank, kuniginln pikwa k ! Mldac kanawabandankwa-i-ci u da pinank. Kumiginm awiya uglmadwaganonigon:15 ugri-gon."Tatata,":ugri gon ;"klninaI8 /ui ikipigwa k,"<O 8 *o widac ugri nan: "Kawm," ugri nan. "Anicagunlwlwabandan.""Taga, podawan kundigu kigfkatc," ugl i gon.8O-o dac ugri-nan: "Aye , kaga t Mldacnigrkatc."20 kaga t acipodawat,mldac i i man aci a wasut.Mldac rrma n ajigagi s tcinit, midac, "Taga,midcin mi /uindacikanan," ugri-gon. Mldac kagat acro da pinanklni /uudaciganini, anln kawri cinang a pl ka-u da pinangIni /uudaciganini minangwana lni /u kaskami kwanawan !Pacigi-25 dac udanawickwandan, "Mlgu i 11 ka kina icimldcin,"ugri gon. "Mamindaga idac ningri niga a g,"krrnandam ;wisa "i ikiskwandamawasiwagwa ninldcanisag."Owabaman1Tatata, "you fool,"an adverb of imprecation.
and so moved away. Not far away he made his camp,and so of course thither he took his own fish. So therebyhungry became the others whose fish he had eaten up.Now, as for the man (whosefish had been eaten up), hekept his children alive bymeans of sweet-brier berries.So once when home came the man, "Now,we shall starve,"he said to his wife.I fear that"I fear so,"he was told.And so on the following day he started on hiswayagain to seek for sweet-brier berries. And once as hewas travelling over the ice of the lake, as he went walkingalong the shore-line, he suddenly heard the sound ofsomething out on the ice. He saw that an object wasthere, and so went up toit, and lo, it was an arrow !Accordingly he gazed upon it with a desire to pick it up.He was startled at the sound of somebody s voice saying1to him: "You he was told; that "isyour arrow?"was told.fool,"heAnd this he said to him:"Nay,"he said to him. "Idesire onlyto look at it.""Come, kindle a fire. It seems as ifyou are cold,"he was told.And this he said to him: "Yes,Itruly, am cold."Accordingly, indeed, he kindled a fire, and so there hewarmed himself.And then the other took off his moccasins, whereupon,"Pray,eat these moccasins of mine,"he was told. Accordingly, indeed, he took the other s moccasins, and whatwas he to behold when he took the other s moccasins3but really the dried tails of beavers !Now, one he fullyintended to leave, but, of "All it shall you he waseat,"told. "Now, very great wrong am I doing them,"hethought, "in that I have not saved some for my children."2 The tail of a beaver dried by fire is a delicacy.
ugrirr u iyanigu kwanig uma Ini/u kisinan, pacigwagini /u lma k-5wayanan niganigu ma tcigisinit,miwanini wama 11 kisinit;iniwidac maskitibanabin miwamni u k si ipagwa rgatanig/uuma kisining.Mldac ka kijibabltclnit ka-i-cinasi kaminit(ls /ui iumackimut, uglckackimut. Mldac ka icislgwabinanite /ui iudugimma 8 mldac ka-i cimockina a-nit ami kuminan.,Mldac ka i ci u-mbawana igut. Mldac a l plka O mbawanai-gut o o dac :ugri gon "Anipacwanbandamaniimaandayag unabandan ki^ciwanu kamigag, mldac i i ma 11( s10 ka-rcipagatciwapa kandaman /u i i kimackimut. Mldac kanlcimadcayan,kagu 7 win abanabi kan. Pamadac kigicapklgapi i nap. Ayangwamisin kici kan o crma 11 ; tcimadcayan ;i*iawiya kiganondawag /u -tcisa kwanikwa, o o dac kigail:gog A 8 a /u , kungwau k! klga i gog. Gagu^ac abanabi-15 l -kan i;ayangwamisin. Miguu icictcigan rrwisa aciki kinoa monan."Mldac kaga t ka i cimadciba tot. O o widac ugri go 8u^k !"2 ipaminica u gut: ut A 8 a /u ,go 9 . Midac(ikungwakaga t pacu tawat; intigwamlpigu katabibiciwat. Anlc20 sagai ganing pimadaga kuba wat. i Midac cayigwa anawipacwabandank8 /ui itcimicaga kuba i-wat, midac a pitcicigwa kzTkrrgut 4 8 i /u paminica u-gut. Midac cigwa migagakuba i wat; kamicaga kut, awaniban 4 8 i /u paminica-u gut. 11That is, the manitous of the wind.
53He saw how large the moccasins were, that one bearskin was of a bear surpassingly large, and from that theother had a moccasin;and (the skin of) a young bearwas what he used for a patch on his moccasins. Andwhen the other had put on his moccasins, he went towhere his bag was, his cedar-bark bag. And so whenhe poured out his sweet-brier berries, he filled the bagup with beaver berries.Thereupon by the other was he helped in lifting thepack upon his back. And then, after he had helped inliftingon the pack, this he was told: "Whenyou havecome nigh to the place where you (and the others) live,then select a large hollow space of ground, and there iswhere you should put down that pack of yours. Andthen you should continue on your way, and look not backbehind you. Not till in the morning should you go andlook. Exert yourself; make haste as you go on this path ;for the sound of somebody will you hear yelling at you,and this you will be told: Hey, push him! will you betold. So look not back be careful. Do; precisely as Ihave taught you."And so truly off he started running. And this he wastold by them who pursued him: "Hey, pushwas told. And now, indeed, he heard them a short distancehim!" heitaway seemed that now;they would overtake him. Soout upon the ice of a lake he came fleeing.And notwithstanding that, already was he coming close to theother side in his flight over the ice, yet exceedingly hardwas he now being pressed by them who were pursuinghim. And then presently was he arriving at the otherside of the frozen lake;and when he was come at theother side of the ice, gone were they by whom he waspursued. 1
"A54Mlsa pisan anrijipapimusat. Mldac c s /ui i ka rgut:"Anlckawln gayapi iwati no piming kanibiminija irgusV ugrrgon.Mldac kagat kawln keyabi ugra^nra-manisutuwaslniwitikani kuplt. Mldac kagat kra-nra-ntawabandank rrma n5 tcigi s tclwana kamiganig. Mldac kagat aciwabandank rrma nki tciwana kamiganig, mldac i i-ma 11 ka ijipagitciwapa kandank.Mlsa kaga t kawln kra banabisi. Mlsa kaniijikiwat.O o-widac ugri gon!ni /u wlwan : "Anm wlna kipmasiwadwaIgi /u uginlg?" ugi i gon Ini /u wlwan.10 O o dac ugri nan "An :ic, kawm ningutino kita i nandanzl,kanabatc1kicawandagus," ugrrnan mi/u wiwan.Mldac kawin kica n ca x nibasi a s a /u inini. "Wo o- kuca 715ningl ciwabis i ; kanabatc, mindimoya, klcawandagusimin,"ugrrnan Ini /u wiwan. Mldac a pl kawabaninig acikanonat:au, amba, icada 6 !"Mldac kaga tcigwa kra nimadcawat, awrrnabiwat i i ma 11ka-i cina-kl pipagitciwapa kandank 4 8 /u i omockimut amm;mowat a l pi anitababandamuwat a pana mlgu i 11namawan !Mldac motcigisiwat. "Kaga tiguna klgawlsinimin." Mlsa20 cigwa a l p! ka u ntciwanawat. Mlsa ka/rnano klwat, klcigatnigkaya kra wanawat Ini /u namawan. Mldac a pl cigwaka a wanawat kawin gayapi klwlsinislwag."Taga,uwra a kamawi k i-i ma n kitonda i baninang."Mldac kagat ka rca kamawawat. Anlc potc taplndigaiKicawandagus, "you (will) yet have food toeat;" literally, "youwill be
""Where55And so in peace he then went walking on. Now, thiswas what he had been told : For at yonder forest willyou no longer be he was told. pursued,"It was truethat no longer did he feel the pursuit of anybody afterhe had gone up from the shore. And so truly he continued his way, looking for the place where there was agreat depression in the ground. And when he truly sawthe place that had a itdeep depression, was there thathe dropped his pack.It was true that he did not lookback. And so on his way back home he went. Now,this he was asked byhis wife :are the sweetbrierberries that you went to get?"he was asked byhiswife.And this he said to her: "Why,in no wise should youfeel so sad about it,for no doubt you will yet have food1to eat,"he said to his wife. And then hardly could theman sleep."This is indeed the feelingI have had, thatperhaps, old woman, we shall yet be blessed," he (thus)said to his wife. And so after the day was come, hethen addressed her, saying:"Allright, come, let us go!"Thereupon, in truth, they now started on their way, theywent to look at the place where he had dropped his packwhen coming home; now, what were they to behold whenthey caught sight of it but a place full of sturgeons !Thereupon were they happy."Without fail shall we nowhave food to eat." And so from that moment they beganpacking from there. And now when they set to work,while it was day and allday long, they packed (and)hauled the sturgeon. And so by the time they had finishedhauling it all, not yet had they eaten."Isay, do you go wait for him at the place where wedraw our water."Accordingly they trulywaited for him. Naturallywithoutblessed,"but blessed in a particular way, which in this case is in the getting of food.
"!156Ia 8 a /u Nanabucu; cigwa ka klcf tawat, pacik kaya rrmanutackwandamiwan uglpima kwicimawat Ini /u namawan... Anlc mii /u pra-wat tciblndiganit Ini /u Nanabucowan.Midac kagat a s awati Nanabucu o 8 d utigo 8 : "Nimba-5 kinagunanig Igi /u kwlwisansag,"a 8 a /u Nanabucu, o 8 o 7 ugl i go i s-i/>uunidcanisalugri gd 88 .I 8 /u i i unidcanisa 8Od widac kri- kito :"Magica kago uglmi kani 4 8 i /u midacwantcimino a-yawat. Kaga t kuca aya a n namawa kwan,mlguca 4 8 /u i madciwat. Midac wandcipa kinawiyangitwa.10 Taga ningawabama mtcizazi kizi," ugri nan 4 8 /u i unidcanisa 8 . Midac kaga tcigwa klmadcat mawatisat Ini /u Papaklwisan.3 Midac ka/i cipmdigawat, mlgu -i man anipmdigat,owabaman namawan pima kwucinini ! Wo o widac ugri nan:Ningamawadisa nitcizazrkizl," ugri15 mawat 4 8 /u i andanit atata oba ta*rnawan namawan !widac uoq-rnan : "Anlndiowantcinanatwa?"nan. Anm ka*i cina-Wo o-Midac ka i :gut"Ocrma 11 nintonta ipaninang. Wo o -kri-cictciga a s a /u nimmdimoyayim ; kra-pi ka kabagijik.lMidac ka ijisagisitayabinikacit, midac i i-ma n nintonta i-pa-20 ninang ka icipa kuplyan. Midac a pl rrwiti wabamakagumut, midac pacipawak. Midac acito tokablkibitoyan,midac aciwl kubitot a 8 a /u mindimoya n . Midac aci a gwawabinit.Mldacigu mlnawa acipa kublyan. Na x ,misa acictcigayani i ma 11 ka-u ntinaman. Midac kaya nln wantciwl-25 siniyan. Mlsa i >u windamonanka i-cictcigayan."1Referringother family.to the contest between the children of Nanabushu and those of the2 Nitcizaz^kizi, "myold friend:"literally, one of the same"my age as I."3Papa klwisan, in the"Pilferer;"nominative form it isPapa c kiwis; this is thePapakeewis, the mischief-maker, in the song of Hiawatha. The name comes frompa^kwis, one that breaks off or snaps something off; the reduplicated form denotesthe frequency of the act; and the name connotes one given to petty theft, especially
57fail would Nanabushu come in; so, after they were ready,then one of the sturgeons they laid across their doorway.Then accordingly waited they for Nanabushu to come in.Thereupon, truly, Nanabushu at yonder placetold him: "We lost to the boys in a wager,"lhad this(thus)his children was Nanabushu told, this was he told by hischildren.So this he said:"Probablyhe has found something,and for that reason they are living comfortably. Surely,indeed, it is sturgeon-roe, for that was what they ate.It was on that account that they won from us. I thinkI willgo and see my old friend,"2byhe said to his children.Thereupon, truly,he soon was off to visit the Pilferer. 3And so after he had gone in, indeed while he was entering,he saw a sturgeon lying across his !way And this hesaid to them: "I want to visitmy old friend,"he said tothem. What should he see where the others lived but awonderful supply of !sturgeon And this he said to them :"Where did youkill them?" he said to him.So this he was told: "Over here at our water-hole.This my old woman did ;she was at work allday longmaking a line. And after she had tied the line to myfoot,Ithereupon went down into the water by way ofour water-hole. And when I saw (the sturgeon) downthere under the water,I then spearedit. And when Ijerked the line, then on the line pulledthe old woman.So thus she drew me out of the water. And so onceagain I went down into the water. There, that was howI did down there where Igot them. Now, that was howIprovided myself with food. Therefore have I relatedto you what I had done."in the way of food. The term is also a synonyme for a "sponger 5" thephraseubaba kiwisi kanan means,"he desires the use of some one else s things before usinghisown,"
58"Kaga tsa,"krr kitoca s a /u 7Nanabucu. "Mlsaidacs /ui i Izan rrma n ka-irntciwlsiniyan."Anlc acama rrma n mawaticiwat. Wo O tac krrna:Igiwati kitani a-yawag nintickwantaminang kapima kwicinuwat."Mldac kaga tkanicisaga a nk, kra ni u da pinat 4 8 i /u namawas ,mldac kamciklwat, O O dac ogri nan ini /u wiwan :wabank"Taga, api ka kan. Miguca Isan i-i man utagamlmiwangwantcinanawa Ini/unamawan."10 Mldac kagat ka icictcigat a 8 a /u mindimoya, ki a-pi katkabagljik, wmidac a 8 a /u Nanabucu kra nitrka. Mldacka i-jikici tawat, wayabaninig kigicap o o widac ugrrgonIni /u Papa kiwisan :"Migu-i ma n nmtonta ibaninang icipakubln."Wo o widac kl icictciga I a 8 a /u Papa kiwis, ugra -15 gumu a-an Ini/u namawan.Mldac a pipa kublt Nanabucu kaya ani a I nabit uglwabaman,kaga t agumunit ini /u namawan. Anlc misa" acipacipawat.Acito togabigipitot, mldac ka i ci a gwawabinigutIni /u wiwan. Kuniginln kaga t namawan utagwaci-20 manini. Wo o widac udinan Ini /u wiwan: "Mlnangwanawo o-ma ka/u ndatismg."Anlc, mlnawa anu icipa kubit, anubaba inabit, misa 7kawin ganaga ningutino icina n zl; plnicigu a kwanabawat,intawa a kwanabawat ajito togablgipitot. Anlc, minawagu25 anuba kubl; mldac intawa ka rcito tokabigipi tot. Ka i ciagwawabinigutIni /u wiwan, anic, minawagu anuba kubl,misa kawin kanaga kago."Anmaciwabisiwangan i i wisa
59"Yes, indeed,"said Nanabushu. that"Possibly maybe a source by which I shall obtain some food."Naturally he was fed at the place where he was visiting.Now, this he was told: "Take with you the ones that lieacross yonder doorway of ours."It was so that, as he went out, he took up the sturgeons,this he saidand then he went his homeward way. Now,to his wife: "Isay, to-morrow do you make a line. Forit was by way of yonder water-hole of theirs that theykilled the sturgeons."Accordingly that truly was what the old woman did:she worked allday long making a line, while Nanabushuhimself worked at making spears. And so after they wereready, then on the morning of the morrow this he wastold by the Pilferer: "By way of yonder water-hole of oursdo you go into the water."Now, this had the Pilfererdone, he had laid a sturgeon in under the water.And so when into the water Nanabushu went, and whenhe was looking about, he saw, sure enough, a sturgeonmoving in the water. So thereupon he spearedhe jerked the line, he was then pulled out of the waterit. Whenby his wife. She was amazed to see him actually drawinga sturgeon out of the water. And this he said to hiswife :"This issustenance."just the placewhere we shall obtainWell, again he went into the water, but without success;in vain he tried looking about, but not a single thingdid he see; (this continued) till he was getting short ofbreath, and there was no need of his getting out of breath.Then he jerked the line (to be drawn up).So once morehe went into the water, but it came to nothing ; and sowithout success he jerked on the line (to be drawn up).After he was pulled out of the water by his wife, why,he would have gone back in again, but it was no use
,"ugri-nan6o11wabamasiwag aV nama?"ugrrnan Ini/u wlwan. Intawaka katabawat, intawamrr 11 ka/rcra-nici tank. Kaga/t inangarrma n krirndinigasuwan anica kra; gantcitcigasuwan.Mldac ka/rciklwawat intawa. Kumadac igu a pl a i ndawad5 anlc ml cigwa pa katawad.Cigwa anawi sigwanini, mldac wmi tam ka i cinantawiginlwat.A pidci tacigu pa kadawat, animadcat;uginlnugiwabaman, anlc ui imiya tagu wantcipimatciat umtcanisan.Mldac anandank :10 inandam."Kuniga ningapina a s a /u ugin?"Ningutingigu anibabimusat saga i gan ogiwabandan ;anlcimada kut, anlcitcatclgawati i u saga i gan. Owabandanwapigamanig. Pama mlgu rrma n saga i ganing nawikwam kago madwasininig. Ajiinabit, mldac kagat15 ka/rcinondank madwasininig. "Wagunan?"kri nandam.Kuniginln, aninasikank pikwa k kl a- tani kitcipikwa k,ma kwa tawagan asawawint ! Acrirta pinank awiya ma-:dwaganonigon "Tatata, klnina kibikwa k, Nanabucu,wa-u da pinaman?"820"Aye , nislmisa, nin nimbikwa k.""Kawln, nm, Nanabucu, nimbikwak," ugrrgon."Kawln," ugri-nan c a s a /u Nanabucu."Kawln," ugri-gon;"Nm 4 8 i /u nimbikwa k." Medacka igut: "Kawln win kri kitusl Papa kiwis a pl cawanimag."25"O nwa a u Nanabucu; "kin nangwana i u ,niclmisa, kipi kwa k!"ugri nan.
somehe"Wonder6iat all. "What can be the matter with us that I do notsee any sturgeon?"he said to his wife. For nought washe chilled by the water, so he gave up in failure. It trulywas not a place to get (sturgeons) ;for wittingly had (thesturgeon) been put into the water for him. Thereuponback home they went without success. And so later on,while they were abiding there, they then beganwant of food.to be inIt was now getting well on towards the springtime,whereupon he took it upon himself to go looking forsweet-brier berries. So when they were exceedingly hungry,he started on his-,way sweet-brier berries he found,for it was only by such means that he was able to keephis children alive. And then he thought:can take the sweet-brier berries home !"if Ithought.Now, once as he was walking along, he saw a lake;then along upon the ice he went, on the ice along by theedge of the lake he travelled. He saw where (the lake)narrowed into a channel. Then farther on the lake, far outupon the ice, he heard some sort of a sound. As he looked,then was he sure that he heard something making a sound."What(isheit)?" thought. As he went up to it, therewas an arrow, a great arrow, with the ear of a bear forthe feather ! As he reached for it,he heard the voice ofsome one addressing him: "Fool, is ityour arrow, Nanabushu,that youshould have the desire to take it?""Yea, my younger brother, it is my"Nay,own arrow."it is mine, Nanabushu, it is my arrow," he was told."Nay,"to him said Nanabushu."Nay,"he was told,"it is my own arrow." And he wastold: "The Pilferer himself did not say that when I wasmerciful to him.""Oh,"to him said Nanabushu, "then it is the truth, myyounger brother, that the arrow is yours!"he said to him.
62Cigwa minawa uglkanonigon Nanabucu:"Intigwakigrkatc. Taga, potawan," ugrrgon.Oo-dac kri- kito wa-a u Nanabucu: "Antagasaa s a /u miniklgrkatci. Kawm nm nimkfkatisi,"krr kito5 nabucu.la s a /uNa-"Nanabucu, kawm kri^kitusl a pi cawanimag l a c a /uPapa kwis."s"Aye , niclmisa, kaga t ningl katc.""Potawinguta."10 Kaga t ka i cipotawat. Mri dac mri ma 11 ka-i cigagi tcinit."Taga, Nanabucu, midcin uno/u nindaciganan."Wo 5 widac ugri nan: "Kawm nin nindanimuciwisl kamitciyambanlni/uaciganan.""Nanabucu, kawin kri kitus! Papa kiwis a l pl cawanimag."815 "Aye, niclmisa, kaga t ningamitcinan Ini /u kitaciganan."Mldac ka icipa pa u wabinaminit mldac ka i^kitut au Nanabucu :"Pldon, niclmisa, ningamldcinan Ini /u kitaciganan."Amn ka icinang Nanabucu, kuniginln, Ini /u kaskami kwanuwan! Mldac kagat, acimldcit. Pajig utanawl i ckwandan.20 "Awawa, Nanabucu, mlgu r u Mldacicigitan." kaga/tka icigitang.Cigwa undani-u da pinamini 4 8 /u iutogimwac, acisigwapinanit/u i i4 8udogimma 8 . Aniniminakuwan micawi kwamkidacisigwa-i gawan. Mldac ka-ijimockina-a/niti i ma 1125 mackimutank, "Amba, Nanabucu," ugri gon. "Umpumwa s a u mi kwam. Kagu win inanimicikan. Acimadci ningrrnigak! i inantangan. Kmlgu kigababami tam 4 8 /uia/rninan. Ayangwamisin ; ambasano, manu icitcigan ka i -ninan. Kagu bablni tawici kan; mlgu u i tci-i*niga-i tisuyan30 klcpin pablni tawiyan l s /ui i; mlgu iu kaga t tci i niga toyan
""He63Presently again was Nanabushu addressed: "It seemsas ifyou were cold. Pray, kindle a he wasfire,"told.And this said Nanabushu :issurely the man whois cold. I am not cold,"said Nanabushu."Nanabushu, the Pilferer did not say that when I wasblessinghim.""Yea, my younger brother, certainly"Then build you up a fire."I am cold."Truly, after that he built up a fire. Accordingly theother then took off his moccasins there. "Isay, Nanabushu, eat these stockings of mine."And this he said to him : "I am not a dog, that I shouldeat those stockings.""Nanabushu, the Pilferer did not say that when I wastaking pity upon him."Yea, my younger brother, truly, will I eat those stockingsof yours."And so, after the other had shaken them thoroughly, then this said Nanabushu: "Bringthem hither,my younger brother, I will eat those stockings of yours."What was Nanabushu to behold but a wondrous store ofdried beaver-tails !Thereupon truly he ate. One hewished to save. "O Nanabushu! go eat it up."Whereupon truly he ate it up.When the other went and took up (Nanabushu s) bagof sweet-brier berries, he emptied out his sweet-brier berries.Then off he went, goingfar out upon the ice, where hebegan chopping the ice (into chunks). And then, afterhe had filled the sack full (of ice), "Hither, Nanabushu,"(Nanabushu) was told. this"Carryice upon your back.Regard me not in an evil way.lOh, the evil that I amdone! do not think. is(It for) your (good) that youshould heed what I am telling you. Be careful;Ibegof you, try to do what I tell you. Do not disobey me;
"Autigokri-64klya /u 8.Ambasano, ayangwamisin, icictcigan /ui i ka/rninan.Q-o-ma ntcra-nimadcayan, awlya kikanontawag tcigagigitowat.A-e e 1 !klga gdg i awlya. Kagu pabami tawa kan.1A a /u , Nanabushu, pamataga kut ll!klga i gog. A a /u ,5 kungwa u- k !klga-i gog. Kagu x abanabi kan. Mlgu 4 8 /u i a pana ka-i ni taman WCTO* saga i gan tcibimataga kuyan.Pimiba ton anigu k. Midac ka i ni kwa :c 1O, l o,co,lo,kungwa u- k, kungwa u- k, kungwa*u ( k! klga i gog."Midac a pl cigwa ki pimadca ; pitcmagigu a pi patagwi-10 cing, cigwa kagatawiya onondawa 8 . Midac acimadclpatod, cigwa gaga t onondawa8 ,-gwa u k Nanabucu !" 8 ." 1AU ,lau,a u ,la u ,kun-A n ,midac kaga tnandaganimusig pimipa tod. Cayigwanawi kwam pimadaga kuba to.Kumagu udaplsi taw^a 8 4 8 i /u15 paminlca-irgut. Midac aninantaganimusig ackam pacu.Ningutingigu, "Mlmawln tcitabibiciwat ka/rnwawat," kri n-andam. Ugltcicagwasum rr u waga kwat ; aciyabamipagisut,u,kungwa u- k !" kitu. Anu inabit, kawln awlyaoglwabamasin.20 Midac mmawa acimadciba tod, misa unbtcita 4 8 /u ani itank;anigu k pimiba to. "Taga nlngagwanaganag Igi /u ka i n-wawat," kri-nandam. Midac anigu k anupimipa tod ackamiguupacu tawa mmawa. "Mlmawln midac i i tcitabi<ubiciwat Igi /u ka-i-nwawat," kri-nandam. Midac a pidci
hewas65else you will surely clo yourself harm if you fail to obeyme in that;for truly will you do yourself harm. I begof you, be careful, do that which I have told you. Whenfrom this place you start upon your way, youwill hearthe voice of somebody Halloo !talking". youwill be toldby somebody. Do not heed them. Halloo, Nanabushuispassing across on the ice! they will say of you. Now,then, Push him! they will say of you. Don t look back.That is what you will keep hearing all the while you arecrossing this lake on the ice. Run as fast as you can.This is what they will say to :you Hey, hey, hey, hey,push him, push him, push him! they will say of you."And so then was when he came starting away. As soonas he was come at the place, then truly some one heheard. And as he began running, then trulythem, "Hey, hey, hey, hey, push Nanabushu !"of him.he heardsaidAh, thereupon truly, nothing loath, he ran with all hisspeed. Soon a long way out upon the ice did he comerunning. Some distance away he could hear those whowere pursuing him. And then all the faster he went, thenearer they came. At times,"Nowthey sound as if theywill overtake me,"he thought. From the belt round hiswaist he pulled forth an axe. As round he whirled,"Allright, push him !" but nobodysaid. In vain he looked round about,did he see.Thereupon, as he started running again,if he could hear the sound;with all his speedit seemed ashe ran."Now, I will try running away from them who are makingthe noise,"he thought. Thereupon with all his might hetried to run, and closer still he could hear them again."I fear that they who are making the noise will nowovertake me,"he thought. Thereupon ever so close washe now being pressed when again round he whirled, and5I U1>L. AMER. ETHN. SOC. VOL. VII.
" cAa66kaya kri gut mlnawa acra/bamipagisiit, awanan dac kawabamat?Amc anirrnabi, awanan dac kawabamat?Mlnawa acimadclba tod; kumagu a 1 pi mlnawa anitagwicink,cigwa mlnawa onontawa, mldac acimadclpa tod anigu k.5 Mldac anawi cigwa pacwabandanki i ma n wa icimlcaga k-upa tod, mldac anawi caylgwa pacwabandank, micigwamlnawa ka kri gut. Medac aciku plpa tod, mldac awanibanls /ui inondawa pan.Mldac acipapimusat plsan. Cayigwa bacwandank l c /ui i10 andawat, anic idac cigwa andawabandanI8 /ui itciwana kamiganig;mldac kagatcigwa klwabandank ki l tciwana l kamiganig.Mldac ima n ka icipagitciwanat. Mldac ka a*nicimadcatki i na :"Kaguabanabi kan,"anic krrna.7Mldac ka-i ci a-banabit. Anln ka-rcinank a pi ayabanabit?15 A panagu namawan owabaman ima n ka-i cipagitciwanat.Kaga t minwantam rrman ka i-cipagitciwanat. Mldac aniiciglwat ka icitagwicink iwiti /uantawat, mldac ka igutini ;wlwan : "Anln win/uklblnasiwatwa Igiuginlg?""Mindimo n Mlsa"ya, ninglcawantagus." kawln nibasl i20 tibi katinik, a /upltciminwantank. Wo O dac ugri-gonIniwlwan: "Intackaukigibwabablnitanzimitug i i anugri gowanan."fii /uAmc anotantam tcibwawabaninig. Tcigwasa piwabanini./u,mindimoya, kidapi kan uda pinan. Kagackaginm25 na*a*gatc ningrijinanzl," ugrrnan Ini /u wlwan.Mldac kagat anicimadcawat. Anisagatciwat, awanibanml i 11 kaicinank; intacka /uuglwabaman mockinanit lni11nawawan rrma kanibagitciwanat. Mldac aciganonatIni /u
"6 7who was there for him to see? Even though he triedlooking round about, yet who was there for him to see?Then again he started running and when a certain;distance on the way he was come, then again he heardthem, whereupon he began running with full speed. Andthough he could see that near was the other shore whichhe hoped to reach by running on the ice, though he couldsee it close by, yet again was he being hard pressed.And when up from the shore he ran, no one then didhe hear any more.Thereupon he walked peacefully on his way. When heperceived that he was approaching home, he then soughtfor a great depression in the ground.It was true thatsoon he saw where there was a great hollow. It wasthere he put down his pack. Now, when he started togo, he was told: "Look not back,"thus he was told.But what he did was to look back. What was he tobehold when he looked back? A host of sturgeons hesaw where he had put down his pack. Truly,was hepleased to have put down his pack there. Thereuponhe started on his homeward way. After he was come therewhere they lived, he was then asked byhis wife: "Whydid you not bring home the sweet-brier berries?""Oldwoman, I have been blessed." Thereupon he didnot sleep during the night, for he was so thoroughly happy.And this he avas told by his wife :failed to obey what was fruitlessly said to you."Iwager that youNow, he longed for the morning before it was time toappear. Soon then came the morning. "Now, then, oldwoman, get your tump-line. By no means a mere morselhave I seen,"he said to his wife.started. When heThereupon truly on their way theycame out upon the hill, gone was that which he had seen;for previously he had seen great abundance of sturgeons
,"ugrrnan;umindimo-i-mican:"Mockinabanik68ogo u namawag."Mldacka/rgutIni /u wlwan: "Intacka kiglbwabablnitazlmitug,"/uugri gonIni wlwan."Ayes"kaga t kagu abanabi kan, nintanuv}Mldac kfrrcinickiat lni /u wlwan. "Mamindagasa gaga tkawln kini tanontanzl k*ago anugri-goyanin."Wo-o widac igrinan wa s a /u Nanabucu: "Kagatsa kawlni iningri jitcigasi anugri Mldac ima n ki a nwa-<ugoyan."10 nindizut.Mri madac papai nabiwat pajik sa^na cigwa kunamawanuglmi kawawan ma i i kl*a* l tod rr 11 upimiwanan. Mldacacikiwawat, intawa mlsana lni /u ka plnawat mldac ini /uka^kabacimawat.15 Mlsa minawa tcigwa krarnimadcat, minawa aninantcwabamat.Anlc mlsaguna/r wandcipimatci a t unldcanisa /s i i11<u .Anlc mlgu ku tasing wabaninigin antawabamat Ini /u uginln.Ningutingigu a pitci kawanantamuwat minawa antawabamatlni /u uginln. Mldac ka icipimadaga kut iY 11 saga i gan,20 mldac pimacagamat 4 8 i /u saga i gan, minawa kago onontilnpitiku kusininig. Ka-i-cina n si l kank, kuniginm uglwabandanki s tcipikwa k l a tanig, ma ku tawagan asawawint. "Tatata,"ugri gon awiya "klnina kibi kwak, Nanabucu?""Kawln," ugri nan. e"Aye,"ugri25 "kin kibikwa k, niclmsa."nan a t; a /u Nanabucu;"Taga, Nanabucu, potawan. Kuntigu kigrkatc."
6 9there where he had laid down his pack. So then headdressed the old woman, saying: "The placehere wasonce full of sturgeons."And this he was told by hiswife: "Idarehe was told bysay but that you have doubtless disobeyed,"his wife."Yea,"he said to her; "truly,Look not back,I wastold to no purpose."And then was when he angered his wife. in"Reallygood sooth you are thoroughly incapable of giving heedto anything one tries to tell you."And this to her said Nanabushu :"Quite true,I did not dowhat I was uselesslytold." And so then was he repentant.Now, from there they went searching round about, whentruly they found some sturgeon-roe at the place wherehe had put down his pack. Whereupon they then wentback home, so accordingly what they fetched home waswhat they cooked in the kettle.And so once more was he already on his way, oncemore was he looking for (sweet-brier berries). Now, thiswas the only source he had to sustain his children. Soit was every morning that he went to look for the sweetbrierberries. Nowronce, when they were very much inwant of food, he went again to seek for the sweet-brierberries. Accordingly, as he was goingof the lake, and as he travelled along bythe lake, again he heard the sound of somethingacross on the icethe shore offall witha thud upon the ice. When he went up to it,he wassurprised to see a great arrow that was there, with abear-ear was it feathered."Fool,"he was told by someone, "is it your arrow, Nanabushu?""No,"he said to him. "Yea,"to him said Nanabushu;"it isyour arrow, my younger brother.""Isay, Nanabushu, kindle a fire. It seems that youarecold."
,"ugri-nan;"Autigo;o"Aye8"nislmisa, kaga t nigikatc," ugrrnan.Mldac ka/rcikagitcinit."Taga, uno /u midcin,"lugri gon.Midac kagat ka/rcimidcit ini u aciganan.Clgwa utota pinamini 4 8 /u iutoginiwac, midac acisigwa-5 binat. Kaslgwabinanit kahicimadcanit. Owabaman tacisigwa*i*ganitmi pma n navvi kwam, mlsa mlnawa ka i i cimockina*anit ima umackimutank.11Mldac ka-rci u mbiwana rgut, o 6 widac ugri-gon:"Ambasinotac ayangwamisin, kagi^dac mlnawa icictciga/kan.10 Ka i*ninan dacigu icictcigan. Kawln mlnawa kida i nisinan.Mldac a/ta o u Ininan," igli-gon.u ,mri<uicimadcan,"ugi-i gon.Mldaclkagat ka icimadcat, ka i cimadciba tod. Cigwamlnawa awiya unontawa 8 sa kwanigut. Midac ka*i*nandank :15 a Kawln pa pic idac nintaVrnapisl. Misawagu awiyaki tciwinankl e /ui inimpimiwanan," kri nandam. Midac kagatpimataga kut, cigwa bablmiba to. Kaga t uga kri-go iY 11nwantawat."O-o-o, kungwinr k Nanabucu !"8 .Anlc midac kagat kawin wra banabisl. Midac pinic ka-20 rciacawaga kut awaniban a pii i witi a ki kank.Anipapimusat cayigwa ubacwantan s;/ui i antawat. Anlcminawa utaninantawabandan tciki tciwana kamiganig. Mldacri rna ka icipagitciwanat, midac kawin kiabababisi i i ma11ka ijipagitciwanat. Ka-ijitagwicink iwiti antawat, midac25 kawin ugiganonasiini /u wiwan. Ka ijikawicimut, kawin1Not the moccasins, but the stockings.
""Yes,"he said to him- "my younger brother, truly Iam cold,"he said to him.Thereupon the other removed his moccasins. "Isay,leat these," (Nanabushu) was told.Whereupon he then truly ate the stockings.Now, the other took (Nanabushu s) bag of sweet-brierberries and poured them out. After he had emptied themout, he then started away. (Nanabushu) saw him choppinga hole far out upon the ice, and he was again fillinghissackthere.And when by the other he was helped with liftingonhis pack, this was he then told :Ibeg of younow takepains, and repeat not the same thing. What I have totell you, that you do. Not again will I give you advice.This is the last time that I shall speak to you,"he wastold. "Sothen, start you hence,"he was told.Thereupon truly off he started, off he went running.Presently another one he heard yelling to him. And thenhe thought:"Under no circumstances will I look, eventhough some one should hold back on my pack,"he(thus) thought. Thereupon truly, as he was coming acrosson the ice, he then took a straight away course as he ran.Truly was he hard pressed bythose whom he heard."Ho, ho, ho, push Nanabushu!" was said of him. Now,it was true that he was not anxious to look behind. Sothen at last, after he had crossed the ice, there was thenno one there on the land.As he went walking along, he soon perceived that hewas approaching where he lived. So again he sought forthe place with a deep depressionin the earth. And soafter he had put down his pack there, he accordinglydidnot look back where he had put down his pack. Whenhe was come at yonder place where he dwelt,he accordingly did not speak to his wife. After he had gone to
,"ugri"72"Intacka kibwabablni tanzimltug waylba mlnawa amantc5 ka/i gowanan. Kitiniga a g kinltcanisinanig bablni tamankago. Amn, kagona kigri go?""Aye8,amantcrmidac ka-i-ciwabatogwan mldac; igui i/uka igoyan ka i cictcigayan."ul A la /uuglkacki toslnI 8 i i tcinibat. Mldac anicagu ka/i cicinko O dac ugrrnan Ini /u wlwan: "Kagiit mlnawa nintanugiicawantagus."mindi-Cigwasa owabandanawa 4 s /u i iwabaninig.10 moya!" ugri nan mi /u wlwan. Mrrdac ka i cimadcawatiima n kipipagitwanat, kaga anm t ka rcinank iman klpagitciwanat11wantcitagu mockinani mini k i i ma wana kamiganignamawan mockinawan. Anlc mldac awatciwanawatkabagljik. "Mlmawin i i >u15 wlwan.tciwabanicink," ugrrnanini/u"Aye8gon ;"mlsa i i />upimatisiwat Igi /u kinltcanisinanig."Mldac pisan mri rna 11 ka i ciwawlsiniwat.8. NANABUSIIU AND THE WOLVES.Mldac ningtitinigu papamusat awiya owabaman, kuniginin20 tna i gana8 Izan. Ka rcipipagimat, ka plciicaniti ^ma11ayat.O o widac kri* c kitowag igi /u ma inganag:"Kagupacu xa l pitci ica kagun, kago klwri gowa," ugiina 8 . Mldac kagatnagawasa wantcigabawiwat kanonawat. Wo O widac ugli:gowan Amantcwlni /u kltotamag ingutci wayabamina-25 gogun? Kawinina indinawamaslwanan kitinandamina ku ?Pacuginlnigu kitinawamininim; migininiguIa 8 a /ukosiwa
73bed, he was not able to sleep. And after he had spentsome time merely lying there, this he then said to hiswife: "Truly, again to no purpose have I been blessed.""Ifancy that perhaps again you were not long remembering what had been told you. You do our children ahurt by your failure to obey. What, was there somethingyouwere told?""Yes,but it is uncertain how it will turn out; foraccording as I was told so I did."So presently they saw that the morrow was come."Now, then, old woman!" he said to his wife. Accordingly, after they had started off (and had come) to theplace where he had left his pack, truly what was he tobehold there where he had left his pack but a place fullto the brim with as many sturgeonsas the basin couldhold. So therefore were they busy lugging throughoutthe day."No doubt but that now we shall live throughthe winter," he said to his wife."Yes,"he was told; "therefore saved are our children."And so incomfort with plenty to eat they continued there.8. NANABUSHU AND THE WOLVES. lNow, once on a time as he was travelling about, hesaw somebody. Lo, they were wolves! After he had calledaloud to them, then they came over to where he was.And this said the wolves: "Goyou not so very close,for he wishes to say something to you," theysaid of him.Whereupon truly, at some distance away, was where theystood when they spoke to him. Then this they were told :"I shouldlike to know why you act so whenever I happento see you anywhere.Is italways yournot your kinsman? Why, I am very closely1For other versions see Nos. 9, 30, 44.idea that I amrelated to
:"74nldcikiwa n zi." Oo dac ugri nangomanIni /u a l kiwa n z!maTnganan"Nltcizazfkizl," : /uugrrnan. Midac ka/rnat ini ugwisisini Ini /u a kiwa l n zImaT n "Anlcganan.ugrrna 8 u l i imaTngana 8 . Wo crwidac :ugrrnan5 acayag? ugri nan.nintocimag,""Anlndi"Wo o witi nlbinunk kini tagfabanigf O O I^i O /u kitocimaof. O inldaciiwitiacayang. Midac a pana iwiti ki a santcikuyangibanugimrkawiawabanin. Mldaciguiwiti ka kina kaicra santcikuyangibanmlciac iwiti anubimi i cayank."10 O dac ugri na 8 *a 8 a /u Nanabucu :"Mlgayanm i i witipami-i cayan, mlsa iTsan kataniciwltclwinaguk," uglma 8 .15 baclyank,"Anlc, mlsa kaga t cigwa kra niwawltclwat. Anlc kawlnkeclca" utibi a sm aniwidciwat. Ta kasinini pimusawat.Midac cigwa unagucininig,"Mlmawlni r u cigwa tcinantagaikitowag. Midacckaga t aninantakabaciwat.Kaga t cigwa umi kanawa iman kabaciwat;anotc ima napagata a nunk wantci-irninamanit. "Mlsa iuma,"kitowa L .Cigwa wi kacimowag cayigwa mlciac ka i cikicipagabawinit;/u j:*i i kawicimonit anic mlgu gayli win andotank {:/ui i ka-20 wicimunit. Ocr ugri gonIni /u a kiwa^Ima rnganan: "Miziwau iIgi /u kitocimag i-i-ma 11 cingicimuwat icikawicimunkaya ;kuntigu kigrkatc."c,"Aye kagat uningikatc."Anlc mlguiacimadwasininigIni /u wlbitan I a 8 a /u Nanabucu, a pltcikrkatcit. Midac kagiilt25 ka i cikawicimut i i ma 11Ini /u a 4 kiwa n zima i-nganan:kibl tawacaniwan."nisawicininit, o-o clac krkitowan"Taga,kimicomaiwa awi i- k
all75you now that father of; yoursismybrother." And thiswas the way he told of how he was related to the oldWolf: "He is of my old brother," he said to them. Andthis was what he said to the son of the old Wolf: "Why(you are) my nephews,"he said to the Wolves. And thishe said to them : "Whither are you hegoing?"said to them."Off over here last summer your nephews did somekilling, and it is thither we are :going for it was alwaysthere that we have cached what (my children) have found.Therefore over to the place where we had cached awayeverything is where we are endeavoring to go."And this to them said Nanabushu : "So am I boundfor that place too, therefore I will go along with you,"he said to them.Well, it was true that he then went with them upontheir journey. To be sure, he could hardly keep up ashe travelled along with them. A cold wind was blowingas they went. And then as evening was coming on, "Itisperhaps now time for us to look for a place to camp,"they said. Thereupon they truly went seeking for a placeto carnp. Very soon they found a place where they wereto-,camp about a spot where the wind had fullsweepwas where they prepared a place to camp. "Here is a place,"they said. At once they made ready to lie down so after;they had (each) circled a spot in which they were to lie, thenthe same thing did he when he lay down to sleep. Thishe was told by the old Wolf: "In among where lie yournephews do you lie too; it seems as if youwere cold.""Yes,indeed I am cold." Now, then the chatter ofNanabushu s teeth could be heard, so very cold was he.Thereupon truly, after he had lain down in the midst ofwhere they lay, this then said the old Wolf: "Pray,letyour uncle have the top-covering."l1Referring to the tail.
udigon7 6Mldac kagatpinanowaniwan Ini /u pacig, mlnawa ini /upacio--, mitugigu kauntcinibat. Kaga tsa klcungwan. Midacningutinigu kuckusit, kagatsa abwaso. 6 wiclac krr kito:"Kaga tsa, nintabwackagunanIni /u animowaniuwucan !"5 Ningutci ka rcra^pagita irt, o*o*dac uglmadwa i gona kiwa n z!mainganan:"Kagatsaugl i gon lni /u a 4 kiwa n zlma rnganan.mi/ukitimlgamag Igi /u kitocimag,"Anlc wlbagu mlnawa anigi katci, anlc cigwa mlnawa/umadwawasininigIni wlbitan.10 "Mlmawlnigu cayigwa tcigawatcit a s: a /u kimicoma i wa.Aninta wlni u />umlnawa awra siwag mri kibl tawacaniwa ?"oMldac kaga t a s a /u pacig ka iciinanuwanit, minawaIa 8 a /upacig.Anlc migu mlnawa kra niklcosit.15 Anlc, midac cigwa tciwabaninig, anic cayrgwa wimadcawagmlnawa. Anic cayigwa ugri gon ini /u a l kiwii n zlma*rnganannongum wunagwucig: "Mlsatcitagwicinangiwitipamri cayank klcpin kicfkayank."Midac kaga t kanlcimadcawat, midac anupimiba tot20 Nanabucu. Ningutinigu bapimusawat,"Mlmawincigwatciglwlsiniyanguban," udigonIni /u a kiwa^zTma-rnganan.Mlsa kagatcayigwa Nanabucu ina :ani a t pltcipodawan.""Taga,25Mlsa kagat ka ir kwa kwisitot, midac natunawat Ini /uutickuta kanan."Anlnacictcigayan?"Ini /u a l kiwa n zlma"rnganan.Cigwa kanoniman Ini /u pacig: "Taga, kin, potawan,"inimawan.Mldac kagatpimiijawan i i*man krtrkwa kwisitot ini /u30 mi tigon cayigwa acipacitcikwaskwanutaminit, panagum,amiskwa kunanig.
When77Thereupon truly one of them tossed his tail over him,and the same (did) another;so in that way he went tosleep. Truly, very warm he slept. And now, when oncehe woke, he truly was in a sweat. So this he said :"Forsooth, but now I am made to sweat by these oldaside he had flung them, this he heard!"dog-tailssaid to him by the old Wolf: "Intruth, very shamefullythe old Wolf.you use your henephews,"was told bySo when in a little while he was again o becoming o cold,then already again the chatter of his teeth could he heard."Without doubt your uncle is already freezing to death.Why do you not again let him have your top-coverings?"Thereupon truly, after one had tossed his tail over him,then another (did) likewise.Naturally then againhe was warmed.Well, it was now time for the morrow to come, so ofcourse they were already anxious to be off again. Sopresently he was told by the old Wolf: "It is this eveningthat we shall arrive at the place for which we are bound,if onlywe hasten."Thereupon truly, as on their way they started, then witheffort went Nanabushu running. Now, once as they werewalking along,"Itsurely must be time for us to haveeaten," he was told by the old Wolf. It was true thatpresently Nanabushu was told: "Pray, go on ahead andhave a fire builtup."Thereupon truly, after he had gathered his wood intoa pile, he then sought for his flint."What are you he was askeddoing?" by the old Wolf.Presently (theold WTolf) addressed one (of his sons): "Isay, you kindle the fire,"thus (the son) was told.Thereupon (the young Wolf) went over to where (Nanabushu) had gathered the wood into a pile the instant he;leaped over (the wood), upthen blazed the fire.
73"Na ,mlsai i u acictcigank rr u wapo tawangin."Mlsa ka i ciwlsiniwat rrma 11 ,mldac cigwa kra nimadcawat; anlc wrkagwatataguicinog. Kawln kanaga anuglpangicimtmit,nawantcic pimusawag. mri tU "Anlc, pacu 7 cigwa,"5 utigo c . Mldac uskitibi katini a c p! wadi tamuwat. Anlcmldac i i-ma ka 11 i cikabaciwat kl ircikawag. Cigwasa natasantcigowag.Anlc kaya win mina aya r, uto pa kunisagmlna. Mlnawa wacackwatowan mina Nanabucu."Kaguwin ka a pltcitibi^kak wabandangan pamagu kiglcap klga-10 wabandan," kri na. Mldac ka i nint :"Pamakigicap."Mlsa acinanontayagantank tcibwawabaninig. "Tagapina,ningawabandan," kri-nandank. Mlsa kagat ka i ciwabandank,anln ka cinank iwayabandank kagwanisagimi s tcakwatini4 8 /u i mo n !sonagic Mldac ka/rcipa kwandank, mldac15 ka iciwabaninik, caylgwa kwa kitawan anln ka rcinawat;kagwanisagimiHca kwatini G /ui i mo n !sunagic Anlckaya win kwa/ki sta, o O dac ugri*go:kimadwantciganaban.""Intigogucacaylgwatibi kunkCaylgwasa kayawm udanumatasiton l si i />ukaya win20 kamlnt. Klyanabitacin 4 8 /u i to pa kunisag, kaya Ini /u wacackwatowan klyanabitacin. Mldac uba pH gon."Anlnwaridcitotamanl i}]i /u kri cictcigayan? kawln kitagipapamandanzlna pl tcitibi kak, nackadac ajrrnlga rtisuyan.Kagatsa
79"There, that is the way to do when one intends tomake a fire."And so after they had eaten there, then presently upontheir way they started ;for they were trying to arrivethere (that day). They did noj: stop even when the sunwent down, right on they kept going. "Well, it is alittleway now,"he was told. And it was in the twilightwhen they arrived there. Now, it was after they hadgone into camp there that they built a shelter. Presentlythe cache. And as forthey went after (the contents of)(Nanabushu) himself, he was given a certain thing, somechoice firewood was he given. Besides, some fungus wasgiven Nanabushu. "Don t you look at it during the nighttime;not till in the morning shall you look at it,"he wastold. And so this was what he was told: "Not till inthe morning."And as he grew restless waiting for the morning beforeit was time to come, "Now, really,I should like to seeit,"he (thus) thought.It was true that after he hadseen it, what should he behold as he looked at it but an!enormously large moose-gut And now, after he hadbitten off a piece, and then after he had looked at it,that moment (from where they sat) did they turn aboutto reach for something ; (and)what was he to see butthem (in the act of reaching hold of) a wonderfully largemoose-ut !o So then also turned he in his seat to reachfor something, and this he was told: "It truly seemed bythe sound you made last night that you had been eating."Already now was he too trying to take out the thingsthat had been given to him. The mark of his teeth wason the choice firewood, and on the fungus was the markof his teeth. Thereupon fun was made of him. "Forwhat reason did you do what you did? You should notfor behold thehave bothered with itduring the night,
Sokawln klni tanonta n szl, iwidaci iiniga toyan /uAnlc, wagunacwin kamldcit?"kimisat.sMisa intawa acra camigut mlnawa /u i i .Anlc umisawinamawan.Midac ka-rcra camigut, anlc, misa / klwisinit5 kaya win. O O dac ugri-gon Ini /u a kiwa^ima i^ganan:"Ambasano, papamigusita," ugri gon."Wa a wa pajigkitocim kigapapanantawantcigam, mlgu i u pa pic mminan.Kaga t umaci a ii Ini /u awasiyan."Midac kagat ka icikusiwat, a pana kamadcanit !:/ui i10 utockinawamiwa. Wrkaguna pitcinag kanimadcawad.(A pana a i ci kawanit iY u utockinawamiwa nudac anipapimaa nawat. Midac cigvva ningutingigu anipima*a nawat,ninguting anrrnabiwat, ugiwabandanawa upimwackltlwininika u-ntcimaclciba tonit. O o-dac ugrrgon Ini /u a l kiwa n zi-T5 ma rnganan: "Anrayamu* kitocim fiii /uu pltaw^acan.""Sa 11 ! Anlnkatotaman i i >u mackitlwinickaniayayan?"i kito a"a/uNanabucu. O vvidac udigon ini /u a l kiwa n zl-:ma-rnganan "Mamindaga kigri-nigama11aVObiminasi kamini20 aciba pawabinaminit ; waboyan idac uglta kunamini.kitocim."4 R /ui i mackitlwin;ac-i oda pinaminit miclac"Icta!Pidon, nitcizazi kizi, ninganipimuntan," ugri nan.Midac kagat ka pljimmigut mldac anipimondank. Anic,mlsa x mlnawa kanlcimadcawat. Ningutingigu anipapimu-
8idisappointment you have done yourself! Truthfully areyou not good at giving heed, and on that account haveyou disappointed the craving of your belly. Why, whaton earth is he going to eat?"And so accordingly was he again given that to eat.Now he felt a desire for (what they had). And after hewas given food, why, he ate too. And this he was toldby the old Wolf: "Pray,let us go travellingabout withall our possessions,"he (thus)was told. "Alongwith allof these nephews of yours shall you go as you journeyabout hunting for game, and this Igiftmake you forall time. Truly, he is good in getting game."It was true that when (he and the Wolf) left the camp,already off had gone their companions. Not for a whileafterwards did they leave. Ever in the trail of theircompanions did they keep as they followed along behind.And then occasionally while they continued holding thetrail of the others, once in a while as they looked whengoing along, they beheld the fresh droppings (in places)from which (their companions) started running (again).Now, this he was told by the old Wolf: "As you go, takewith you the top-covering of your nephew.""Disgusting!What should I do with the yielding filththat I should take itsaid Nanabushu. And thisalong?"he was told by the old Wolf: "Miserably pitiful have youmade your nephew by sayingthat." Then he went towhere the fresh dropping was when he reached; (and)took itup, he then gave it a shaking ; then a (white)blanket he was holdingin his hand."(I)declare! Fetch it hither, my old friend,I willcarry it along upon my back," (Nanabushu) said to him.Whereupon truly hither came the other, who then gaveit to him, and accordingly then went he on his way carryingitupon his back. Well, so then again were they off on6 PUBL. AMER. ETHN. SOC. VOL. VII.
>u"82sawat utanri gon Ini /u a kiwa^Iyan ; wcrcr udigon:"Mlsai u Ini /u tcro nitcaniwan paminlcawawa lgi /u kidocimag.Anic, mlsa gaga t cigwa aniga kiawat Igi /u kidocimag.Ningutingigu kinibataga kwismini I 8 /ui iwlbitani.5 "Naginin, Nanabucu, midugoma anu-a nipimwawagwanIni /u mo n 7111son. Nanabucu, taga ani a-yai^i ubikwa ka c a /ukidocim.""Sa,bina ! Amnda8katotaman /u i i animwabidic kani-?"ayayan10"Kagatsa kidinigamag Igi u kitocimag." Ajiblmra yaminitnani kakubitonit Ini /u a kiwa^Ima rnganan. Mldac ajipawiwapinaminit,kuniginln, kaga t pikwa k uglta kunamini !"Pldon, taga," ugl nan.iMldac kaga t ka ijimmigut ka;ijipimiwitot. Cigwa15 ninguting ugiwabamawan cingicininit udqjima^. Kawmkanaga ningutci tcimiskwlwakunaganig. Kuniginln, Nanabucu kanona : "Kanitagawagwan igi /u kitocimag. Mlsai u andotamuwat ma kawawatcin ini /u md n zon."Kamdtcigisinit!ni /u a kiw^slyan.20 i-i ma n kataciwiyasikayank."UA U ,la 11 , Nanabucu,wikici tota"Wagunanrikawiyasi katamank?"Mldac agutIni /u a kiwa^zImaTngan:kitinigamagkitocimag.""KagatsaMldac kagat sibickatc witci a tucigawat. Kawin kanaga25 tcimadcicininit, plnic panima kaklcigawat paplndigawag.Anln kaicinank? Cigwa unawi a- kaya win, abi tagu wlnin
"83their way. Now once while they were walking along, hewas addressed by the old (Wolf). This he was told :a big cow that your nephews are after. Why,"It isit is truethat now are your nephews pressing close uponit."And presently (he saw) sticking in a tree the tooth(of one of his nephews).Look, Nanabushu !perhaps here may have been wherethey shot at a moose, but failed to hit it.Nanabushu,pray, take that arrow of your nephew s as you go.""Pshaw! What am I to do with that old dog-tooth,that I should take italong?""Truly, indeed, have you done your nephews a wrongby saying that." By giving it a twist the old Wolf pulledit out;and when he shook it, lo, an arrow was he trulyholding in his hand !"Fetch it hither, please,"he said to (the old Wolf).It was true that it was given to him ;after which heotook italong. Then by and by they saw his nephewslying down. Nowhere at all was there snow on theground. Behold, Nanabushu was addressed (in thesehave killed."Somewords): game must your nephewsThat is the way they act whenever they have found amoose." Then happy was the old "Corne(Wolf). on,Nanabushu ! let us make a place where we can preparethemeat.""Where in the world is the meat for us to dry?"Whereupon was he told by the old Wolf: "Truly, indeed,pitiful have you made your nephews by sayingthat."Thereupon truly, much against his will, (Nanabushu)helped them make the lodge. Not at all did he movefrom where he lay, (which he continued to tilldo) lateron, when they had finished the lodge, (and) one by onethey were coming in. What was he now to see? Alreadywas he allotted a share, half of the fat was the share
8 4kci/u i wanawi-rnt. Mlsa pitclnagI rma n klminwandanku itciwlsiniyan kaya nln,"krrnandam."Mlnangwana"Wandcitagu kaga tiguna minira-yang."9. NANABUSHU AND THE WOLVES, Continued.5Ningutingigu rrma n mamo n su t kawat, "Ambasanona,kosinan ta-a<cka. Mlgwantacina c u i a l ta pimisa kwat," ugli-Hawaii Ini /u osiwan.Mldac kaga tcigwa kimadci tanit lni /u osiwan. O^owidac:udiguwan "Ambasano, kagu"kanawabamici kagun wo fio /uwra- kayan. Ayangwamisin, Nanabucu," iniudigon /u10 a kiwa^zfmaTnganan.Mldac kaga t.Amc Nanabucu u kunacic acikackackiwicink, misa pisindawawat,indigunandagu madwagana pi tciga. "Taga pina,ninga rnab,"inandam Nanabucu. Kaga t aci a gwasaigi-15 nank s /u i i u l ukunacic, tcigwa kaga owabaman na i ta i*iubigwa kugananini na rta utowawicacanatamini; kagagumica klgablgagotani rr u usibickanamowinini. Mldac kanawabamat,ningutingigu aciku tigwandaminit a pidci i i ma 11uckmcigunk acipangisininig. Panagu, tco n to n kaini tank.,20 "Cigwadac,Nanabucu ningwackwagana*a mawa !" Mldaca kidut ; a fi a /u a kiwa n l zl:"Ayawi k kimicoma rwa,ta kabawanik!"Midac kaga t krta kabawinint, midac ka i cimi kawit.Mldac ka-i-gut Ini /u a l kiwa n zlyan:25 bamivvambansa.""Nanabucu. kanawa-
85given him. So then was he well pleased over it. "It iscertain that I shall eat too,"he thought. "Truly, veryexcellently are we now living."9. NANABUSHU AND THE WOLVES, Continued}Now once, while they were fixing moose-meat there,"Please let our father boil the broken bones for themarrow. Therefore then let him be the only one to dothe cooking," they said of their father.Thereupon truly began their father upon his work. Sothis were they told by him: "Ibeg of you, watch me notwhile I am at this work of boiling bones for the marrow.Have a care, Nanabushu," he was told by the old Wolf.Thereupon truly (such was what happened).Now, as Nanabushu lay wrappedin his old soiled blanket,and as they listened to (their father), it seemed by thesound as if he were gnawing upon a bone. "Isay, now,I will take a look," (thus) thought Nanabushu. Truly, ashe quietly lifted his old soiled blanket, he saw him at thevery moment when he was biting on an ulna, but at justthe time when itslipped from his mouth and; nearly tothe ground was stringing the (old Wolf s) saliva. Andnow, as he was watching him, then of a sudden (the oldWolf) lost his hold (on the bone) in his mouth, (and)straight yonder into it(Nanabushu s) eye struck. Thennothing but tco n to n was the sound he heard. to, , "Oh,Nanabushu slipped a bone from my mouth!" Whereuponsaid the old "Attend(Wolf): to your uncle, cool himwater !"withAnd so they truly cooled him off with water, whereuponhe was then revived. Accordingly was he then told bythe old (Wolf):"Nanabushu, really you were lookingiSee Nos. 8, 30, 44.at me."
<kri86"Kawln,"Nanabucu,kawln !"kanawabamiwambansagu."Amc cigwa kigicap, amn aya pitcisigwanig pimida?lAmc udacamiguwan kigicapu fci i uda kanini.5 Cigwa udinan :"Ambasano, mn ni tam-ninga a ft ka,"15udina . Midac kagat a kat. "Anicmlgu gaya nln, kawlnI 8wfka ninganawabamigosl i i a l kayan. Amc mlcigwatcigackackiwicinag."Amc tcaTgwa umadclplsiganaananIni /u a kanan. Kagatsa pimitawikanagatiniwan. Migunal10 anislwaganatank /u i mini k pamitawikanagatini k, cigwa{:ikumaa pl pltikwacinon kackackiwicininit Ini /u a kiw^zlmarganan.Wawanigu ugrtrnabandan l s /ui imangikanagatinigu kan ka rcra l cogana/a nk, ka icipaki ta O wat Ini /u a l kiwan z!ma*rn2fanan. Amc m!sa / aciniwanawat. O c odac umoo{:15 /u -i na*" i i utocima 8 :"Nackana, ta kabawani k !"ugrrnan.Medac ka i nat: "Kanawabamlwambanisa nltcizazi kisi.Misa aciayayan awiya kanawabamitcin."11Anic mrr cigwa kimi kawit waV u a kiwa^ima-rngan.Wo^owidac ki i- kito: "Nanabucu nimpaki l ta u l kri- k," kito;20 "untcitagu nimpaki l ta*u mt k 1"-kri- kito wa*a* u a 4 kiwa n zimarngfan."Kawln kuca anawi ninp;anawabaniasiban ,"OC5kito wa c a u a "Anickiwa^ima-rngan. pamasana kaya nlnkiga a camininim."oMidac kagatkigicap. Cigwa anlc na Ini /u uda ki kon25 kanabatc wlgwasaba kwang a pi tcisigwani 4 j: /u iupimita kan.Cigwasa minawa udacama ; 8 /ui i udocima s . Amc mlsa 7cigwa kidamwawat Ini /u umo n zumiwan, "Mlmawin cigwa
8;"No,no!"at me.""Nanabushu, really you were lookingSo when (came) the morning, how thick was the greasefrozen! So they were fed in the morning upon the greasemade by boiling the bones.Now (Nanabushu) said to them: "Pray,let me have aturn at making grease from bones broken and boiled," hesaid to them. Thereupon truly he made some grease."Now, it is the same with me too, never should I bewatched while at work making grease from broken bones.So therefore cover yourselves up."Now began he uponthe work of cracking the bones. Truly very greasy were(the bones). Now, while he sucked the marrow from asmany bones as had grease in them, at some distance away,with his head towards (Nanabushu and) rolled upin hisblanket, laythe old Wolf. With care he selected a boneof great size which he had split crosswise, (and) with ithe hit the old Wolf. So he then killed (the old Wolf).Now, this he said to his nephews: "Mercy,cool him offwith some water!" he said to them. And this was whathe said of him: "Myold friend was certainly looking atme. That is the way I behave whenever anyone iswatchingme."So then presently was the old Wolf revived. And thishe said: "ByNanabushu was I struck,"he said; "purposelywas I hit by him," said the old Wolf. "Noattempt whatever did I make to watch him,"said the old Wolf. "Sonot till after a while will I feed you."Thereupon truly was now it morning. According tothe story, the grease in his kettle was frozen as thick asa sheet of birch-bark covering of the lodge. Now, againhe fed his nephews on So it. by the time they had eatenup their moose,"It must be time for us now to movecamp,"he was told by the old (Wolf). And so he was
"88tciguslyang, utigon ini /u a kiwa^zlyan. Mldac agutIni /ua kiwa^zlyan: "Pacik kiminin was;a /u ningwisis," utigon.Anlc unana/kuman. "Mlsadac izan rr u ka/irndciminoayayayan. Intawa mlgu oma ka u*ndcit,"udinan !ni /u5 a kiwa n zyan."Anlc, mlsagu i u wabank tciguslyang," utigon Ini /u a kiwazlyan.Anlc mlsa gagat cigwa kusiwat. "Namaguna aya a<<;a /ukawabanicimi k," ugri gon Ini 11 a kiwaziyan.10 Mldac kagat.10. THE DEATH OF NANABUSHU S NEPHEW, THE WOLF.Mldac ka ijipa kaguzita tiwat. Mldac ka ijikabaciwat,mlsa kaga t unisani Ini /u awaslyan. Anlc kawlnigu piicigwanunkayaslwag. Paniigu papamigusiwag. Mldac kaga tLigitcimamrkawi a nini ini /u awaslyan. Kaga mmo t a ya.15 Ningutingigu papamigusiwat, acimawlngwaminitIni /uumicomayan. Al>a /u ma i ngan acinimiskamat, "Intackanlnltug manapamigwan," udinan i^ i 711 klciglnipanit.Mldac ka icikuskusinit, cigwa kaga t uwmdamagon:"Kagatsa, nintojim, kigic tcimanabamin. Ambasano, manu20 pisindawicin ka/rmnan;manu icictcigan 4 t! /u i kaininan.Klcpin wlnontawisiwan c xii wisa kaininan, kaga tklga i niga-4tonl G /u i ikiya /u .Ambasano, misawa ku ani a timat was:a /u
8 9told by the old (Wolf): "One of my sons I give to you,"he was told.Now, (Nanabushu) uttered assent (whilespoke). "This, indeed,the old Wolfwill be the source from which Ishall obtain good sustenance. Accordingly from this placehe should go forth (tohe said to the oldhunt)," (Wolf).it is on the morrow that we will move," he was"Well,told by the old (Wolf).So it was true that then they moved. "Iamleavingyou one who will keep you supplied with food throughoutthe winter," he was told by the old (Wolf).And it was true.10. THE DEATH OF NANABUSHU S NEPHEW, THE WoLF. 1Thereupon they separatedfrom one another.And when(he and the Wolf) went into camp, it was truly (the Wolf)that killed the game. Naturally not in one spot theyremained, always from one place to another they went.And so truly was (the Wolf) ever killing the pick of game."ITruly was he living well.Now, once while they were moving about, in his sleepwas (the Wolf s) uncle weeping. The Wolf indifferentlysigned to him with the hand, fancy that probably hemay be having a bad dream about me,"he said of himwho then was taking his nap.Thereupon when (Nanabushu) woke, then truly was (theWolf) informed by him, saying: "Verily, my nephew, haveI had an exceedingly bad dream about you.Ibeg ofyou, please listen to what I shall say to you ; please dowhat I tell you. Ifyou have no desire to listen to whatI have to tellyou, truly then will you do yourself aninjury. So please, even if it be when you are overtaking1For other versions see Nos. 31, 45.
9oawasP, manii mi tigons klganabo kubiton misawa pangin sslblnsiwa kamigak, mldac i l ma 11 kanra pagitoyanlmi tigons. Mlsagu panakatotaman."i:i iuAnic mlsa gaga t acictcigat misawagu cigwa adimat.5 Anic ningutingigu piminicawat mi /u awasPyan - - anlc mlgupana 4 8 /u iacictcigat kagatsa clgatci. Ningutingigukani u ndciidacpiminicawatIni /u mo n son- -anlc mlcigwaanawi slgwaninig- -mldac anantank 8 a*a u ma rngan piminijawatIni /u mo n zon, kaga t ki tciunltcaniwan Ini/u pami-4 810 nicawat. Mldac cigwa tababamat, mlgu/u i i a pitci cigwatabipinat, ugiwabandan pangPs slbmsiwa kamiganig.KPwa n krrnandam: "Ambasano, mlgu u i kanrijra/cawigwackwaniyanc Ki i ma n siblnsiwa kamiganig." Panagu nawagamkapangicink s i i nia n ki tcisiblnk, panagu kasaswiinik15 u tawagan.Misa 7 papimusat Nanabucu acinica i ka kawanit lni /uutociman, cigwa unisito kawa/a n kc^ki a nigubanan ningutingigu anrrnabit, panaguki tcisibi kabimi tigwayanig.Mldac acimawit Nanabucu. Mlnawa ku ningutci anuwri ca,20 a /upanagu pabamatamut. Kagatsa umindcinawasinan Iniutociman. Anlc ugi kantan awlya totagut. Ka ijimadcatmsatciwan 4 c i /u sibi. Anic anibimatamu. Mldac ka ijisagitawacagamat48 i /u sibi, mldac i i ma n owabaman Ini /u
game, as you go along break off a little stick, no matterhow small the dry bed of a brook may be, and thereshall you fling the little stick. That is what you shouldalwaysdo."Accordingly that truly was what he did whenever hewas about to overtake (the game). Now, once while hewas in pursuit of some game,- -for that was what healways was doing, - - truly, he grew tired (of throwing astick into the dry bed of brooks). For when once awayfrom a certain place he was in pursuit of a -moose,since it was now getting well on towards the spring,-this was the feeling of the Wolf when in pursuitof themoose, truly a big cow was he following after. And thenpresently, when he came in sight of her, -- indeed, when he-was on the very point of seizing her, he saw the drybed of a small brook. They say (that thus) he thought:"Well, now, (without throwing the stick ahead of me,) Iwill leap right on across the dry bed of this brook."Then straightway down into the middle of a great streamhe fell, and all the while was there a ringing in his ears.And now, while along was walking Nanabushu as hefollowed the trail of his nephew, he presently noticed bythe sign of the tracks that (his nephew) was pressing close(upon the moose) ;andonce as he looked while goingalong, there, to his surprise, was a great river flowingacross his path. Thereupon wept Nanabushu. Thenrepeatedly from place to place in vain he went (to getacross), and all the while he wept as he wandered about.Truly sad he felt for his nephew. Now, (Nanabushu)knew that by somebody was he (thus) treated. Afterwardshe started down the course of the river. Now, he weptas he went. And now, when he had followed the courseof the river to where itopened out (into another bodyof water), then there he beheld the kingfisher looking
92uglckimanism inabiwan rrma n nibrkang. Acinawatinat,mldac ka icipicigunat uctigwanining anuglna U tinat. Midac:ka/rgut"Micanim Nanabucu! Niwiwindamawaban wina 11 ,"ugri gon.5 "Taga, wlndamawicin," ugri nan.Mldac kagat ka priji rcanit."Tagackuma, wlndamawicin, nicimisa," ugriuglckimanism. O o widac ugli gon :Km mawin Nanabucu," ugri gon.10 "Kawm," ugri -nan.8"Ayenan ini/u, klgawmdamon.Wo o* idac :ugrrgon "Ka,anica Nanabucu udocimanklma kama. Mraf * ugimamiclpici, kama mra/-u kamat Ini /uNanabucowan udocimini. O o widac nintinandam, magicakaya mn unagic sagitciwapinigatanig. Kaya nln nintinan-15 tarn rrma ukra 11 gosiyan, mlgu*i kanawabiyan rrma nkra gosiyan.""Kao-atsa awawa, ambasano, wawmdamawicin," um ioonanIni /u uglckimanism."Mackut tcru niciciyan kigai ci i n."Medac kagat ka i cina kumigut.20 Mldac ka-rciwawacra/t Ini /u uglckimanism, Ini /u udonamananklwawacitcigagat. Mldac kiwawacra t Ini /u uglckimanism. O o widac ugri gon:"Ambasano, ayangwamisin,Nanabucu. Kigawito kawin 8 H* U kadicictcigayan," ugri nan25 "Awawa," ugl i-nan wa 8 a /u Nanabucu."Nacka, klgawawmtamon," ugri gon Ini /u uglckimanisln.8l,kagat mlgiri ma 11 tcra yayan pacu irma 11 saga i gan"Ayesagitawa," ugi i gon ;"medac i i ma 11 nawagam minisinatawangak.Midac ima n andaci kawat klcigatinik klcpinl1130 mica kwatinik; mlgui acinibawat ka kina. iMlguu kaba-
"93down into the water. He made a grab for him, but hehold of him at the head when he tried to seizeslippedhim. And this was what he was told: "Confound Nanabushu! I meant to tell him something,"he was told."Pray,do tellme,"he said to him.Thereupon truly hither came (the Kingfisher)."Doplease tell me, my little brother,"he said to theKino-fisher. So this he was told: "Yes,I will tell you.But you must be Nanabushu," he was told.he said to him."No,"So this he was told : without reason was Nanabushu s"Ay,nephew taken away from him. It was the chief of the greatlynxes, 1 it was he who took away Nanabushu s nephew.Now, this was I :thinking Perhaps I too (shallhave a shareof) his gut when it is thrown out (from where he has beentaken down).I too wanted it, (that) was why I was perchedup there, and watched for it while perched up there."Truly, then, all right! Pray, go ahead and tell meaboutit,"he said to the Kingfisher."In return I willmake you so that youwill be beautiful."Thereupon he truly was willing to do what he was asked.Thereupon, when he painted the itKingfisher, was hispaintthat he had used. And so he painted the Kingfisher.Now, this he was told: take"Pray, pains, Nanabushu;for I will help you in what you do," (thus)theKingfisher.to him said Nanabushu."Allright,"to him said"Listen! I will now tell you,"he was told by the Kingfisher. "Yea, truly, there at the place where I stay, closeto where (the river) flows out upon this lake,"he was"andtold; so out there upon the water is an island ofsand. It is there they amuse themselves by day whenthe skyis clear,andthere they all sleep. And so all1Chief of the great lynxes, the great water-monster of the sea, lakes, and rivers.
94gijik aciglciginibawat. Medac iima n tciwabamat a^a 11ka irda pinat Ini /u kitociman. Pama ickwatc agwamri ma 11 o-a l kina agwa tawat Igi /u lmanito^. Midacltaei i ma no o o oa pitcmawaya r cingicing a s a u ka irta pinat Ini /u kitociman.5 Wabickisi minangwana a 11 klga i nandam a pl mockamut.Mldac i i-ma 11 nawaya*r tcinibat. Na x ,misa aciwlntamonan.UsamAnlc mlgu ma i 1111i ikatanisiyan ma tciayayan.kaga t kigrtabi ka i-ci i yan. *Pi /u kri ci i-yan idac ka U n-dciagawatansiwan l i u kamldciyan."10 Kaga t ugawanipaci a n ini /u kigocansan a s a /uugickimanisil;anic an i tinsan kimina a c a /u uklckimanisi. Miclaca pidcikiwawlcantam.Cigwasa kaga t Nanabucu kisagitawacigama l isagaifigan.-Mldac ka rnandank tcimica kwatinik. Mldac kagat15 ka i cimica kwatinik. Ka*i ji*u*jigabawit tcigigicap tcibwamoka a minit klzison, anic manisisag kra wi ;rrma n tclgibigkipada kisut. Mldac I 8 /ui iwlnag kawm kri cinagusinini,misa 7acigwinawicictcigat, anic inasamigabawi iwiti nibrkang.s"Amn ka-i cictcigayan?"kl i nandam /u i iwlnagtcri cina-20 gusininig. "Anlc, ningawati kwani 11 / Medac ka/rcibwanawitot mldac ka i ci a nonat lni /u uglckimanesin tcimldcitaminit.Midac kagat ka icimldcitaminit, mlgu a panaponlnit i i ma" winagank. Midac tkaga ka i&cinisi tawina-gfusininik u ka i i ionackitcitaminit.i /u25 Cigwa kaga t owabandan mamatcltciwaninig. Cigwaowabama mockamunit awiya anotc awlya mockam65;; mlgupimra-gwa tanit ima" minisinatawanganik. Migu a pana
He95day long they nap. And so there will you see the onethat seized your nephew. Not till the last does he comeforth out of the water to where have come all the manitous.And then there in the very centre lies the one that seizedyour nephew. He is white, and therefore by that signwillyou know when he comes up to the surface. Andthere in the middle will he sleep. There, that is all Ihave to tell you. Now, therefore, there will I be presentwhere you are. Ever so proud, truly, am I of what youhave done for me. That you did so to me iswhy I shallnot lack for what I shall eat."Truly, always with ease will the Kingfisherobtain thelittle fishes;for with tiny spears was the Kingfisher provided.Accordingly very pleased was he with the gift.Then truly Nanabushu followed the stream to where itopened out on the lake. Thereupon he willed that thereshould be a clear day. Whereupon truly there was aclear day. After he had found a place to stand veryearly in the morning before the sun was yet up, theninto a dead pine stump he changed there ; by the edgeof the water he stood. But yet his penis did not changeits form, whereupon he was at a loss to know what todo, for as he stood he faced the water. "What shall Ido ?" desired that his penis should not look that way."Well, I will have a branch (there)."And when he wasunable to produce it,he then had the Kingfisher muteupon it. And then, truly, after he had muted upon it,then continuallylit he there upon the penis. Whereuponittruly could not be recognized from itsappearance, byreason of (the Kingfisher) having muted uponit.In time he truly beheld the water setting up a ripple.Presently he saw a creature come to the surface, then allkinds of beings began to rise upon the water and then;hither came they forth from out of the water upon the
!"udigonkl>u96agwa tanit rr u manito c ,anotc acinagusinit."Mldac awa-inandam.niban,"Anlc mlgu-rma" agosinit mi /u "Mlugickimanisin. cigvvakaga," udigon; "tcimockamut," udigon."Mamawi ickwatc5 tamockamu," udigon.Mlgu Mldac kagat acinawatxi -i manitofi.aninibanitima n minisinatawangank. Wl kagu awaniban awlya kamockamunit.wawabamat."/"Mlsaca ta*a!:, Nanabucu, kamockamut wa a /u10 Ningutinigu ca i gwa ki tcimadcitciwanini rr u saga*i-gan."Mlcigwalni /u ugickimanisin.Cavig^wa kaea t inabit ri witi nawaram untcimockamo-J O O Owan, kaga tsa uniciciwan. :Cigwa madwaglgitowanbucu awati kanibawit," madwa-i^kitowan."Nana"Anm kagicina-15 O O widac madwa/r kitowan mi /u :pajiggwa k kayawit c a c a /u Nanabucu?" madwa*r ( kitowan ini /upajik.Mldac ka-i- kitut mlnawa pajik: "Madclnata i jimanitowi."O o widac kri>lkito awati agumut: "Kawln20 Taga, kinabi k, awititibana kwa 8 ."wlgwra*patasl.Kaga t kipitotawan ka i cititbana kwa U gut. Kwratcigu c ku"Yo!" tcri kitut ka i ci-a-bisku tanit. "Anlnkaglcinagwa kNanabucu kayawit?"i- kitowan.
"He97sandy island. Then in a multitude out of the water camethe manitous, of every kind that were, and the way theylooked. "But he is not there,"he thought.Now, up yonder was perched the Kingfisher."It isnearly time," (Nanabushu) was told,"for him to come tothe surface," he was told. "Of* them all, he will be thelast to appear,"he was told.And so they truly seemed to him like the manitous.And as they came, they went to sleep there upon thesandy island. It was a long while before the absent onecame up to the surface. "Now, that is the only one,Nanabushu, yet to appear, (the one) that you have beenwanting to see."Now, at times the water moved in great ripples aboutover the lake."Now, then!" he was told by the Kingfisher.Now, truly, as he looked out there upon the water fromwhich the creature was coming forth, truly beautiful wasthe being. Presently the voice of him was heard saying:"It is Nanabushu that stands the voice of himyonder,"was heard saying.And this one of them was heard saying:"How couldNanabushu be changed to look like that?" one of them>was heard saying.And this was what another said :is without thepower of being a manitou to that extent."And this said the one yonder, who was yet in thewater: "He does not want to come. Go, Snake, (and) coilaroundhim."Truly (by the Snake) that came crawling was (Nanabushu)then coiled round about. Just as he was on the pointof saying"Yo!" then (the Snake) uncoiled. "How is itpossible(theSnake).for Nanabushu to take on such a form?" said7 PUBL. AMER. ETHN. SOC. VOL. VII.
"Kigawmtamon9 8Midac minawa ka/r kitut awati :"Ambasano, kin krtcimakwa, awiba^pasagobic," ugrrnan.Midac kagat ka picra/gwatanit Ini /u ki^tcima^kwan ka i*-cipa^pasagubinigut. Kwatcigu^ku"Yd!" tcri* l kitut acipo-ki i-5 nri gut."Aninkaglcinagwa k Nanabucu kayawit?"kitowan.i^i 711Nanabucu ka iMidac"Kawln,iTiisagucinagirirt."sibiskatc ka picinatagumunit, a pidcinawaya i icigawicimowan.10 "Wi kagasa a pidci tabosangwaci," kri nandam w^a a 11Nanabucu. Mlsa wi kawa a t tcinibanit, misa kawln niba-lslwan pinic ka kina nabanit. O 5 widac ogri gonlni /u:ugickimanisin a /upi nibat," udigonlniuglckimanisln. "Mimawincigwa kinibat. lAla /u Nana-,15 bucu, amba, awipimi/! Nanabucu, kagu win wiyawingpimwa kan. Kawln potc kitanisas! rrma 11 wiyawink anupimwat,Miya^ta iima n 11mazinatacink mri ma tcimisatijipimwat," utigon Ini /u ugickimanisin.Midac cigwa animadcat nasi kawat. Cigwasa utotisan ;20 anlcipa pacitawat un o<ucankicininit. Amc krrnantamtcaposangwaminit. Midac cigwa krirdisat, anic kaga tcigwa uglkwatackwawan mi /u mi tigwabin, midac cigwawi pimwat. Anic waca pmit udicipimwan, kagatclskatwawayanga*a*t.Minawa pangigu pimaya1i aniri na a*, misa 725 minawa kagatclckatwawayanga a tle /ui iubigwa k. "Icta,
And this again was what the one yonder said: "I begof you, Great Bear, do go (and) claw him,"he said to him.Whereupon trulyout of the water came the Great Bearby whom (Nanabushu) was clawed. Justas he was aboutto say "Yo!" he was let alone by it. "How is it possiblefor Nanabushu to be changed to such a form?" said (the Bear)."Nay,but into such a form has Nanabushu changedhimself." Then cautiously over the water to where theothers were, came the being; in their very midst was wherehe lay down."Would that he might go soundly to sleep!" thoughtNanabushu. Whereupon he waited for him to go to sleep,but the other would not go to sleep till all (the rest) wereasleep. Then this was he told by the Kingfisher:"Iwilltellyou when he is asleep,"he was told by the Kingfisher."No doubt he is now asleep. Now, then, Nanabushu,come, go shoot him !Nanabushu, don tyou shoot him inthe body.It is impossible for you to kill him if you tryto shoot him there in the body. Only there where hecasts a shadow l is where youwill kill him when youshoot him,"he was told by the Kingfisher.to him. InThereupon now on his way he started to goa while (Nanabushu) came to where (the manitou) was ;ashe went, he stepped over them that were lying there. Now,he was sure that they were all sound asleep. And whenhe got to where (the being) was, then truly he strung hisbow, whereupon he then aimed to shoot (the being). Now,in his side was where he shot him; he heard the sound of(his weapon) when it hit him. Another time in a slightlydifferent place he tried to shoot with his arrow, and soagainhe heard the sound of his arrow when it struck."Ah,this was the way mylittle brother told me: There1Shadow and soul are closely connected. The soul of a personis his life:hence to kill the soul is to kill life.
"""krikri*nandam.IOOml ta win ka rcit nicimisa rrwiti agawa tacink icipimuningrr Midac kaga k." t iima 11 waskaningwlcininit acipimwat.Micanlm Nanabucu !5 i^kitunaban. Mlgu i u nicit kanabatc."Nax mra* Nanabucu 11 nindanu-,Mlsa 7 ,acimadclba rwat, mlsa / nipi uno 4 pinanigun. Aninantaganimusiknantupatwadank ningutci tciwatciwaninig ;wrkagu umi kan. Ackamigu a ku ukitcipisut a kwa a-m ri*"Mlmawln ni kibig wo O a l kri andam. Anlcki,"nipi.10 <umicigwa klta kwamatciwat i i wadci /u ,mlgu kayabi klmocka*a*ninig.Ka icia^kwantawat, kagagu abi tawa tigsrr unmi tigo mi u i ka a- kumocka a-ninig medac ka i; cinogickanig.Midac ka iciskablnig ;medacmldacka-i cinlsantawat.ka/rciskabigi i <unipi,1 1 . NANABUSHUBREAKS THE NECKS OF THE DANCING GKKSE.15 Mlsa x cigwa minawa kl pabamatisit wo O a l ki.Ningutingigupabamusat oglwabandan saga gan i ; oglwabamaawlya tacfkanit.?"Awagwanagigic Medacka-rcinasi kawat i i ma 11 tacl kanit, kuniginin 4 c /u i ni ka !"Amantcigic katotawawagwan?"20 mi l kwantan i ikl-i nandani.unandam. Cigwa ugl-kacictcigat. wa-o* "Taga, ninga i nag,"Ambasano, kiganlmrrninim ninga i nag,"kl i-nandam. Midac acikupipa tod ri* u saga i gan; kawlicikacklginatclngubl 8 rrma 11 u kunacicink, mldac acimadata\vangusat.
""101where he casts a shadow is where you shall shoot him,I was told." And so truly there into the side of hisshadow was where he shot him."Confound Nanabushu! There,that it was NanabushuIsaid, but to no purpose. And now perhaps he hasslainme."And now, as (Nanabushu) started in flight, then by thewater was he pursued. With all his might he ran, seekingfor a place where there might be a mountain ;he was along while finding it. And above his girdle was he wadingin the water. "No doubt but that this earth iswhollyunder water," he thought. Now, while he was on his wayup the mountain, still yet was it overflowing. When hehad climbed (a tree), then nearly halfway up the treesthen was whenwas how far the water had risen;andthe water ceased rising.And then afterwards the waterreceded;and when the water receded, then down fromthe tree he descended.ii.NANABUSHU BREAKS THE NECKS OF THE DANCING GEESE. lAnd so again he went travelling about over this earth.Now, once while he was walking about, he saw a lake;he saw some creatures moving about there. Wonderwho theyare!" he thought. And so, when he went overto the place where they were busied, lo, they were geese!"Wonder how I shall do to get at them!" he thought.Presently he discovered what he would do. "I say, thisPlease let me make youwill I tell them,"he thought.dance,I will say to them,"he thought. And then heran up from the lake after he had been off; gatheringbalsam-boughs in his old soiled blanket, then out uponthe beach he went walking.1For other versions see Nos. 20 and 48.
"inawagka<<:1O2Nanabucu awati ! Kawm"Oi, klgabasamigusiwa!Niminawa O yu k !"Igi /u ni ka^sag.Cigwasa owabama Nanabucu, "Namantc winrr 11 kitotawakningutci wa/a !bammagogun Kaga/tagu ningitcrr-5 nigawagantam. Nackagimn ana kamiga k o o witi wantusayan.Kaga t rninawanigusiwag, ki tcipapa pina kamigisiwago-o witi wantusayan. Atatana, ki tcinanimi itiwag!Nacka, o O ma 11picayu k."10Anic kaga t pri cawa 8 .Nicimisatug, nlmi tiwin i nimplton. Misagu ono /u nagamunanka i iciwanayan. Nackasagu kigammi ninim. Ucitoyuk i i ma n kitacinimi inagu k."ujiAnic kaga/t agwa tawag/ulgi ni kansag, midac cigwaltowat i i ina 11 watacinimi ntwa. Anic ugMdncra mawa,i15 l s /ui i ka irci tonit. Aba pic ka kicitdnit."Anic misa cigwa tciblndigayag."Mlsa / iicimockinanit.Aba picka kino a mawat ka i!:icictciganit./ui kiini-"Migiiicitcigayag. Nacka,i na a man kani a rntotamag; mri /<ulkiga ki kino-a monininim20 kani-a rntotamag,"udina i i <uc /ui i kani rna a man, mlgu/uini ka n l sa 8 . "Anm win kiicipabami^tawiyagusam tci kinclisoyan, ningapasigwlwinigu.Mlgu ku u i katatotaman i iu tca kintisoyanin. Anic misa 7l si imlgutcibabatacicimoyan, ri* u tcitcfkindisoyan tcibabananlrniyananigu k."25 Anic misa cigwa madcinimra t u i i* ni ka n l sa. Kiigatsa{:udcrkima mmi a t. "Anic, mlmawln cigwa tciwlnisagwa,"inantam. Midac ajinagamut:
"103will not refrainHey, (there Nanabushu !is) yonder Hefrom saying something to !you Swim out into the lake !"the goslings were told.When Nanabushu saw them, "Wonderwhy youact sowhenever I see !you anywhere Truly hurt am I overmy disappointment. Learn what isgoing on over herefrom whence I come. Truly, a fine time are they having,in a highly delightful manner are they enjoying themselvesover here from whence I come. !Oh, my but what a greattime they always have dancing!Now, truly, hither they came.Hark! Come youhither.""Omy little brothers! a dance have I fetched (to you).Now, these are (all) songs that I have upon my back.So therefore I am going to have you dance. Arrangeyou there a place where I am to have you dance."And so truly out of the water came the goslings, whereupon they now began making a place where they wouldbe made to dance. Now, he taught them how to make it.In time they had it finished."Now it is time for you to enter in." Wrhereupon theyfilled (the place) full. In due time he taught them what theyshould do. "Now, the way that 1 shall sing is the waythat you should do such is the; way you are to act. Now,listen ! I will teach you what I shall sing,and that is whatyou are to do,"he said to the goslings."You shall payno heed to me when I become overwrought with excitement, for I shall be leaping to myfeet. That is what Ishall be doing when Iget to feeling good. Now, that isthe very way I shall move about in the dance, because Ishall be so happy when I am moving about dancing."Well, it was now that he began to make the goslingsdance. Truly happy he made them when he had themnow is the time for me to killdancing. "Well, perhapsthem,"he thought. And so he sang:
104"Nabanakatacimuwin nimbiton, nicimisitug!"Anic mlgu gagatnabanagatacimuwat igi /L1 nika^ag.Anic udci kimiguwan.Ningutingigu mlnawa madcra*minit, cro widac ina a mon :5 "Toskabicimowin nimpiton nicimisitug!"Midacigu antotaminit i i* u nika n sa e ."Ocrkutawin a pii i -u ina a-man, klcpin awiya toskabittamiskuskicingwa," ugl*i-na 8 .Caylgwamadcra/m :"Pasangwa picimowin nimpiton, nicimisitug!"10 Anlc migu gaga t acipasangwabiwat Igi /u ni ka n l sag.Caylgwa mlnawa udanra/ntciwintan y i iunagamun:"Ayantaso ni kiwiyag ayansigwacimoyu k,Nicimisitug,nicimisitug!"Anic mlgu kaga t antotamuwat Igi /u ni kansag, intigui^ kro*yu 4 kupinawag acicimuwat.11Anlc midac i i ma kri nat : "Mrrma n a pi kapasigwiyankayamn tcipabanlmiyan," ugi i na8 . Midac kagatklpasigwit,mlgu aninitamickawat ansigwacimunit acipo kugwabinat.Anlc mlgu pa kic nagamut pimipo kugwabinat.20 Ickwantang win mank aTntacicimu. Kagatsa wawisa-"Aninta?"gickagon awiya. inantam *a i: a /u mank."Tagapina ningatoskab,"inantam. "Untikwanantaguobo kugwabinao <rnaminit," inantam l a s a /u mank. Acitoskabit,kuniginln kaga t na i ta inabit upimipo kugwabinani. O 6 ma n
105"A dance on one leg do I fetch, O mylittle brothers!"So then truly on one leg danced the goslings. Nowhappy were they made by him.Now, another time as he started singing, this was thesong he sang:"A dance with the eyes nearly closed do I fetch, O mylittle brothers!"Now, that was what the goslingsDOdid."Now, when in this manner I begin to sing, if oneopens one s eyes to look, then will one become red in theeye,"he said to them. Now he began singing:"A dance with the eyes closed do I fetch, O mylittle brothers!"So then truly did the goslings close their eyes (as theydanced).Now again he changed his song as he sang:"Asmany geese as there are of you, swarm you with necks together,O my little brothers, O mylittle brothers!"Now, that truly was what the goslings did as :expected,they bunched together when they danced.So it was at this point that he said to them: "Now isthe time for me to rise and move about in the dance,"he said to them. And so truly up he rose, whereupon,as he came to them dancing with their necks together, hebroke their necks. Now he sang at the same time thathe moved among them breaking their necks.By the doorway was yonder Loon dancing. Truly washe hurt when jostled by some one bumping against him."What is the matter?"thought the Loon. "I think I hadbetter open my eyes and hesee," thought."It isseeminglyprobable that he is breaking the necks of these who aredancing," thought the Loon. When he opened his eyesto look, lo, ittruly was in time to see that (Nanabushu)
"Nanabucu"<uuniio6antacicimut !ni /ukawawisagickagut, mmangwana kawinanit.Ajisagitcikwaskwanit."Mimawln tcitaba kupipa rwayamban,"inantam aciplgagit a s a /u mank. Aba pinisiwagan,Nanabucu kidickwanigunan!" i kito a^a mank.115"Nicanim!" omadwa-i gon nasibiba*i-wat. Cigwa pacwawitamon,mri u cigwa anubacwabandank i rma 11 a kunibl-kanig ; migu ba kubipa-i wat, intagagimn pl tcibagwani.lMldac i i ma n kltangickagut uciganang, mldac ka i cicakackicikanawapickagut.Mldac ka u ndcrixinagusit l a e a /u10 mank.Anlc misa cigwa Nanabucu wikiciswat riAciki tcipotawat, mldac anlciningwa a bawatsima 8 . Mldackanicisagisitacimat. "Kagatsa ninki tciwiniba,"15 Mldac H/>uka n simat i;lit:i /u uni l kii n -i kito Nanabucu. "Ambasano, ninganiba,"ki i* kito.utclt ka i tank :tcisagwa O wat," ugi i tan 4 c i /u utclt."Ambasano, a lkawabam piwitag.Misa ka icinibat, misa x ka icitcangitiyanit ; sagra t i i 7unikansima 8 /u. Anlc pimickawat igi anicinabag Nanabucowankitcankitiya kisowan.owiiti. Kago mawin20 uglnii tonatug," kitowag Igi /u anicinabag.11Anlc,cigwala c a /u ka kanawanta i ntla !:a /umiskwasapcigwa gaga t owabama sagawa O nit piwita 8 .!" i kito c a c a /u miskwasap."Piwitag
saidwas busily breaking the necks (of the goslings). Herewhere he was dancing, by one was he hurt when jostled,it was by one that was flopping around. Then out ofdoors leaped (the Loon). "Perhapsthere is justtime forme to flee to the water," he thought. Then with a loudvoice cried the Loon: "Look out! by Nanabushu are wethe Loon.being slain !""Wretch!" he heard (Nanabushu) say to him as he fledfor the water. Now, near was heard the voice (of Nanabushu), whereupon then he tried to reach the place wherethe water met the land; whereupon he reached the waterin his flight,but alas! faraway out was it yet shallow. Andso he was kicked upon the small of the back, whereuponhe got a flat curve in the back by the kick he received.And such was how the Loon came to look that way.So it was now that Nanabushu desired to cook hisgoslings. When he made a great fire, he then bakedhis goslings under (abed of live-coals).And after hehad laid them so that their feet were sticking out, then,"Truly very anxious am I for a long sleep,"said Nanabushu."Well,I am going to sleep,"he said. Accordingly,then to his bottom he said: "Pray,do you watch for anyvisitors that might be coming into view round the point,"he said to his bottom.And so when he went to sleep, he then lay with thebottom projecting upward for he was selfish of his goslings.Now, by canoe were travelling some people (who saw)Nanabushu reclining with the bottom projecting upward."(There is)Nanabushu yonder. Something perhaps hemay have killed,"said the people.Well, presently the bottom that was watching for himnow truly saw some strangers coming into view round thepoint. "Strangers are coming round the point!"said thebottom.
utitanio8Aciwaniskapa tod Nanabucu,anic awaniban kawabamat."Apana ka-a cata ia-muwat," kito l a a t: /u mickwasap.Mldac mlnawa acitcangitiyakisut."Mlmawm cigwa kinibagwan," i kitowag Igi /u anicinabag.5"Mlmawinkinibagwan," i kitowag. mlnawa"Taga, sagawaota."Acisagawa O wat, mlnawa aci-a ca ta a-muwat.Cigwa minawa uganonigon iyutclt : "Plwitag sagawa a -mog." Mlgu i u anigucktisit Nanabucu. Minawa kigitowanini /u utcitin : "Pana kacata a muwat," utigonIni /u10 utcitin."Micanim !"i i >uutclt.Acipa pasagupitot panimagukakackipitot mri -u klponi l tot."Kaga tigu kawm ba pic minawa nintawlntamawasi,"tidinanimigun rr u utclt.15 Minawa acisagawa O wat Igi/l1anicinabag."Mldac i i <uikinibat," kitowag. "A a /u ,taga, awri nabiwata 6 .Kagokuca ugini Mldactonatug." kagat acikabawat, kagaopotawanini kra yani.Mldac acikimodimawat ka kina 4 !: /uiuni ka n 4 simini. Anic kickisitabinawat, anicisagisitowat iima nlt20 kanondcimo^awawat i*i >uni ka n sa 8 .Cigwa kuskusi Nanabucu."E^ nindonsamingwam!Mlmawln usamisuwagwan Igi/u nini ka^simag. Tagatagaskumakuta." Ani i ciwlkubitot i i <umigu acinanikibitot.x"Nausidansini,, mlsa kaga t usamisowat nini kansimag."25 Mlnawa pacig utanuwi kubiton, mlgayabiaci u ndcipitot."Mlsagaga t usamisuwat Igi /u nini kansimag."Mldac
Up leaped Nanabushu from where he lay, but therewas no one for him to see."Straightway back have they turned," said the bottom.And so again he lay with his bottom projecting upward."Perhapsnow he may be asleep,"said the people.he "Perhaps may be asleep," they said. let us"Pray,again go round the point." They then went round thepoint, but again they withdrew.Now, again he was addressed by his bottom :saying"Strangers are coming round the point." Whereupon thenup rose Nanabushu from where he lay. Again spoke hisbottom, saying:"Forthwith out of sight they withdrew,"he was told by his bottom."Wretch!" he said to his bottom. Then vigorously hescratched it;andnot till he had scratched it so hard thatit bled did he then let it alone."Surely,not another time would I warn him,"was thethought entertained of him byhis bottom.Then again round the point into view came the people."He has now gone to sleep," they said. "Now, then, Isay, let us go (and) look. Something surelymust he havekilled." And then, in truth, when they went ashore, sureenough, there was his fire. Thereupon theyrobbed himof all his goslings. So, breaking off the legs (of thegoslings), they put them sticking out of the place fromwhich they took out the goslings.Then up woke Nanabushu. I have"Why,overslept!Perhaps overdone must be those goslings of mine. PerIhaps had better look at them." As one after anotherhe pulled out their little feet, he was pulling them off."Why, it is true that over-long have my goslings cooked."Another he tried in vain to pull out, and that too hepulled off. "It is true that too long have my goslingsbeen cooking."And so, when one after another he had
inantam."I IOka kina aniciwfkubitot, "Kanabatc mawin ningigimotimigog,"inandam. O o dac uditan rr u utclt :"Klgayanimis kicpineka kimotimigowanan," uditan /u i i utclt. Mldac anubabanantwawanga-igat, mlsa7 kawln kanaga pajik umi kawasln.5 "Micanim!" i kito. "Wantcitotawit kiwintamawisi k!" i kito.Kaga t unickri gun i 8i /u utclt. Mlsa 7 acimawandcitot misa n,uticpa kwisitonan Ini /u misan. Aciki tcipotawat, aba picka kitcipotawat acinisawa a ng 4 9 i /u ickuta. Amc, tcagisu.Anicagu, "Tel!" ka i nwawatanig *i 8 i /u utclt; pmicigu kasi-10 tawickat, kasitawitiyat.Amc o O dac uditan 4 8 i /u utclt:8"Ae,ctci n tci n, ,f;ci n ! kainwayan ka kimotimigoyan Igi /unini kansimag,"uditan l s /ui i utclt. Madwatanig.Mlmawlnii <utcagisugwan," ki nandam. Mldac ka i i cii kugabawitcayigwa anawimadca, mlgu u i ajikaskitosig l s /ui i anuwima-15 dcat. Mlgu iu acitongitiya a mit, anic kawln ugackitosml G /u i itcipimusat."Anmta ?"aci-a*yawanan Misa xacipwanawitot anuwlpimusat. O O dac kri nandam; "Amantcigicnantawm i i wisa kibwanawi toyan, tcipimusayan?"Mldac ka-i cinantawabantank ningutci ki tcigickabi kanig,8 720 cigwadac ka*i cicockwatciwat - i ! !!!^11klckabi kanig. Kapangicing,abanabit, panagu kaba a-yagu kanig u i i utdmigitiyan.Mldac ka-i- kitut:"Ei,wa kunag uga i-nawananicinabagtci a nia^kiwang!"Anrrjaniadcat niinawa ; cayigwa anibabimusat ngiwab-25 andanan mi l tigonsan u kwa kitanig. Anic ajinisawitiyantank,abanabit, panagu kamiskwiwa kwatinig Ini /u mi tigonsan.uti, miskwablmagon ogaitanawan anicinabagtci a ni a ki-
he1 1 1taken them all out, then, "PerhapsImayhave beenrobbed," he thought. So this he said to his bottom :"You shall suffer if I have been robbed,"he said to hisbottom. Thereupon he searched about in among the ashes,but not a single one did he find. "Wretch!" he said."For what reason should he thus treat me, that he shouldnot tell me!" he said. Truly was he angered byhis bottom.And so, when he set to gathering firewood, high he stackedthe pile.Then he kindled a greatfire;and by the timehe had the fire going strong,he stood over the fire withlegs spread apart. Well, he was thoroughly burned.Simply was the "Tci!" only sound the bottom made; (heburned) till he was drawn tight, drawn tight at the bottom.So then this he said to his bottom: "Yes, tcP, tcl n tc! n !,is what you say after letting me be robbed of those goslings of mine,"he said to his bottom. He heard it uttera sound. it"Perhaps may now be thoroughly burned,"he thought. And after he had taken his stand awaybut he was(from the fire),he then tried in vain to go ;unable to try to start. And so his legs were stretched farc">apart, but he was not able to walk. "Wonder what maybe the matter with me !"thought. And so he waswithout strength when he tried to walk. So this he thought:"I am curious to know what it is that prevents me frombeing able to walk." And when he had sought for aplace where there was a very steep cliff, then down fromthe cliff he slid. When he alighted, he looked back (and)saw nothing but the sore of his bottom along where hehad slid. And this was what he said: "Oh, lichens shallthe people call it as long as the world lasts!"Then he continued on his way again. Now, while hewas walking about, he saw a dense growth of shrub. Now,as he walked through their midst, he then looked behind,and all the way was the shrub reddened. "Oh, red willows
,"ugri!" inwanit.!"I 1 2!wang Anicinabag sagaswawat uga a- pa kusiganawan,"kri- kito.Mldac ka-a-ni-ijimadcat. Ningutingigu anibabimusatmlnawa ka a nrrjinisawitiyantank mi tigonsan, kawlndacrcini kata-kwa 5 tc miskwlwa kusininiwan. "Wo o wisa uganawa anicinabagtci-a iii a- kiwang, pagwatc miskwabimagogta inawag,"kl12. NANABUSHU EATS THE ARTICHOKES.Midac ka-a-ni-i*cimamadcat. Ningutingigu papimusatawiya uglwabama s . "Anln acini c kasuyag?" ugri na8 .10 "Kuniga kitamugumwatug?""Ayesgo 8 . Midacka igut:"Ayes, kagat nintamugomin.""Amc ani kagayag i^wisa nlbiwa amugoyag?""Kawinsawinigu kago nintini kagaslmin. Mlsa ya tagu15 I 8 /ui ipogisi kagayank."Midac ka-i-ci a-mwat, anic ugri*go fi i*i u amuntwa;ka ta a mwat ugrponi*a tfi ."Kagatsapamaklwmgipugusim,"ugri na 8 . Mldac a pra nimamadcat. Ningutingigu anipapimusatpamagu tatanaming, Acimadci-20 pa tot, "Awanan ka i nwat?" krrnandam. Wasa pagami-nG"Poinwawanpa tot. Magwagu mlnawa anipapimusat, "Po 8awiya, acra/pamipagisut,"Awanan ka i nwat?" kri nantam.Magwagu mlnawa anipapimusat, panimagu wantci-
"shall the peoplecall them till the end of the world ! Thepeople, when they smoke, shall use them for a mixture(in their tobacco),"he said.And so upon his way he then started. And by andby, as he went travelling along, he again went wadingthrough some bushes, but not quite so much were theyreddened."This, indeed, shall the peoplecall them tillthe end of the world, wild red willows shall- - they becalled,"he said.12. NANABUSHU EATS THE ARTICHOKES. :So then upon his way he slowly went along. Andonce while travelling o along o he saw some creatures. Whatare you called?" he said to them. "Wonder if you maybe eaten for food !""Yes,"he was told. Now,this was what he was told:"Yes, trulyyouwe are eaten for food.""What isyour effect upon one after a great"Nohas been eaten?"deal of(evil) effect of any sort do we leave. The onlything we do is to make one windyin the stomach."Thereupon he ate them, for he was told that they weregood to eat not till he had had his fill of them did he;leave them alone. a"Truly pleasing taste you have,"hesaid to them. And so then he kept straight on his courseof travel. Now, once as he was travelling along,of asudden at the rear,"Po!" came a sound. As he startedrunning,"Who was it made that noise?" he thought.Afar was he now getting while on the run. And whileagain he was "Po!"walking along, was the sound something uttered; when round he whirled, "Who was it madethat sound?" he thought. And while again he was walking1For another version see No. 23.8 PUBL. AMER. ETHN. SOC. VOL. VII.
!"Acipasiguntcisat.inandam!" Ki!"!"!"pogitit acimadclpa tot. "Ambasano, ningagagwanagana^a11ka/rnwat," krrnantam. Kwatciku ku aninanawatcisatpamagu mlnawa, "Po n{ M" anwanit. Misa sagisit."Ambasano, ninga-a/ kamawa aV 115 kandwadankI8 /u i i umi kana;ka-rnwat," krrnandam. Aci a -mlsagu klci-a caglwa, midacinia" wansabandank I 8 /ui i umi kana. Panimagu mlnawanpi kwanang uwlya nwantawat. Mlsa 7 untcita anwanit,uPo nC"Taba pinisiwagan, awanac wa r a /upamfnica O !gwan Ka/tcimanitowigwan," ki-rnantam aci-10 madclpa tot ki s 4tcra nigu k. Magwagu anipimipa tot, pamagunC"Pomlnawa,tciwasa pangicin, apamipagisut anlc,kawin owabamasln anu a-swaganat. Panimagu mlnawaWwiti upi kwanang wantcinontagusinit, n"Po "Taba-11!"pinisiwagan acimadcipatot.Mlgiri ma maclcl-15"Popa tot, mlnawa, n8"Taba/pinisiwaganinandamanigirk ajimadclpa tot ; kagupri gu pacu x aba to, pimipatotanigu k. Mlsa x undcita ani tank utackwayaming, "Po nl: !"Kagu pigu antasupangicink, "PonC ,po n8 , po n8 , po nS , po nf: !"-"Midacifii /u ml taglni/uka i ciwat niclmayagsa klbiwaba-20 magwa Igi /n ackipwag. 1 Nimpogisi kakamin, ningrrgog.Takln, ei, nimpogit! mlsa / ka/r kitowat anicinabag nicijayag,tcini a klwank."Magwagu anipapimusat, panimagu mlnawa,-"Ei,nimpogit!"1Ackipwag, "artichokes:" literally, "raw objects."
"hehealong, suddenly from the place where he broke wind hestarted running. "Well, now, I will try to leave behindthe one that ismaking the sound," he thought. Just ashe was about to slacken his speed, then suddenly again,"Po!" was the sound something made. Thereupon hebecame afraid. "Well, now,I will watch for the one thatuttered the sound," he thought. Then he lay in wait forit beside the path ;and then a short ways back he went,and so from there bythe road he watched for it.Suddenlyagain at his back some creature he heard. And as before,it uttered the same "Po!" Then up he leaped to his feet.For goodness sake ! wonder who it is that may be following me ! It must be a great manitou being,"he thoughtas he started running at the very top of his speed. Andwhile he was running along, suddenly again,"Po!" Agreat distance off he landed, when round he whirled ;why,he did not see the one at whom he tried in vain to aima blow. And later again, from yonder at his back, washeard the sound of some one saying,"Po!" "Forgoodness sake !"thought as he started running. And therewhere he started running, again, "Po!" "For goodnesssake !"thought as with speed he started running. Thenat last a short way he ran ;as he went, he ran with speed.But what he heard behind him was still the same sound,"Po!" Then finally at every step he took it was, "Po,po, po, po, po!""Why,this was just what my littlebrothers told me when I saw the artichokes. 1 We makepeople windy in the stomach,I was told. Oh, why, Iam breaking wind ! That is what the people, my uncles,shall tillsay the end of the world." And while he wentwalking along, then of a sudden -again, "Po!"am breaking wind !""Why,I
inandam.n613. NANABUSHU AND THE CRANBERRIES.Aye 8 , anipapimusat acimadabit sibi a panaguinabit anlbiminan ka/a-yitcitagiskotanig.t "Kaga pama tamltciyanningaponi tonan," inantam. Mldac igu clgwa acru cigabawitank; inabit rrwiti nibi kang, panagu anlbiminan. "Taga,5 ml iwiti ni tam ningamltcinan,"krrnandam. Acigagltcikunayau t aciba kubikwackwanit anupapanantublkantcigat.Wagunac kamrkwandank? A kwanapawat, acimockamut ;inabit, ml gayubi ka i*nagotanikini /u anlbiminan. "Amantcigic4 8 /u i klmrkwandanziwan ?" Mlnawa ajipa-10 kublkwackwanit, aciklcklngwacink mldac aci*a-gwaslt;acimawit. Anlc wlsagicin, pana mlgu miskwi usklcigunk.Agwasltidac ajiki tcimawit , magwagu mawit, kago unanacabickagun.Acipa katawabit inabit, panagu anlbiminan.Utanimamatantanan. Ka tamitcit aciponi tot.14. NANABUSHU AND THE CARIBOU.Mianicmamadcat. Ningutingigu anipapimusat, tcimicawaskusiwaganiwaditank. Ajrrnabit witi lwaya kwackusi/ui itci a yaba ati kwan klpimatabickusiwawan. Kagatsa umi-
"13. NANABUSHU AND THE CRANBERRIES. 1Yea, as he went walking along, he came out upon ariver, where, while looking about, he saw nothing but highbushcranberries that hung with drooping head. "Truly,not till after I have eaten enough will I leave them alone,"he thought. So thereupon he then went and stood intheir midst;as he looked down in the water, nothing(could be seen) but high-bush cranberries. Now, thoseyonder first will I eat,"he thought. When he was undressed, he then leaped into the stream where beneaththe water he sought for things to eat. But what wasthere for him to bite upon He was ? getting out of breathin the water when he then came up to the surface;ashe looked, there still hung the high-bush cranberries.C5O"Wonder how I did not bite upon any!"he thought.When again into the water he leaped, he cut his face bylanding (on a rock) and so when he came out of thewater, he was weeping. Naturally, he was hurt in the fall;and, to crown all, his eyes were filled with blood. Andas he came out of the water, he was crying bitterly ;andwhile he cried, he felt the rub of somethingacross theface. On openinghis eyes to see, he glanced about,and there were the high-bush cranberries without measure.Thither he went, and ate of them without stint. Afterhe had eaten enough, then he quit.14. NANABUSHU AND THE CARIBOU. 2Thereupon he continued steadily on his way. Now,once while he was walking along, to a wide field of highgrass he came. As he looked toward the other end ofiFor another version see No. 21.2 For another version see No. 19.
krrn8sawinawan. "Amantcigic ka/rna ?"pinanawagipanan Aciwabamigut,inandam a u adi l k.l"Intacltug kapasamit,""Tagantawa ninga a cima," animadclba to a 5: a /u adi k.Cigwa kaga t ut:umadwakanonigon Ai, niclmisa ,amantcwin5 4 8 /u i kltotaman ningutci wayapaminanin? A kawa, klwitibatcimotawin !Kaga t ki tci nakamigat o o witi wantusayan,""Awawa, undas, plcan Kawln i udinan. ! kitananlsananimisl."Midac kaga t ka plji i canit i i ma n ayat.10"Tiwa/, kaga tigu tci i na kamigat pitcmagu, kmisitiwag ;ki tciwawlyag kru ndcinanitiwag ; kipickwa Anic mlgu ma i 11apitcitanatcimu tawattaginu tatiwag."aci i^kwa^tackawatini /u umi tigwabin."O O wisagu totamobamg."A cinanimakwlnotawat rrma 11 waca plnit.1"Mlsa wu c o" antota-15 mowa pan,"udinan. Acipimwat iiman waca/plnit."Micanim Nanabucu !Kagat anaglnanimagiban."Anic misa x ka icinisat, acimatci kawat. Papanaginangai kamowan; acipapimagotot !ni u uwininoman; acigapacimatka kina. Ka/rciklziswat, ugltackwamag ugl a gwawan.20 Midac ka/r kitut a pika u nabrtawat :"Tibigickauntamawagan?" kitd. "Intawasauctigwaning ninga U ntama.Kamawln nintaminu tcigasl, nintapa pri gog nlnimuca n yag 3ugra cawabaman," grrnandam."Nindaba pi igog nlnimo-1At the Caribou s side.~Ninimuca"yag.l "my loves;" literally, "my cousins;"more literally still, "myrelatives" (that are the children of the sister of my mother).
""119the meadow, (he saw) a big bullCaribou come walking outupon the stretch of grass, and so he (Nanabushu) wantedto cret him. "Wonder how can I get hold of him!"ooWhen (Nanabushu) was seen, "Without fail he will havesomething to say to me," thought"1the Caribou.thinkI will draw him on." Off running started the Caribou.Then truly the voice of Nanabushu was heard saying tohim: "Hey, my little brother, would that I knew why youact so whenever I see you anywhere! Wait,I wish to tell!you something Truly, a great time isgoing on overthere from whence I have come," he said to him."Ay,hither, come here ! You have no cause to fear me."It was true that he went to where (Nanabushu) was."Ah, but there truly was a great time going on yesterday,they were killing one another for no reason were; theyslaying one another ; they shot one another indiscriminatelywith arrows." Now, while he was tellinghim the story,he was stringing his bow. "This was the very way theydid at the time." All the while he kept aiming there athis l side. "This was just the way they did," he said tohim. Then he shot him in the side.Confound Nanabushu !Truly, that was the very thingIthought he would do."So after he had killed (the Caribou), he then set to workflaying (and) cutting him up. Exceedingly fat was (theCaribou) ;then he went (and) hung up his fat;then heboiled it all. After he had finished cooking it,then outupon a sheet of birch-bark he dipped the meat. And thiswas what he said when he came to where it :lay Wonderfrom what part of the body I shall take (what I am to eat)!"he said. "I think that from the head I will take what Iam to eat of him. -Perhaps it would not be proper forme to do that, for I should be made fun of by my loves 3on account of my having begun at the opposite end,"
"Intigumi<:120ca n yag,"klnandam. "Amantcisawln rrwiti upi kwanangundamak? Kawlnsa, kanabatc nindaba prrgog. Kanabatcuglkantcwabaman ki tciayaba a di kwan, ninda/rgog mawinnlnimuca n yag. Amantcisawln pimi tcayaTundamak?" krr-5 nandam. "Kawlnsa, kanabatc nindapa pr i-gok. Ugipimitcwabamanninda igok ki tci-a-yaba a di kwan, nmimoca n yagninda i gog."Magwagu tanwawa tod mlslwa tciga tig ugibabaa- tonumama i biman. Midac a pl ajinondagwatinig kisiba kwat,10 "Kaga/tsa ningi tcisasiskimigun. Kanabatcsa kaya win15 yawlwlsini."Kapa kwacwat -ma n i i uwlninowinit, acra kwan-ltawiit. Midac iwiti awiposinang ;lkayagu wlninon ugisindakwiciman. Aciki tcipltanimadinik, acita kwamigutikislba kwat. A1-ragosi.ci /u,mlsa ima 11 a intanagosit ! Pinicigu kabci-Ningutingigu inabit iwiti wayakwakusi /u ma*rngana 8 untatabipartiwa 51 ,midac acikanonat :"Kaguwin oma n picakagun!"Kago mawin ugini tonatug Nanabucu. A a 11 ,taga20 a pa tita i !" .kibigagwatcikanitiwa Cayigwapagamisawakama kandinit.v:,aciwabamanit ini /u udadi kuman. A paniiguAe Xi , anlc kagldotank, misa panaudadi kuman. Acikanonat: "Niclmisa, kagi/ win tcatclga tig pa-i nabi kagun!"Awiposinang: the real sense is that "he went (and) greased" (the place).1The expressionis a Bois Fort idiom.
"I(thus) he thought. should be laughed at by my loves,"(thus) he thought. "Wonder if it would be well for meto eat of him at the back !- -No, indeed, for probably Ishould then be laughed at. - - Perhaps he shoved the bigbullCaribou forward while eating upon him, would be saidof me perhaps by my loves. - Wonder - if it would be wellfor me to eat of him at the side!"(thus) he thought."Noindeed, for perhaps I should be laughed at. - - Hetried to push a great bull caribou sidewise when eatingupon him, would be said of me by myloves."And while engaged in this talk, he laid round aboutthe foot of a tree all the grease (which he had boileddown). And so when the creaking of trees rubbing (together) was heard, "Truly by some one am I soughtbeseechingly. Perhaps, indeed, some one too wants to eat."After slicing off a piece from a fatty part (of the caribou),then up the tree he climbed. And so there he went andplaced the fat land he;put the fat in where it wascreaking. When a great gust of wind came up, he wasthen caught fast by the creaking tree. Ah, and so therehe !hung Even till a long while after was he hanging.Then suddenly, while looking toward the other end of>J othe meadowy (he saw) some wolves running hitherwardinto the meadow, whereupon he addressed them, saying:"Don tyou come this way!"doubtless must Nanabushu have slain. Come"Somethingon, do let us run over there!" It seemed as ifthey triedto race (to where he was). Now, when they came runningup to the place, they saw his caribou. Straightway didthey fall upon it, grabbingAlas !naturallyit from one another.was there nothing for him to do, forentirely gone was his caribou. Then he addressed them,saying: my "O little brothers! don t you come and lookround about this tree !"
"A"KitawananaMldacAnicL>] 22a 11 !",kago ogla tonatug kagat kama kandinitiguumama rbiman. xCigwa wanimadclba rtIwa, "Kaguwin, nicimisatug, icpiming inabi !"kagun acida taganapiwat!gi /u ma Pnganag, panagu winin ka*i - nagotanig.5 Anic kaya kama^kandinit i i u ma rngana. Ka^kitanawanitanimadcibai tinit; acipagitamigut. Nap^m upagitamiguni i* u kislba kwat.Acinisantawat. Misa anugwinawri crkank, anic mra- tautoctigwanim a tanig. Anic utanutclctclgwantan rr u utoc-10 tigwanim. Anic mlya/ta wlnintip ayanig. Anic ukwlnawrina pinaton. "Taga intawa, ningakinabi konsi^kas,"kri nantam. Mldac kagat ka i-cinagusit,mi i-wati wlnintipwantci tot. Magwagu tacl kank aci a nicinabawit, mlsa 7madcat. Mldac aci irtackanimagatinig, a 1 ,anic gaglcictcigat!15 Acipita kwicink, "Kitawanana tigo, niclmisar""Aye5:,ninisa ku pagwata kamik kananibaxviyan."ttOn , niclmisa, kiminaikowimlzan."Aye e ,"ugi-i-gon.Minawa acipita kwicink,tigo, niclmisa ?20 "Nlnisa ku wadciwink kananlbawiyan."Un, kicingwa kowimizan."Minawa acipita^kwicing, "Kitawanana^igo?"
(he"WhatSo""Come on, something he probably has laid out (there)!"Whereupon truly they grabbed away from one anotherthe grease (which he had boiled down). Presently werethey about to race away when, "Don t now, O mylittlewhen up the Wolvesbrothers, don tyou look !"uplooked, nothing but fat (did they see) hanging there. Soof course the Wolves also grabbed that away from oneanother. After they had eaten itup, then away theywent racing ;then was he let loose from the grip.Whenit was all over, he was set free by the creaking tree.Then down he climbed from the tree. Thereupon hewent in vain to see what he yet had left, for there remainedonly his (caribou) head. So he tried in vain to gnawupon what was left (of the meat of) his (caribou) head.Now only the brain was left.he had no meansof getting at it. "Then, therefore,NaturallyI will take on the formof a little snake,"he thought. Thereupon truly that wasthe form he took upon himself, the reason he did it wason account of the brain there (in the skull).And whilebusied with the brain he became a human being, whereupon off he started. And so when there were horns(upon his head), ah, what was he then to do ! When hebumped against a tree,sort of a tree are you,my little brother?" (he asked.)in the"Ay,deep solutide of the forest ever do Istand.""Then really, my little brother, youmust be a tamarack."he was"Yes,"told.When he bumped against another tree, What kind ofa tree are you, mylittle brother?" he asked."Always uponthe mountain do I stand.""Then, indeed, you must (then) be a pine."When liebumped against another tree, "What kind ofa tree are you?"asked.)
",""Ka*i"E124"Nlnisa ku kawawasana kikabawiyan ningutci sagaigankwa kin."tayabinauNicimisa, kiwlgwasiwimizan."Anlcimadcat. Minawaacipita c kwicink, "Kitawanana tigu, nicimisa?"5Nmisa ku ningutci sagaigan ayagin nomaga no pimingkananibwiyan."n"O, nicimisa, kitasatlwimizan."KAye 8 ."Minawa anicirnaclcat. Minawa ajipita kwicink, "Kitawa-10 nana tigu,nicimisa?""Nmisa ku saga iganing a kugicka kamigag kananlbawiyan."n"O, nicimisa, kiglciklvvimizan.""Ayeuudigon.15 Anicimadcat, pitcinagigu ani irda a mlt acipa kubita kukit.Anlc mlgu acipana^klnank acimadclyatagat.l j ^pimatagat,ningutingigu awiya unontawa : e e, adi kpamadagat!"kitowaA- a 11 ,mawinata ir k !"5i.Amc,Anlc misa gaga t mawinata irnt. Anlc kawln nantagani-20 must pirnatagat. Ackam pacwawitamo, kawln nantaganimusl."A e e 7 ,kimicaganigunan!""Mlnangwana cigwa anawi pacwabatamowanan," inantam.Anlc kawln nantaganimusl pirnatagat. Ackam pigigitowa8,"Tabapinisiwagan, misa rnicaganinank!"tl kitunint.25 Acitaba klnank, waylbagu taba kinank. Anlc mlnangwanacockwanabi kanigi i-ma n ka iji a gwasiba tod. Magwagu
25"Continually do I stand with glistening topfor one thatcomes in sight of a lake anywhere."little"My brother, you then must be a birch." Thenon hisway he went. When he bumped against anothertree, "What kind of a tree are you, mylittle brother?"(he asked.)"Wherever there is a lake, then a short way back inthe forest is where Ialways stand.""Really, my little brother, you then must be a poplar.""Yes."Then on hisway he continued. When he bumpedagainst another tree, "What kind of a tree are you, mylittle brother?"(he asked.)"Always bythe bank of a lake do I stand.""Oh, my little brother, then youmust be a cedar.""Yes,"he was told.Then on his way he started, and the instant he madeanother step he walked into the water. Well, he thenout into thebegan wading water, then he began swimming.While swimming along he suddenly heard the sound of:somebody (saying) "Halloo, there goes a caribou swimmingalong!" they said. Then, "Come on, go after it!" Sothereupon they truly started after it.Now, with all hispower he swam. As nearer he heard the sound of them,then with all his speed did he go. "Halloo,we shall bebeaten to the shore !""It ispossible that I surely must be getting close (tothe shore),"he thought. Yet with all his might he swam.Nearer came the sound of their voices, near by he heardthem saying:"Too bad, he islanding ahead of us!"(Such) was what they said. Then he came to where hecould touch bottom, soon was he where he could touchbottom. Now, it happened to be a slipperybank where
"A126anibabimipa tod acrujajabi kicink aciblkusitod l c /ui iutdctigwanim.Inabiwat igi/uNanabucowan anrirndciklgitowan:anicinabag,"Kaga tigu adi k pamatagat, kagatigu ati kpamatagat," ani i^kitowan Nanabucowan, anigagawa piwan.5 Kawln kanaga piyapimigabawdslwan, pana mlsa anipapimusat.15. NANABUSHU FLIES WITH THE GEESE. lNingutingigu anipapimusat saga i gan acimatablt, a l panagunrkafitnanomini kawa l s .Kagatsa umisawinawa8 anlc,acikanonat :"Ambasano, 2 klgawitclwininim," udina 8 .10 "Awawa, Nanabucu," udigo c ."Miguls /ui ia kawii ucitoyangwanawa poyang."Anlc acipa kublt kaya win Nanabucu. Mlsa kayii winantotaminit anutotank, mlsa 7 kawln umilmanomin.kobiga a >nsln iT 1115 "Amn, Nanabucu? Intigo kucagu kibwr anawiton i i <umanomin."8nimbwanawiton.""Aye,a 11 ,intawa mri u mini k.Papanglns i citiwa 8 H 7 11i /umanomin,"ni ka 1 .Ningutingigu cigwa utigo E : "Mlsa wa-20 bank wlmadcayang," utigo84 8 /u i ni ka . Mldacka i nat :"Aniga ka kitakackl i slm kaya nin tcipimisayambanr""Nanabucu,kitapisinda n zl4anawi kitakackri go tcipimisayan, kawlnidac8 /u i ika-i goyambam."1For another version see No. 56.
"pray12;he ran up out of the water. And while he was runningalong, he slipped and fell upon a rock, bursting open his(caribou) head. As the people looked, (they saw) Nanabtishu,who said as he went running from there: "Trulyit was a caribou itswimming along, truly was a caribouswimming along,"said Nanabushu as he went, as he fellheadlong laughing. Not did he stop in his career to lookback at them, ever straight ahead he continued his way.15. NANABUSHU FLIES WITH THE GEESE. lNow, once while walking along, out upona lake hecame, and everywhere were Geese feeding on rice.Trulymuch he envied them, so he then addressed them, saying:"Ipray you, 2 let me inamong he said to them.you,""Very well, Nanabushu," he was told. "But we firstare laying in store the food that we shall eat on the way."So into the water went Nanabushu too. And whatthey did he tried to do too, but he found no rice in thewater."What, Nanabushu? Seemingly, indeed, are you withoutsuccess in finding rice."Ay,I am not successful.""There, now, that isenough. Each (of us) now has asmall bit of rice,"to one another said the Geese. Andpresently then was he told : "Therefore on the morrow shallwe expect to start,"he was told by the Geese. And thishe then said to them: "I want to know ifyou could fixme up so that I too might fly.""Nanabushu, it is quite within our power to fix you upso that you can fly, but you would not listen to whatwould be told you."2"IAmbasano, This adverb is rendered in variousyou." ways throughoutthe texts, sometimes with a finite verb, as here; its general sense is that of anentreaty.
"madwa"A128"O n , manii, niclmisa, icrrciyu k tcipimisayan!"Mldac kagactla u ugrrgon:Ayangwamisindac win.O crma n abi tawaiyaT anicinabag pa taTnuwag. A p!ima nanitagwicinank, kagu inabi kan, kigasa kwanigunanig. Aya-5 ngwamisin, kagu x inabi kan mlgu s u itcibangicinan klcpininabiyan. Mlya tagu ma i*i n acicagwanimigoyan," l udigd?;.Mldac antacinit ka kina papajik umigwanini ka icimmigut."Tagackuma,kutcipasigvva u n."Mldac710 "Mlsakagalt ka icipasigwa u t, ka i cikiwi tagamasat.i u tciwltciwigoyan. Misa x wabank tcimadcayang."Cigwa wabanini, cigwa pasigwa O wa8 a; pidci nawaya ricino a mawa.aMrirma n tcipimisay an .Xawatciguunaguciktciwabamangwa Igi /u anicinabag." Cigwa gagii t15:okanonigon i i ma n "Mlcigwa ayawat Igi /uanicinabag." Caylgwa gaga t rnadwasa :kwanigtiwa^ c e 7 ,ni lkag ! Nanabucu uwldcisama !" i na. Kaga plmadwa/ilkitowan : "Kanawabami k, nackakuca pagicin!"inabi"Kagu kan, Nanabucu," udigo l s /ui i ni ka s l.Kaga pl madwa nagamowan:20 "Nanabucu uwitcisama uciraisa 8 ,ucimisa 8 .Tapangicin.Nanabucu uwitcisama uclmisa 8 ,ucimisa 8 .Tapangicin.Nanabucu uwitcisama ucimisa 8 ,ucimisa 8 .Tapangicin.""Taga pina 7 , ninga i nab,"inantam. Acrrnabit,"ata,1Acicagwanimigoyan, "\ve fear you might do,"-a very free rendering, but yet
wasI 29"Doplease, my little brothers, fix me upso that Imay fly!"Whereupon truly he was told: "Take care that youdo it ! Off here about halfway are many people. Whenwe are coming there, don tyou look down, for we shallbe whooped at. Do you be careful, don tyou look clown ,for you will surely fall if youonly thing we fear you might do," :look down. That is thehe was told.Accordingly by every one that was there was he given a feather."Therefore, now, just you try to fly up."Thereupon truly up he rose on the wing,then roundover the lake he flew. "Therefore now you may go withus. Now, to-morrow is when we shall start."Now was the morrow come, now was when they flewawayin the; very centre was he given a place where to"It isfly.here you are to fly. Along towards eveningshall we see the people."Sure enough, was he addressedby one saying: "There, now, are we cominginto view ofthe place where the people are." Already could theytruly hear (the people) whooping at them: "Halloo, Geese!Nanabushu is flying along with them !" the sound ofthem speaking of him. At last he heard them saying:"Why, look, he is really falling!""Don tyou look, Nanabushu," he was told by the Geese.Finally he heard them sing:"Nanabushu flies in company with his little brothers, with his little brothers.May he fall.Nanabushu flies in company with his little brothers, with his little brothers.May he fall.Nanabushu flies in company with his little brothers, with his little brothers.May he fall.""Isay, really, I will take a look,"he thought. Whenconveying the sense better than the literal one, which is, "in which you are regardedunwillingly."9 PUBL. AMER. ETHN. SOC. VOL. VII.
udigon.more-ki tcodana! Anln ka rni tank kpanagu kaco kanik u tawagan.Anuta taganabit, aca wasa uwitclwagana8. A pitcina/o tanaicipangicin.Mldac ka-rcimamandcigwa pinint."Ambasano, midcinata!"5 i kitowag. Mlsa kaga t ka/rcimldcinint, ga^kinamini k imawa^ta^tonit umltcinicro. O AbaJT pic tciofwa o nakackitcinio-utC>clpitonanit. Awlya onontawa: "Anti kamltcinint?" i kitowa 8 .Kuniginln, mindimoyaya 8 , niciwa gaglplngwawa 8 . "Antikamltcinint?"prr:10 udina 8 .Cigwakitunit. Acikanonat"Oma n nintaya,"udotisigu. 1 Caylgwa uwlmltcinigonIni/umindimoyayan, acikanonat : utinan"Ic," ; "Kagicwln, gucamlguA l s /ui iwa-rcimltciciyan kawa ? nlni kti nintapa-yguwamltciniguwanin.""O n ,""Kaga kiwanitotawanan l a fi a /u kamitcinint."kamamoi5 Misa x kaga t aci a-biskwamigut kanawabamat;wabitanit igu u imindimoyaya 8 . Ka klcl kagut acinanlwanuwat.2 Anrrcimadcat oma 11 .Anipapimusat saga i gan uniatabln,mlgu u i acipa kublt acikislblglt. Kanawabandank4 9 /u nibi imlgu u i acipimangutanik I 8 /ui i mo xi . Ka a gwaslt20 mldac a l kitut :"Ka i cini katamowat anicinabag nicica n yag-e,wlniplg! 3 ta i cini kata i u saga-rgan."Udotisigu, where he was "to they came5" literally,"he was come to."12 Acinannvanuwat, "he clubbed them to death, first one, then the other." "Firstone, then the is the sense of theother,"reduplication nanl-.3water!"Wlniplg!the"filthyname of various lakes in the Ojibwa country;Lake Winnipegis one of them.
theythey"he looked, oh, what a great town ! Thenwhat was heto hear but a continuous whizzing- in his ears. In vainhe tried keeping his look upwards, but already afar (hadgone) his companions. In the very centre of the townwas where he fell.rThereupon was he then thoroughly bound with cords."Come on, let us ease ourselves upon him!" they said.Whereupon truly was he then eased upon, by every onethere in the town was he eased upon. In course of timehe became engulfed so deep in the dung that he had topurse his lips. Somebody he heard :(asking) Where ishe who was eased ?"upon were saying. Lo, (therewere) some old women, two that were blind.that was eased ?"upon said as they came. Then hespoke to them, "Here Isaying: am,"he said to them.Then to where he was they came. 1 Already was hedesired by an old woman to ease herself upon when he"Where is headdressed her:"Wait,"he said to her; "really, now, isthis the position you mean to relieve yourself upon me?Usually I am first unbound before I am relieved upon.""Really,"he was told.to him who has been eased upon.""Nearlydid we do a mistakeAnd so truly, while being unbound, was he watchingthem; (he saw that) the old women had dungin theirteeth. When he was set free, then he clubbed them todeath, first one, then the other. 2 Then on hisway hecontinued from this place. As he went walking along,out upon a lake he came, whereupon into the water hewent (and) washed himself. While looking at the water,he then saw the dung floating thereon. When he cameout of the water, this then he said: "The name which thepeople my uncles shall call it - -shall be the name of the lake."lah, filthywater !3such
I3 216. NANABUSHU AND THE BUZZARD.Midac acimadcat, kipabamusat. Ningutingigu pabamusatinabit icpiming awiya ugiwabaman namadabinit ana kwatunk.Kaga t umisawlnawan. "Ambadac 1 kaya krrnandamnin,"ka i cakanonat : "Kawlnina kitablcasi, niclmisa?" ugTrnan.5 Midac ka igut:"Kawln,"ugri gon.lri /u"Anin kagrrcinagwa k 2 mini k awiya pawabamag klnidactcipisindawislwambanan?""Nanabucu,klgusin.""Kawlnkitagwacisi,"udinan. Midac ka/rciwayacimat,10 anic mlsa 7 kap anoniorut :. o o "Ambasano, kao-a o tsa kimisawinawin.Kunigana wasa klta kwabimituo-," udinan."AyeeatA u ,"udinan.uAmbasano, kigawltclwin.", kagat."Medac krri ci i-nat :15 "Awawa," ugl i gon. Midac ka*rcru mb!wat i i ma anakwatunk.Midac acimadcawat, madciyasiniki i >u ana kwat.Ninguting agawa tabinagwatini I 8 /ui i a ki tcigwa udinanimigon.lndacltug wawiyac nandagini tatotawat.uAmbasano, wawiyac ningatotawa,"kri-riandam. Midac ka/rcil20epa kwayasininik /u i i ana kwat. Mlnawa acipa kwayasininik ;iickamigu agasani ina ayawat. Kaga pi kagagu anigukwabiwatInigu kwani. Ningutingigu ka i citacki kanikpapa^kankinamadapiwag. Anic mlnawa acitackasininik1Ambadac, "would that;"the last is the best of the three forms.-it is less frequently used than ambagic and a c pagic;Kagri-cinagwa k, "would itthat is the literallook;" meaning; but the senseis,"can it be possible."
1331 6. NANABUSHU AND THE BUZZARD.And so he started away, round about he travelled.Now, once while journeying about, he looked above (and)saw some one seated upon a cloud. Truly envious washe of him. "Would that I(could)1hetoo," thought, afterwhich he addressed him, saying: "Would younot comedown, my little brother?" he said to him. Upon whichhe was then told: "No,"he was told."How would it look, 3 (in view of) as manyseen, for younot to heed me?"as I have"Nanabushu, I am afraid of you.""You have no cause to fear me,"he said to him. Andso after (Nanabushu) had deceived him, then was he broughtinto conversation with him."Oh,Ireally,am so enviousof ! Iyou fancy that afar must you be able to see,"hesaid to him."Yes, (that is)true.""Good,"he said to him. Uponwhich he then said tohim: "Pray,let me bear you company.""Certainly,"he was told. Whereupon up they wentto yonder cloud. And so when they started away, withthe wind went wafting the cloud.By and by hardly was theearth to be seen. Then thoughts concerning him did theother entertain. "Apparentlyhe is ever playing a trickon some one. Now, I will play a trick on him," (thus)he thought. Thereupon apart then broke the cloud byreason of the wind. Again it broke apart on account ofthe wind; gradually smaller grew the space where theywere. At last almost space enough for them to sit onwas how much that yet remained. And anon when itwas rent asunder, then in different places theywhen againit blew apart, then away flew the other, alight-sat. So
"ka1134acipasigwa irnit, aciponinit ri wati animi tcanik l rr u anakwat.Midac utanukanonan : "Anmkatiyan, nicimisa?"ugrrnan. Mlcigwa klwabandank tclpangicink. Cigwamlnawa pa kwayasinini mi i-ma ayat; kaga pri gu piguckani.5 Agawa udababandan ucawacka kamiganig. Acipangicinka panaTban pabimipisut. Cigwa ajidababandank atataki tcimi tikukani ka icipangicink. Cayigwa ka i ciplndcisatkitcimi tigon wimbisinit. Mlsa / ka icipmdcini kisat, misa xacibwabwanawi u t. Anuwfkwatcrirt awlya uglnontawa,jo pipapiniti kwawa1,midac ka i- kitunit : "Mlsa76*o ma n ningutciandat ka r kitung wabigak,"ilkitowa c li i >u i kwawa5:.Acikigitut:Wabigagowiyan andayan."(O o dac i kitowa c :"Kunugana mi l kawangnicim," ugri nan mra* u matciki kwawis.ca !j a /u wabigag,15"Kanagin kinontawasl?" udigon Ini /u uclmayan."Kimilkawanan, mawln."11Midac mrrma mlnawa ka i cikanonat :"Wabigagowiyanandayan," ugri nan. Midac ka i cimadclkawa u gut.20 l kawagwan,mra<uMisa x cigwa kaga t udanuklckika irgun.krr-11i i"Wrkagasama tayawi l a c a /u wacima inandam a u Nanabuco.mawit,""Nicim, kl kawawank, awagwanina kaayanigwan kami-irnabamit," ugri nan lni /u uclmayan.1Animitcanik, "where there was a bigger;initial stem ani-.the comparativeelement is in the
35ing upon yonder place where there was a bigger l cloud.Whereupon in vain he tried to speak to :him, saying"What will become of me, mylittle brother?" he said tohim. So then he knew that he was going to fall. Thenagain apart flew the place where he was and in the end;it broke completely. Faintly could he see the green ofthe landscape. When he fell, a long while was he fallingthrough the air. Now, when he came in full sight (ofthe earth, he saw) how so dreadfully wooded was theinto which he was to fall. Then down he fell intowhen he hadplacea great tree that was hollow. Thereupon,dropped into the hollow, then was he unable (to get out).While vainly trying (to get out,) he heard some one, thosewere women 2 coming laughing and this was what; theywere saying: "Now, somewhere hereabouts lives a GrayPorcupine, so they said the women.say,"Then up he spoke, saying:"Iamthe Gray Porcupinethat dwells here."And this they said: "Suppose we should find the GrayPorcupine, my little sister,"to the other said she thatwas older. 3"And did you not hear him?" she was asked by herlittle sister. "We have found him, maybe."And so what he said before, he said to them again:"I am the Gray Porcupine that dwells he said to(here),"them. Whereupon they began felling the tree he was in.little sister, when we have felled the tree, then who"Mysoever is there, (and) whichever the one that finds him, shewill be the one to have him for a husband," she said to herlittle sister. And so they truly chopped away unavailingly."I wishNanabushu.the younger one would be there," thought2The Foolish Maiden and her younger sister,sisters of Nanabushu.3The confusion of the subject of a question, as here, is common.
fcanlc13 6Cigwasa utackika irgon rr u nantuga/irgut, plnic matcikikwawis ka kina ka plguga a nk mi sa; ka/rcigwlnawabamat.Misa a 11 li kwa waclmamawit iima n ayat kaga pika icipo^kwisitot ri -u uwaga kwat.5udinan a l "Nicim," pl kapo kwisitonit l s /ui iuwaga kwatoni"Misa mn tci irnabamiyan," ugrrnan Ini/u uclmayan."Wa win."kagasa kaya O O dac kri nandam : "Ambasano,mlyatagu abiding tcibiyapagitot l s /ui iuwaga kwat,"udinaniman. Aci a-cowinat; cigwa gaga t udackika irgon ;10 acipasiguntcisat. Nanabucowan !ni /u undcipasiguntcisawan,anigagawa piwan. "Kaga tigu wapigak andat inantamog!"Misa kanicimamadcat Nanabucu."Amantcigickri nandam"wawiyac tcitotawak kayii win?"ka i cictcigawanan,";udinaniman lni /u pinasiwan. Acimadablt sagaigan, midaci:rrma 15 n micawi kwam ka i ci U cicink. "Ambasano, ninga a -cmugok anotc, pinasiwag,"kri nandam. Uwl kwatiinimanIni /u wawiyac ka totagut. Cigwa kaga t udamugo 8 antegwa^anotcisagu pinasiwa 8 . Midac ka/rnat :nintcitingttntamici kagun,"Kaguxwin i i witi20 Midac kagatka*i*cictciganit, anlc panagu gatanwavvatonit.Cigwasa uwabaman upabamasimonunit mi /u pinasiutwan. A ic mlsa kawm, prrcasiwan!" uwl kwatiinimantcipicanit. Ackamigu tasing kacigatinigin paconagusiwan,kaga pi aciponinit ; nagawasagui witi ipangicink utonsa-
such137Now, (the women) began splittinga tree in an effort tofind him, 1(keeping it tillup) the elder sister had it all inpieces; but she had failed to find him. And then the youngerwoman yonder, where she was, finallybroke her axe."Mylittle sister," (the elder sister)said to her after shehad broken her axe,"so it will be I who will have ahusband," she said to her little sister."Would the same happen to her too!" And this hethought: "Now,would that only once she might strike(the tree) with her axe,"was the thoughthe had of her.Then he watched for her; presently was the tree reallysplit up by her ; then up he leaped. And there wasNanabushu leaping away, falling headlong with laughteras he went. "That itactually was the home of a GrayPorcupine they thought!"And so upon his way"Icontinued Nanabushu.wonderwhat I shall do,"he thought,"in order that Imay playa trick on him too !" was his thought of the bird.When he came out upon a lake, then far out there onthe ice he went and lay down. "Now,I shall be eatenby all kinds of birds,"he willed. He formed a schemeto get the one that had done him a trick. Then trulywas he eaten by crows and by various kinds of birds.Then this he said to them: "Don tyou eat upon meyonder at my buttocks," he said to them.Whereupon truly such was what they did, and a continuous din did they keep up. At last he then saw thebird sailing about through the air. "Alas,he is not coming!"for he longedin his mind for him to come. Graduallyas the days came and went, nearer it could be seen,tillat last it then alighted ;and a good way off from yonderplace where it came down was (Nanabushu) observed.1This passageis in the passive, with "Nanabushu" as subject;but in the translation it is turned about, with "him" as object, and "the women" as subject.
138bamigon. Midac kaga/t a pidci ugusigon. Tcigwasa w! kakupinasi kagon. Acipa kiwagit, iicikwackwackwaninit. Midactcigwa ackamigu kawin to n tanslwan l kaga prrgu uwawangawanimigon.Kaga prrgu owi kitowan : "Anintaglnawauntamasiwao- o o witi wminwa^uclo-anat?" Mlsa oraora tO O l rr-C) Owiti wantamigut. Cigwa ackamigu wasa iciplndi kwanuwanutclting, kaga pigu kawin sagiti kwanislwan.Acipasiguntcisatkackitiyantamawatlifi/uiuctigwanini."Micanim Nanabucu, ninglgagwanisagi rk !"10 Madclpa tot l c /ui isaga i gan. Anlc anupimiwrkwatci irnit.Misa x cigwa pacwabandank wa kwagamiwaniniki i <usagaigan acipagitcitiyamat, mldac ka icipangicininitima nmi tcaya r. 3 Midac ka i nat :"Winangii kiga i gotcra nia-klwang," ugri nan. "Klgawlnanimik a 11 anicinaba."17. NANABUSHU PRETENDS TO BE A WOMAN.15 Misa / anrrcimadcat papimusat. Misa x ugltabi tawa8i kwawa^ manisanit; anlc uglmi tawa 8 :ka ijictciga-irngubanantciwltigamank"Amantcigic4a e a /u inini?" i kitowa 1 ."Ambasano, wawiyac ningatotawag awagwaniwigwanag,"krrnandam Nanabucu. Ugi kaniman kamawinit wagwi-20 sisinit. Midac ka/rciwawaci irt ka-i ci i- kwa kasut. Midacadi ko-u-blnisagusm mldac Ini /u ka a wa tcigatri -u ikwang.1Ackamigu kawin to"tanslwan,gradually did it less,"that iskeeping upits fear.-Mi tcaya-r,"on the ice;" literally,"on the firm.""itgradually became less afraid;" literally, "it
"1 39And it was true that much was he feared (by the bird).Then after a while to where he was came (the bird).Ashe raised the muscle on his calf, away went the otherhopping. And then presentlyitgradually became lessafraid, 1 till at last (Nanabushu) was made free and easywith. Then finallythis it said:"Whydo you not eatof him from the small of the back, where he is fat?"Thereupon truly from that place was he eaten. Presentlyfarther into the anus yonderitput its neck, then at lastit did not take its neck out from there.Then up he sprang closing his anus tight over theother shand."Confound Nanabushu, by him am I frightfully treated!"While (Nanabushu) went running along the lake, naturallythe other tried in vain to get free. And then presently,when nearing the far end of the lake, (Nanabushu) freed(the bird) from his anus, whereuponice. 2 And this was what he said to it :down it fell on theBuzzardshallyou be called till the end of the world,"he said to it."Foryour filth will you be loathed by the people."-t17. NANABUSHU PRETENDS TO BE A WOMAN.And then away he started upon his journey, travellingafoot. And so he came within the sound of some womenwho were gathering fire-wood;now he secretly overheardthem saying: "(I)wonder how we can bringit to passso that we can marry that man!" they said. "Now, atrick I am going to play on them, whoever they are,"thought Nanabushu. He knew that the mother (of theman) would cry. And so he got into gayattire after hehad taken on the form of a woman. There was a caribouspleen which he turned into a woman s thing. After he hadtaken on the form (of a woman), (and) after he had gone
"""""140Ka*rcinagwirirt, ka/rcinasi kawat H* u i kwawa 8 ,o o widacugri na8 a pika/irdisat: "Anmtiayat a 8 a /u inini cinganimat4 8 /u ili kwawa 8 ka/rnint?" Midac ka/rgut: "Mrirma 11 nawotanaayat," ugrrgo 8 ."Gagwanisagisi, antugwantci i nan-5 dank.""Tagackuma, awrrni k,"udina^;Ninbi icinica irgo ninlgrigok,udina c i u i kwawa 8 .Misa x kaga t ka/i ciklwat pacik, ka i ciwlndamawint wat:a /umindimo n Cya wagusisit. A kitut a 8 a /u i kwa mayatcratci-10 mut :ninlgri gok,"Plwita oma n aya."Odac i kito : Nimbri cinica U goi kito. "Midac ka plcimadcinicalirt, awitibatcimun,nintik. Nicagwanim. Tabicawag nintangwaiyag.Midac a kitut a 11 mintimoya: "Anin dac c^i u antawabamasiwak,"utina 8 c K /u i i udanisa 8 .15 Midac kaga t pa-rcinantawabamawat !gi /u ikwawag,mlsa x ka i klwawitciwawat lgi/u ikwawag. Midac ka/rcrcrnotai nt iwiti wantapinit Ini /u niniwan. Mlsa 7 cigwa x ki u*-napamit. Cigwa uwlcama 8 utangwaya 8 tclmanisawat. Anlcatcinagu kimamatwa i-gawan, aca nibiwa misan. "Awanan20 dac l a u mamindaga kaji n cawisit?"utinawan, uwlntamawawanugiwan. "Kagatsa klci n cawisl a 8 a /u nintangwanan."1The woman impersonated by Nanabushu.2A woman to whom the message had been 3The woman-hater.given.4The formality of leading a daughter to that part of the lodge where a man
"He"WhereuponWhy"HIover to where the women were, this he then saicl to themwhen he came upon them: "Where is the man who issaid to be a hater of women he was told ?" :"Here in the centre of the town heis,"he was told.is it ishopelessly impossible, uncertain what hisfeeling would be (concerning" you).""Thenpray, do you go and give him a message,"hesaid to them;I have been sent hither by my parents,he said to the women.And so truly,when back one (of them) went, then wasthe old woman who was mother (to the man) given themessage. Then said the woman who had conveyed themessage: "A strangeris here." And this she said: "Ihave been sent hither by my she saicl. "Andparents,"so when I was set upon my way hitherward, Go givethe news,I was told. I was loath (to go). Let myfriends come hither, (said the woman T )."Thereupon said the old woman :go look for her ?"1she said to her daughters.2"do you notAnd so truly came the women seeking for her, whereupon back home the women went, taking her l with them.And then a place was made for her there where the man *was seated. Therefore she a now had a husband. 4 Byand by she wished her sisters-in-law to go with her togather fire-wood. 5 So in a little while after the sound ofher chopping was heard, already (was there) much fire7wood. "W ho is she that is such a remarkable worker?"they said to their mother, they said to her, telling herabout it."Truly a goodworker is our sister-in-law."6seats himself, and having her seat herself by him, is the public announcement thatshe is his wife.5One of the first things a bride does is to go for fire-wood or for water, aconvention by which she enters her new station.6A pleasing compliment which a wife enjoys is to hear it said of her that sheis a good worker.
"142Anlc kagatsa minwantam a fi a /u minclimoya, kayala^a /ua kiwa^zi kicincawisinit una a/ngani kwamiwan. Mldacka/rcikanonat wabicaciwan :"Ambasanowlto kawicin o o*acictcigayan," ugrrnan. Mldac Ini /u ka trnltcanisit o 6 widacugi nan i :;"Ambasano, mo n jag maw^n," ugri nan.Mldac kaga/t ka icictciganit, ta kubinat acictcigat mlya/taskljignning saga pinat; ta^kubinat pimumawisut.Misagu pana mawinit."Wo o widac i kidun," ugrrnan. "Tagwagicop10 -a mwa, i kitun *i 8i /u tcimamawiyan," ugri nan.niwl-15Mldac kaga/t anwat a s a /u abinodci. "Tagwagicop niwramwa !" inwat.Caylgwa nisitu tawa. Anlc cigwa sagitowan usinisan,anlcl (ugimawiwan; potc kicitciganit fi /u anicinaba ka i^kltuta s a /ua kiwa n zl."Anlc, anicinabatug, a kitut wa s a /u nocica 11 ,itagwagicop niwra-mwa, kito. Mlclac kaga t ka plciminintNanabucu tagwagicopln. Pisa a l p! ka irnicicininikmadcit.Midac wawitigamat mi /u ininiwan, cigwa ugi^waniman20 pigickananinit Ini /u ublnisagusln. Mldac kigiciip aca namadapiwanucinisan kaya uzikusisan mlsa cigwaki kanimat
""143Now, thoroughly pleased was the old woman, as wasalso the old man, that such a good worker was theirdaughter-in-law. And 1 then she (Nanabushu) addressedthe "IMarten, saying: wish you would help me in thisthat I am undertaking,"she said to it. And so that wasthe creature she had for child;andthis she said to it :"Come, now, all the while do you cry,"she said to it.And that truly was what (the Marten) did. When she haditstrapped to the cradle-board, her arrangement was suchthat she had it bound up as far as over the eyes ;withit bound to the cradle-board, she played the nurse carryingit about on her back.And so all the while did (the Marten) weep."Now, this do you she said to it. Some tendersay,"loin do I wish to eat, do you say, so that you may cry,"she said to it.And that truly was what the infant cried. "Sometenderloin do I want to eat !"it cried.Presently they understood what it wanted. Now, thenout went her father-in-law to cry aloud, for he was chief;for of necessity were the people bound to do whateverthe old man should say. "Now, O ye people! thus saysmy grandchild, Some tenderloin do I want to eat, hesaid. And so truly was Nanabushu given some tenderloin.It hushed when it was given something good to eat.And so while she (Nanabushu) continued living (as awith the man, she then became aware that the spleenwife)was decaying. And so one morning, while her father-inlawand mother-in-law were seated, she then began torealize that she was becoming rotten between the loins.1Pleased because their maintenance is assured. A son is seldom encouraged tomarry a woman simply because she is handsome or that she is of a pleasing disposition ;but if she can work,if she can turn her hands to something useful, thenshe is the one for him to get. Behind all this is the desire of the old folks to becared for in their old age.
"gunanta ka cimagwa iKaga mamitawantam t ;144"Piso,"k?" i kitowan ucinisan.acipasigwlt,anira nicikaskabanit."Ka-Acipangicimat ucinisan anasamabinit, acimadclpa^tod.i;kwa inantamogf!" io kitowan Nanabucowan.i kitowan ucinisan. "Wa-pioickanitcitca kamat.i o1 8. NANABUSHU SLAYS TOAD-WOMAN, THE HEALEROF THEMANITOUS.Misa r anicimaclcat minawa Nanabucu, anipapimusatminawa. Mldac ka i nandank : "Mlmawin klpomagwankama kamit nintociman. Mlsa x cigwatci a ntunawag."Misa kaga t nantunaSvat, ningutingigu awiya onontawan10 naeamunit :. o ."Piyakwa nimbicinawicin ca"."Mlsa 7 nasi tawat, misa 7 undcita ani tawat :"Piyakwa nimbicinawicin ca"."Tcigwa uwabaman, kunigimn uma ka kln uclclgwanini15 ayaconingwawanit. Acikanonat : "Anin no ko anln ananoklyan?"udinan."Ka;ninantawikubl. Nanabucu uglpimwan ugimamcipicln."Mldac anat :"Anic wa totaman Ini /u wlgupln?"20Ka, Nanabucu wmantuwa pi kana. Kanabatc klnisa-
said"Why,"What"H5"Phew!" said her father-in-law. "What is that which smellsso ?"her father-in-law.Trulywas she worried about it. When she rose to herfeet, in vain she tried to keep it from falling. When shedropped it in front of where her father-in-law was seated,then away she started running. "Trulya real womanthey thought!"said Nanabushu.1 8. NANABUSHU SLAYS TOAD-WOMAN, THE HEALEROF THE MANITOUS. 1And then on his way continued Nanabushu, on hiswayhe continued walking. Now, this was what he thought:"Perchance he thinks he is free who robbed me of mynephew. The time has now come for me to look for him."Thereupon truly, while seeking for him, he suddenly heardsome one singing:"From the ends of the earth do I come with the sound of my rattles, sha"."And so when he went to where it was sounding,itseemed as if he heard the same sound as before :"From the ends of the earth do I come with the sound of my rattles, sha"."Presently he saw the being lo, it was a toad with her;rattlehanging under one arm from the other shoulder.Then he addressed her,:saying What, my grandmother,what are at?"you working he said to her.am I seeking for some bast. Nanabushu hasshot the chief of the big lynxes."And so he said to her are :you goingto dowith the bast?"an"Why, attemptwill be made to ensnare Nanabushu.Perhaps he may be drowned, for almost flooded was this1For other versions see Nos. 32 and 46.10 PUBL. AMER. ETHN. SOC. VOL. VII.
"146bawatug, anlc kini kibl kagawcro* a ki. Amnti dac ka/irndcipimatisit? i kitowag.""Amngutawin wantcitotawawat klma kamawat Ini/uutocimini? Manitosa win, ninawint anangitla c a /u Nanabucu.5 "Wa, nocis,"Ka,noma ikin inawin Nanabucu."tkana kltaglnlwana u^k Nanabucu^a^a^1awiyamban. Anin, no ko, a i ci a yatla s a /u ga pimunt?"Ka, kagasagu ninotcimo a nan, nmawint ninananta-wi-a*nan."i10 "No ko, anm i ku ana-a man nanantawi-a t?""Aye2, misagu ana a man, o o* kabi a i na a man :"Piya kwa nimbicinawicin ca n ."Anlc owlnga ugagwatciman owlngadac uwlndamagon,kaya a rrma11 pl wandabinit 8 i*i u rianantawi i wanit, midac15 kaya ima andanit. Ickwayai R Igu nintamin. Nlciwag nocisan yag," udigon. Awlnga oki^kino a magon, ka kina uglkikincra-magon.Midac a ; pl ka cinlwana^wat, ka i icipa kunat. Midac kaixipisikaw^at, ka iciklckipinat pangl ima utclngwaniming.20 Midac ka i combiwanat Ini /u wlgupln, midac ana*a-nk anaaminit ani a-ntcikwaskwanit :"Piyitkwa nimbicinawicin caVAnlc mlgu s i u anri nwat anra/ntcikwaskwanit. Cayigwa
."earth with water. And in what place can he now bealive? they said.""Now,what was their purpose that they should deprivehim of his nephew? He is really a manitou, so we claimNanabushu to be.""Ah, my grandson! you must be Nanabushu (himself).""Why, long since would you have been clubbed todeath if I had been Nanabushu. How, my grandmother,is the one doing that was shot?""Oh, nearly now have we healed him, we ourselves aregivinghim treatment."l"My grandmother, how do you usually sing while youare giving him treatment?""Ay,this is the way I sing, this was how I sang whilecoming hitherward :"From the ends of the earth do I come with the sound of my rattles, sha1Now, quite everything he asked her, and quite everythinghe was told, even the place where she sat when she gaveher treatment, likewise the place where she lived (in thewigwam)."In one corner of the place do we live. Twoare my grandchildren," he was told. Concerning everythingwas he taught, concerning all thingswas he instructed.And so after he had clubbed her to death, he flayedher. And when he got into (the skin), he tore a smallopening there at its head. And now, when he had liftedthe bast upon his back, he then sang the way she sangwhen she went hopping along:"From the ends of the earth do I come with the sound of my rattles, sha 11 ."Now, such was the sound of his voice as he went hopping1By conjuring with bones and flat, circular skin rattles loaded with pebbles;the bones to be swallowed to give knowledge concerning the cause of illness, andthe rattle to bring one s power into action.
"a148utababandan mrrma n andanit. Cigwaaninasi kank aciwanicinkpa kanatinik wlgiwam; anicinasi kank sagitciparrtawa^."No ko, o O ma11kuca andayang.""Kaga t."5 "Amn win, no ko, ka/irndciwanicinan?""Ka, kanagu ku awlnga gaglbwabimoyan,mldac i*i/ukawln nlsababanda n zin W u antayang. Intawa, nocisitug,icisagini kaniciyu Mldac kaga ka k." t u nabit, anic miguima n santaci kanit wagitcitclngwan /u i iabinotclya 51 .Cigwa10 umi kawabamigolipi ma n kinanigic kawat Ini /u udoma ka kfwayanan."Wa,no ko, anicinabawacaga-a nk kigri-nacagai/>uNya, nocis, kana mri l posoyan !ni /u wigupin ici^kamankagabagljik pimina kwataman," utina {: i i* 11 ocici^ ya^.15 Mldac pru-t tcibisagaswai-nt.Cigwa unagucinini. Cayigwakaga t pldawacinon, cigwa plta pabiwan."Noko, awisagaswan,"pri- kitowan. Mldac kaga t anicimadcat. Cayigwaudababandan 4 fi /u iandanit, uglwabaman odociman kibickwantaigawint. Mlgu x u *i* anawi aci a Inabinit, kagagu20 mawi. Anicagu antagantasik kawln untcimawisl acipindigat.Tcigwa ka irnabit, awaniban kawabamat.Adcikackikibitani, midac iwiti ayanit. Cayigwa nanantawriwawa* kanawabamat, pana ku iwiti awasaya*!.Cayigwa kaya win uwlnanantawi a n. Klca ugrirci ton
149along in a newly changed form. Presentlyhe came inlived. When onsight of the place where (the manitous)hisway to the place, he lost the way (and) came to adifferent wigwam while on his; way to it, (he saw somechildren) coming racing out. "O my grandmother! why,here is where we live.""Indeed.""Pray,how, my grandmother, came you to lose the way?""Oh, by reason of too much weeping have my eyesbecome closed, and that iswhy I cannot clearly see wherewe live. Therefore, O my grandchildren! do you leadme thither by the hand." Whereupon truly, after he wasseated, then there upon his lap played the children. Thenwas it discovered where he had ripped an openingin thattoad-skin of his."Why, my grandmother, like the skinof a human beingis the look of your skin !"!"Ah, my grandchild that was how I rubbed myselfwhen working with the bast, as throughout the whole ofevery day I was making twine,"she said to her grandchildren. And then he waited to be asked to where thesmoking was being held. Already was the evening comingon. Then he truly heard the sound of footsteps approaching. Presently some one came and peeped inside. "Mygrandmother, come and smoke," (the person) came saying.Whereupon truly then away he went. Now, when he wascome in sight of where they dwelt, he saw that his nephewwas used as a cover over the entry-way. Even yet hecould see it,and he almost wept. By reason solely ofhis power to control his feelings was why he did not crywhen entering. Then, after he was seated, there was noone for him to see.There was a hanging partition dividing the room, andthere beyond was (the wounded). Then, as they beganministering, he kept watch of them, and continuously round
"c>1504 E ima n 8wa pra- paiwat, mi tigo ugra- kwakwa pina^Mldac cigwa kaya win anrrcat Wwiti awasayai,cigwaowabaman asota kwa-i gasunit.A pidci waca/pmit sangangasininik5 nawat.le /ui iubigwa k. Wawanigu udoninan acicicigwa-Micanim Nanabucu ! Misanicit!" i kito.Pasigwintcisat Nanabucu udanimamipinan otocimiwayanan,madclba i-wat. Unsusama kamik kapiyapitcipitwavvatciwaninikigu, anigu k pimipato.Ackamigu a kupiski klt10 a kwa-a m. Mi yanawi cigwa pacwantank 4 8 i /u omisonukan,caylgwa upacwabandan c K /ui i omisonu kan. Mi cigwaa x kukitcipisut a kwa a ci ing aciposit/u omisomu^kan.Acini kipmiti*i* u mi tigo8,misa x a pana kagalt unawandanwasa anamindim a ( ki ayanik. Owabama ayanit pamataganit15 anotc 555 l.awaslya Misa wlposiwai i ma n utclmaning, m!sa /acrkunlcawat. "Pa ka,"udina 8 "Panima s:.pica udina .kag,"Misa cigwa krrnandank : "Anlnkacictcigayan awagwankabltot c K \ i a ki?" kri nandam. Cigwa ugi kanona55 l {:i imanitowa n ca, midac ni tam c nigigwan:20 ka l n 8sln /u i i a ki?" udinan."Kawlnina kltanasi-Misa gaga t ka i cigoglnit. Ningutingigu awayat krirndci*a-pockandcisawan,kanisabawanigwan. Ka icipabwatanat,ka i cigagwatcimat : "Anm?"ugri nan.
to the other side (of the partition they kept passing).Presently he too began ministering to him. In advancehad he made ready the way by which he meant to flee,some wood he had heapedin a pile.And so whenpresently he too went round to the other side, he thensaw him who sat propped with a support at the back.Right in his side was the feather of the arrow barely tobe seen. And with a careful grip he held it as he workeditvigorouslyback and forth."Confound Nanabushu! Now he is killingme!" he said.Springing to his feet, Nanabushu seized the skin of hisnephew as he went, (and) started in flight. Frightful wasthe roar of the water that came pursuing after, at topspeed he ran. Then by degrees till upto the knee inwater was he wading. When truly, now, he thought hewas nigh to his raft, then near bydid he see his raft.When up to his waist he was wadingin water, then hewent aboard his raft.When the water overflowed the trees, then at once hetruly realized what a long way clown in the water theearth was. He saw all kinds of game-folk swimmingaround. And when they wished to go aboard his raft,he kept them off."Wait,"he said to them. "Not tillafter a while do you come," he said to them. And sohe then thought:"How shall I do (to select) what oneis to fetch some earth?" he thought. Presently he spoketo the smaller animal-folk,1and so the first was the Otter :"Wouldyou not go after some earth?" he said to him.Thereupon truly down into the water (the Otter) dived.And by and by the one that had gone down came upout of the water dead, he must have drowned. When(Nanabushu) had breathed upon him, then he asked him:"Well?" he said to him.1Such as wolves, foxes, beavers, badgers, minks, hares, and the like.
"Aba"A152"Mlgu4 s i /u tababamagwaban Igi /u mi tigog piwa kwanakisiwat,mldac a pl ka-rciwanantaman.""Taga, km, ami k c l snasi kani i a ki."Kaga t ka/i cigogit l a e a /u ami k.Tcigwa"Anln?" udinan. "Kawl-5 bockantcisawan. Acipabwatanat, nina kanaga klbacwabanda n z!naban ?"minawa kl a-"Kaga t abi tawa tig mi tigog nintayanaban,mldac ka-rciwanantaman."pinisiwagan,"udinan.10 "Taga, kin, wajack."Mldac kaga^t acikogltla c a /u wajack. Cigwa abockantcisawan.Aciwuta pinat ugikacka kunitcantamini, a i tawinik uda kunamini ; /u fci i a l ki; kaya!usitaning a tani 1I 11 a ki.usitaning, a T tawisit15"Anlc misa 4 i: /u itcikackitoyang tci O ci toyang c Pi /u a ki,"lugina^. Anic ml cigwa klpoclatank /u i a l ki, ackamigufiikimi s tcani, ackam kl-aji tot. Anic migu ka i cictcigat.Cigwa ajiki kandank ackam mi s tcanig, o 6 widac kri ft kito :ma"Taga, rngan, wabandan anigu^kwagwan," udinan20 ma Inganan ka/a nonat.Mldac kagat ka icimadcanit, mldac ka/rcitagwicininit."Kawlnisa tanigu kwasinon," kri-nandam. "Usam ta/a -Mldac ka igasin." cictcigatminawa nawatc tcimi s tcanig,mldac minawa kacri nat : wabandan minawa ani-"Taga,25 gu kwagwan," ugri nan.Misa x kaga t klmadcanit minawa. Kuniginm, aniwa kkabaya inantiwan i ; cigwa tagwicinon minawa.Mldac ka i nat:u i:, amba, agwa tayu k," ugri-na anotcawaslya c l fi. Mldac kagat. Misa cigwa krpimadci a t/u i i
153"Justas I came in sight of the tree-tops, then waswhen I lost my wits."fetch some earth.""Pray, you, O Beaver! goTruly then down into the water dived the Beaver.Presently he was another to come up out of the waterdead. When (Nanabushu) breathed "Well?"upon him, hesaid to him. "Didyou not approach anywhere at all to it?"as far as "Truly, halfway down the trees I was, whereupon I lost my senses.""Too bad,"he said to him."Now, you, Muskrat."Whereupon trulyinto the water dived the Muskrat.Presently he came up out of the water dead. As (Nanabushu) took him up, he was holding (the earth) in hisclinched paws, in both paws he was holding the earth ;also in his feet, in each foot was some earth."So therefore shall we now be able to create the earth,"he said to them. So it was then that he breathed uponthe earth, and by degreesitgrew in size, larger he madeit. Now, such was what he did. When he knew that itwas grown larger, then this he said: "Pray, Wolf, do yousee how big this earth is,"he said to the Wolf that hehad employed.Thereupon truly away went (the Wolf), and then afterwards back home he came."(This,) indeed, shall not be the size of the earth," hethought."Too small it will be." And so what he didnext was to have itlarger, whereat again he spoke to(the Wolf): do"Pray, you see again how bigit heis,"said to him.Thereupon truly off (the Wolf) started again. Lo, somewhat longer was he absent;then back was he come again.Whereupon (Nanabushu) said to them :"Now, come, goyou he ashore," said to all the various game-folk. And so
154awasiya 8 8.Cigwa kltagwicinon ka a tionat. osam"Aye ,ta/a gasa," ugrrnan. "Anawi klnlcugtinantiyan, kawin katiibisasinonka/i dnit pitcmag wa pimatisit," ugrrnan. Mlsaminawa ka o i ji citot, "Cigwa"mimataga," ugrrnan; tac5 i i utanigu kwagwan,"ugri nan.Misa 7 minawa ka i cimadcanit. Misa babra tpmic nro -gun. Kanro gunagatnig, cigwa tagwicinon. "KagiitsapPtcaka i-cayan.""Kawin," ugrrnan:"usam atcina kidinant. Kawin10 tataTnigu kwasinon," ugri nan. Mlsa x minawa ka/rjiTrcitot;kanru gunagatinink, "Tagackuma, inabin anigu kwagwanminawa,"udinan.Medac kagat kimadcanit. Caylgwa minawa klmadcawanmlsa 7 pabra t minawa. AT, plnic kabaya r anantinint.15 Cigwa tagwicin. "Kagatsa pl tca I 8 /ui i ka i cayan," ugl nan.iMedac, "Aye8,asam atcina kidinant," ugrinan. "Nawatcisakayabi ka U ci tomin o-o* a ki." Mldac minawa ka i -ciuji tod, nawatc tcimi s tcanig kri cictcigat.-Mldac kaga^t anro gunagatnik minawa ka i cimadcanit.20 Mlsa r minawa pabrat- plnic ninguklsis anantinint. "Mlmawln/u i a pitantit," ugri naniman. Kawin nangwanalli/uikaya pitantisinik, ninguklsis ka i-nantinint cigwa tagwikitowan.icinon."Kaga tsa a pitci pl tca ka i cayan,"8skawin i i"Aye,mini k kita i cinantawanimisinon tci i-25 nantiyan," ugri nan. a "Na gataminatataci kabimatisit uma
55it was true. So, then, now he had saved the lives of thegame-folk. Now, back home came the one he had employed. "Ay,too small it willbe,"he said to him.it will not"Though you have been gone two days, yetbe (big) enough to contain all that are to live in timesto come," he said to him. And so when he had workedupon it again, "Now, once more," he said to him: "perhaps it is now big enough,"he said to him.Thereupon again off started (the Wolf). And then heawaited hiscoming for the space of four days. Whenthe four days were ended, then (the Wolf) arrived."Trulyfar have I been."he said to him : "too short a time have"No," you beenItgone.will not be large enough,"he said to him. Andthen he created some more of it;when four days wereended, "Pray, now, do you see again how largeitis,"hesaid to him.Thereupon truly off started (the Wolf). When again(the Wolf) had gone, then (Nanabushu) waited for his comingagain. Oh, for a long while was he gone. Then he cameback.far have I"Trulybeen,"he said to (Nanabushu).Thereupon, too short a while have"Ay, you beenwill we make thishe said to him.gone," "Larger yetearth."Thereupon again he worked upon it,to the endthat itmight be largerhe did his work.Thereupon truly, after four days were ended, then againaway started (the Wolf). And so again (Nanabushu) waitedfor his coming; for a moon was (the Wolf) away."Perhaps now he isgone forever," was his thought of him.But it was not time for him yet to be gone forever so;when he had been gone for a moon, then back he came."Truly very far have I been,"said (the Wolf)."Ay,but not for so short a time do I wish you tobe absent," Nanabushu said to him. "Not so very few
56a king," agri-nan. "Pitclnag taba taTno kapimadisit oma11a klng," ugrrnan. Minawa ka/iji irci towat, nawatc tcimistcanigkijictcigawat.Midac mmawa ka icimadcanit.5 Mlsa pabra/t minawa, plnic ninguki^kinunawin kl i nantiwan.Cigwa ningupibon ka i*nantinit cigwa tagwicinon."Mlsa i u kaga cigwa ka/rnigu kwag. Kawln po^cl fiii /uta inigu kwasinon. Mlnawasa nawatc ninga U ci ton." Mlsaxminawa ka i ci O ci tot, "Amc minawa inabin," ugri nan.10 Cigwa minawa klmadcawan.Mlsa minawa pabrat.Cigwa minawa ningu ki kinonawinkri nantiwan, midac cigwa plnic nicuki kinonawinanantinit. Mlsa papra t awaniban katagwicininit. Midacka i nandank :"Awaniban," kri nandam. Mlsa anubabra/t,15 misa 7 aci a- pitantinit.Ka/rcrr kitut :"Taga, kin, kagagi,klwitasan amantc inigu^kwagwan," ugri nan.Midac kaga/t cigwa kipasigwau-t. Mlsa x l pana kamadclsanitawaniban anubapra wrka t; anunantawabamat,ninguki kinonawin ka*i*nahtinit. Cigwa pagamisawan.20 "Aniwa kigu, Nanabucu, mi s tca wo o- a ki," ugri-gon.7kaga rr u ta inigu kwag, manu nawatc minawatcimi s tcag ninga i cictciga," ugri nan. Midac kaga mlnamatka ijiirci tot u i i* a ki.Kanrtrgunatinik cigwa minawauganonanIni/ukagagiwan.
157will the number be of them who shall live here on earth,"he said to him. "In time many will theybe who shalllive here on earth,"he said to him. When they hadcreated more of it,it was to the end that itmight belarger that they worked.Thereupon again away went (the Wolf).And then (Nanabushu) waited for his coming again, aslong as a full cycle of seasons was (the Wolf) gone. Whenfor a winter he had been gone, then back he came."Therefore it is now almost as large as it will be.It is not yet so large as it should be. Againwill I makeitlarger."And when he had made some more of it, "Nowagain do you look," he said to him.Then again off started (the Wolf).And so when (Nanabushu) waited again for his coming,then for another cycle of seasons was (theW7olf) absent,and then it came to pass that for two full rounds of seasons was (the Wolf) gone. And then he waited for him,but he was not destined to come back. And this waswhat he thought:"He isgone,"he thought. And so invain he waited for him but; (the Wolf) was gone forever,at which he said: "Pray, you, O Raven! do you flyroundover (this earth) to find out how largeitis,"he said to him.Thereupon truly then up (the Raven) rose on the wing.And so gone was he when he started flying away, and itwas needless of (Nanabushu) to wait for him for a; longwhilehe vainly watched for him, for one full round ofseasons had he been gone when he came flying back home."Ratherlarge, O Nanabushu! is this earth,"he was told."It is now almost big enough, but to the end that ityet may be larger will I make he said to him. Thereit,"upon truly more of the earth did he make. After fourdays were ended, he then again spoke to the Raven.1Meaning the people.
"Midac kaga/t minawa cigwa acipasigwa irt l a fi a /u kagagi.Misa cigwa minawa ki kiwitasat H* u a ki.Mlsa mlnawa papra/t Nanabucu. Pmic nicuki kinonuwinanantinit,awanibani ku katagwicininit, pinic cigwa5 kabaya i* anantinit; wrka cigwa tagwicinon mlnawa. Mldacka i-nat:A, manu nawatc kayabi tami s tca." Mldac kagatminawa ka ijroci tot i i a ki nrirgun, >u "Amc, tagackuma,minawa awinabin," ugrrnan mi /u kagagiwan. Caylgwaminawa pabra t, mlsa x ka i ci a- pitantinit. Anupabl a t.10 "Misalifi"Mimawlni /u intawa ka inigu kwag o a ki,"ugri na fi.Mldac,tciwaba*a-ngiban,"krr kito. "Intawa tcigusigunkninga a-ci ton wl ka tcibltcimi kasunu k." ]SERIES II. Nos. 19-32.19. NANABUSHU AND THE CARIBOU. 2Nanabucusa papimusa ;ningutingigu papimusat slblnsumatabl a; pidcisa mackusi kani. Inabit adi kwan pimima-315 daplwan nibiwa ackana^; udayawani. Kwaya kigu pimiaiyawakusiwawan,midac i i />u:ajiplpagimat "Nicimica,a!"kawa, klwlwapaminKaga tkibi tcikapawiwan.Anlcinasi kawat; payacwabamatoganonan:"Kaga t1Unfortunately the ending is incomplete.2 See series i,No. 14, p. 117.
159Whereupon truly again up flew the Raven. And thenroundabout the earth.again did he flyThereupon againfor him did Nanabushu wait. For aslong as two cycles of the seasons was (the Raven) gone ,as time went on, there was no sight of him coming back,continuing so till he had been gone a long while ;a longtime afterwards he came back again. And this was whatohe said to him: "Well, let it be still larger." Thereupontruly, after he had been creatingit for four days more,"Well, now, this time, again go you and see,"he said tothe Raven. Again he waited for him, but this time hewas gone forever. In vain he waited for him. "Thatothen, no doubt, will be the extent of this earth,"he saidto the (animal-folk). And now, "(I)fear that this willfloat away,"he said. "Therefore in order that itmay beheavywill I make it so that it shall never be moved."1SERIES II. Nos. 19-32.19. NANABUSHU AND THE CARIBOU. 3Now, Nanabushu was travelling about; now, once whiletravelling about, he came out upon a brook an; exceedinglybroad meadow was there. While looking around, (he saw)a caribou moving out upon the meadow; many the prongshe had on his antlers. 3 And straight across the meadowwas he moving, whereupon (Nanabushu) called to himwith a loud voice: "Omy younger brother! wait, I wantto see you!"Truly he stopped (and) stood.Then (Nanabushu) walked over to where he was;whenhe was in close view of him, he addressed him, saying:3Nibiwa ackanaE udayawani, "many the prongs he had on his antlers;" literally,"many the horns he had."
i6omatcina kamigat wandusayan, odanang nimprirndcl.Awasinagokinisitiwag ininiwibanlg, mlgu *r u tabita klnisitiwat.Kaga t sanagat. Nlnanaginiwanaban, midacigu iu piminicimoyan.Ocrwisagu Odotatotamobanlg." pinani Niina-5 bucowan Ini /u umi tigwablni ;acfkwatawanit ;kaT kwa tawanitubi kwa kuni, cigwasa unamma kwinu tagdn. Cigwadackigitowan:"Misa o nasab andodamowa pan."Ta tiwa, acipimugut, wantcitagu waca pit u tininagon.Anicna plwabi k sagapi kisini rrma ubi kwa kuning. Anu-TO kwaskuni a a wisa adi k wandcitagu a konamut; mlsagu uikinibut.Tava, Nanabucu oriio;a t minwantam wantcitagu winino-J O C5 Owan !ni /u udadi kuman. A c , mlsagu cigwa madcrkawatl lwlninira t. A kawa, udagwawana k udoci ton;kaklci tod15 mldac ima ani a-gotod 4 s /u i uwininon. Paba pic kaklci kawata pidcisa pa kada. wawani "Pamagu gld tayan ningawlsin,"inandam. Wlyasi dac mlnawa abi ta pimida udclba kwaclan.Cigwasa ka klcitanik, "Misa cigwa tcimadantcigayan," inandam. Wigwas unantawabandan mldac ima acagwa a nk.20 Kayagwa a nk Nanabucu : "Aklgito tawa, ningakiwiyagantan.A pagicsaikwatug wito pamag a pidcigutata kwutclngwanat."Ta, cigwa upa kwacan 4 c i /u wlnin."Kaga tsaningawl a ngatan."Pamagu pi kwanang rrma tciga kwawinini, "Kantc,25 kantc,"inwawan mi tigon.Misa 7 upagitinan Na*nabucu waca kamu pan. "Kaga tsaningikagwanisaglnawamigun." Wawlp acipa kwacank i si /u
"Ah"Trulya wicked time isgoing on at the place fromwhence I come, from a town is where I come. Daybefore yesterday were the men killing one another, actually on both sides were they killingone another. It istruly desperate.I tried to stop the fight,and then Ifledaway. Thus were they doing at the time." Nanabushureached for his bow then he; strungit;after hehad strung it, he then aimed (to shoot). And then hespoke, saying: was what "This they did at the time."Poor creature ! when he was shot by (Nanabushu), rightin the side behind the shoulder was he shot. Accordingto the story, a metal was sticking out of the arrow. Invain did the caribou try to leap away,breathe no more;and then he died.even till he couldOh, now truly pleased was Nanabushu that so unusuallyfat his caribou should be. Ah ! and then was when hebegan work upon it, cutting up its meat. First, he madea roasting-rack ;when he had finished it,he thereuponhung up his fat. By the time he had finished his workon (the caribou), very hungry was he. "Not till I haveput (things) ingood order will I heeat," thought. Sosome meat partly fat he cooked. And when it was donecooking,"It is now time that Ieat,"he thought. For(some) birch-bark he sought, upon which he spread out(what he had cooked). After Nanabushu had dippeditout of (the kettle),he said :! but I shall spoilitbyeat with a womaneating it (alone). Would that Imightwho was short from groin to knee!"However, presentlyhe sliced off a piece of the fat."Verily,I shall spoilitby eating it (alone)."Then of a sudden at his back from yonder edge of thewoods, "Kantc, kantc,"came the sound of a tree.Thereupon down Nanabushu laid what he was goingto put into his mouth. am I"Truly terribly angered byI I PUBL. AMER. ETHN. SOC. VOL. VII.
udina""<>162wamidci pan umawinanan ini /u mi tigon. Aji*a4kwandawat;mlclacI 8 /u i ikakackrtrt, midac ima ajida tot 4Y U wamldci pan.l fiMlsa/u i iajita kwamigut Ini /u mi tigon ; paya ta ircigopldanimatini. Amc mlsa I 8 /ui iayagosit. Anlc anawi ucla-5 nuwf kwutci ton kawln ugacki tosln I 8 /ui i unintc. Ningutingiguayagosit inabit ka^pi irndusat, owabaman ma I ngananplmatapiskusiwanit mlnawa;pacik, kayabi pajik kwaya kigupimi a yawackusiwawa s .Kwatcigupami ku pinit ajiplpagimat:"Ni st tclnistca !"e .10 Kibi l tcikapawiwa Anlc a a / widac a kiwa^zImaTnganfi.8oganona *i i unldcanisa s /: "Mlsa a u Nanabucu kaganoninank.Kao^o o ugini o tonatuef o nia klbaskinawat. i i Ka^odac ^iciwabisitug i^ma kra gosit.A a madcada 11 , , ijataklbaskinawat.715 Nanabucu kanawabamat pimadclbai tinit.Anln ka i cinamowat ma^rnganag panagu adi kwan nanawicicrasunit. Anlc ka/rnabamawat, 1 mlsao u ciVwa matao>mawat. Kawln kanaga nomag kitacitasiwag iY 11 ki kitamwawat. A pidcigu wawip cigwa animadcawag.20 Nanabucu uganona2:Ni s tcimi s tca, kagu x ta taganapi-!"kagunMa rnoranao; o o acita tagranabiwat, &a tiwa, anln acinamowatpanagu wmin agotani. Wantcitagu kamama kantiwadmldciwad. Kawln kanaga nomag kltaci taslwag krkitamo-1Anic kii Inabamawiit, "theyhad nothing to gain by simply looking upon it"(literally, "whyshould they look upon it,"but the sense is in the other rendering).
1 63that." When he had quickly sliced off (a piece of) whathe was going to eat, he rushed to the tree. Then up heclimbed;and when he got up, he then placed there whathe was going to eat. Thereupon he was caught fast bythe tree ;for justat the moment (a gust of) wind came.And so now up there he hung. To be sure, he tried invain to get his finger out, but he could not succeed.Then by and by, while hanging up there and lookingtowards the place from whence he had come afoot, hesaw a Wolf coming out into the meadow; (he saw) another,still another, coming out into the meadow. Just as theywere about entering the cover of the woods, then he calledaloud to them: brothers!" "My younger he said to them.They stopped (and) stood. Now, the old Wolf addressedhis children, saying: "That is Nanabushu who is speakingto us.Something probably he has killed at yonder placewhere his smoke islifting.And something must havehappened to him, that he should be hanging there. Well,let us go, let us go thither where he has a smoke going!"Nanabushu then watched them as they began racinghitherward.What should the Wolves have appear but a vast storeof caribou already prepared. Now, they had nothing to1gain by simply looking upon it,so thereupon they setto work eatingit. Not a whit were they a long (time)occupied before they had it all eaten up. And very soonwere they started on their way.Nanabushu addressed them, saying:don tyou look up!"As the WTolves looked up, why, what were they to"Mylittlebrothers,behold but a great heap of fat hanging aloft. What theysimply did was to grab it from one another when they ate.Not at all long were they at it before they had it eaten up.Then off they started racing together when they were;
?"Cigwa"i64wat. Animadclba-rtiwa 8 ; kapickunagusinit, nabawic kibitanimatini.Kutciwrkwutcrir ajikackito t 4 s /u i anintc.Ajimsantawat, a/tawa Nanabucu kaga/t ko padantam.Ajiki tcimawit, anlc a pidci wlwlsini. Indawa 4 iwafimis-5kwlwa kamiganik mii /u itinunk mwacagantcigat. A pidcigu7wasi tawl. "Ambagicsakacki toyanl^i 11 tciginabigonsiwiyan."Anigu k uwrkwatciton r 8 !^ 11 wi kinabi konsiwit.Kaga/t ugacki ton c r Q \- 11 kinabi konsiwit, mlsadac u ipitcinag8minwlt i- i wlsinit. Aniwa k anitatawlsini. Midac u/<ui10 ustigwan aniwa k l e /ui ipasiganagatinikaniwa k udontcimilkanci8i /<upimita. Magwagui^i^witi wlsinit pasiganagatinig,a tiwa, acinonta a nicinabawit. Wantagu imauka tigwang mri ma ajra/ta o-sut. A ta, Nanabucu kawinwabanda n s;zln/u i ikaijat. Wagunamwinan ki tci a nigu k15 ajimadcat. Papimiba tod a pidcisa kusigwanini l ifi/uiustigwan; cigwasa papimiba tod ajibita^ucing, "Tcwan ,tcwii n ,"ka-rnwawakami kicing. Nanabucu ajiklgitut: "Kidawananatigu:uganonigon Nlnisa ku uca kamigankkananlbiwi a n,"20 "O u , kiwlgwasi 11 .""Kaga t, Nanabucu, nlwigwasi 11 ."Mlnawa madca anigu k. Ningutingigu pi ta kucin minawaNanabucu, misa kayabi aniwawa kamikicing. Nanabucuajiklgitut : "Kituwananatigu?"s25 "Aye,nini ku anipatinank kananlbawiyan."u"O,klcingwa ku l u Mlsa x ingwana.",ajimadciba tot intikuaniba kamiga, inantam Nanabucu. Ningutingigu mlnawaajipita kucink. "Awanan kin ayawiyan?"1The head of the caribou.2ilkito.
,"out of sight, unfortunately not till then did the wind godown. He tried getting his fingers loose till he succeeded.When down he climbed, poor Nanabushu truly felt disappointed. Then he had a great cry, for he was veryanxious to eat. Now, there was blood on the ground, andsuch was the place where he ate. Very awkward was it(for him to get to it). "Would, indeed, that I might become a littleserpent!"With all his power he tried tobecome a little snake. Truly successful was he in changingto a little snake, and then he was in an easy position toeat. Pretty well contented was he as he continued eating.And now the head : had in it somewhat of a groove, wherehe discovered some fat. And while he was eatino- o therein the groove, why, he turned into a person before heexpected. Exactly over his forehead was where he washeld fast.Why, Nanabushu did not see where to go.It so happened that with great speed he started. As heran along, exceedingly heavy was the head when; runningalong, he bumped against a tree. "Tcwa tcwa n was11,the sound he made when he fell. Nanabushu then said :"And what kind of a tree are you?"Then was heanswered: "Alwayson the ridge do I stand.""Oh, then youare a birch!""To be sure, Nanabushu,I am a birch."He continued speeding on. And one other time againsta tree Nanabushu bumped, whereupon he made the samenoise as he fell. Nanabushu then said: "What kind ofa tree are you?""Yea,ever on the hillside do I stand.""Oh, then you are indeed a pine!"And then as hestarted, it seemed that he was running down hill, so thoughtNanabushu. And another time he bumped against a tree(and) fell. "Who are you?"2he said.2Awanan kin ayawiyan? literally, "who are you that you are. 1
1 66"Nlnsa ku a kwa kamiga k kananlbawiyan.""O,kiglcikiy"Nanabucu, kaga t ningici ki 11 ."Anigu k ajimadcat Nanabucu. Nicingigu ka pangicing,5 panagu kasaswanik Ini /u u tawagan. Mlsa cigwa madciyatagat.Kawm ugi kand^zm a pl tcanigi- 8 !7 - 11saga igan.Ml nano^wana u i anicinaba 8 andaci odanawi tonit iosaga gan iwitac i pamatagat. Nintigumi kaga t adi k pamadagatacinagusit Nanabucu. Pamagu mlnangwana ui10 ima uuxpimacicuta wandcipa kublt wa c a /u Nanabucu. "Aa e micawa 1 , pamatagat!kamadwata ta o nagwanig.{li /ule,lA a /u mawinatawata !", PanaguA ta, Nanabucu anigu k ajimadcat."A," piglgitowag, "a a e 1 , kawasa, kimicaganigunan!"15 "Mlnagwana pacu ninga i cimicaga,"inandam. Mldackaga t anigu k Nanabucu ajimadcat. Ningutingigu ajitabakickikat.A pidcisa upacwabamawanxIgianicinaban kanawabamawat,kuniginln, Nanabucowan ani u ndci a gwagwackuni-20 wan. Anic aniba a bi kani; kumagu a pl tagwucininit,a tiwa, acocacapi kicininit Nanabucowan. Acibasisitoniti^^wa udoctigwanimini. Ka O nickabi tonitanigagawa piwan.Mldac I 8 /u i i :aniglgitonit "Kaga tigu micawa pamatagat inantamog Igi /u anicinabag."25 Kavvln kanagatibatcimoslwan Nanabucowan anuwikagwatcimawat.
"1 6 7"Always by the edge of the bank do I stand."then "Oh, you are a cedar!""Nanabushu, truly am I a cedar."With all his speed then started Nanabushu. And whenhe was come at the end of the second leap, then wasthere a steady ringing in his ears.Thereupon he thenbegan swimming. He did not know how big was the lake.There happened to be some people dwelling in a townby the lake where he was swimming. Very much like acaribou swimming past was the look of Nanabushu. Thenof a sudden there was stirring at yonder place, off a wayfrom where Nanabushu had gone down into the water.Halloo, an elk isswimming past Come, let us chase!him in our canoes!" And forthwith there arose a hubbub(withpaddles and canoes when shoving off into the water).Oh, how Nanabushu went with all his speed!"Ah," they said as they came, "too bad, impossible,we shall be beaten to the shore!""It must be that nigh to the shore am I getting,"hethought. Thereupon truly with full speed then Nanabushustarted. Then all at once he touched the bottom.Exceedingly nigh were the people observing (the elk),when, lo, Nanabushu went leaping out of the water. Now,there was a bank of loose stones sloping down to thewater and when he was come a certain; distance, why,upon a rock Nanabushu slipped (and) fell. Then he burstopen that (caribou) head of his. When up he sprangfrom where he fell, away he went falling headlong withlaughter. And this he said as he went along:"Sotrulyan elk was swimming past, thought the people."Nothing at all did Nanabushu tell when in vain theytried to question him.
<8i6820. NANABUSHU BREAKS THE NECKS OF THE DANCING GEESK.li iMlsaguba pic animadcanit. Nanabucu anibabimusatcigwadac umadabl slblns;udanibabima a ton kagaprigu mi s; tcanigl i8i-uslbi.Cigwadac udababatan 4 8 i />usaga i gan, a pidci unicicinini ima wandcisagitawanigi"{ :i /usowabama.5 slbi. Inabit Nanabuco mlnisi u tawanganig ;ni 4 kansa 8 ,a pidcisa8pa^tinlnowa Nanabucu wagunaniwinan,natagamaba to, udawru da pinanini /u clngubln ; u l kunacicingugacklwaginan. Uciwani ka u icingubl, a pidcisaubwawanana 8 u 8icingubl. Miclac I ui i anlcimadcat udani a -11110 sunan i Y umi kwaban. Anisagawat kigito a u ki s tcinrka :"Nanabucu sagawat. Ucimuyu^k, kagugu kiga i gunan."Kawlndac win pasigu irsiwag lgi /u ni kansag. Kuniginin,oganonigowan Nanabucowan :"Kaga/tsagu nintinigawagantamanuwabamagwanin !gi /u niclmayag. Kaga tiginin pa15 pina kainigat wandusayan ;mlsa 7 iwiti 7 nlmi i tiwat anicinabag.Kagwanisagimaminwa i-gataniwan !ni /u nagamunannagamuwatcin. Mlsagu na onou pamondamanin Ini /u nagamunan. Ambasano kammi i ninim. Mro*ma tcibagitondamanIni /u nagamunan. Ninga u ci ton i^ma katacitayan20 tcinlmi i-nagu k. Ta irnicicin nlmi itlwigamik ka irci toyan."Nanabucu mlsa cigwa madci tad uci tod, cingubl wakalkinat; tcitagu pacitcipagisusinik mi / tu iaplta tod
1692O. NANAHUSIIU BREAKS THE NECKS OF THE DANCING GEESE. lAnd so in course of time he was upon his way. WhileNanabushu was travelling about, he soon came out upona brook he followed its course till at last it; (opened outinto) a large river. Then presently he came in sight ofa lake, very beautiful was the place where the river flowedout (into the lake). While Nanabushu was looking about,(he saw) an island of sand ;he saw some Goslings, verynumerous were they. Nanabushu, simpleton that he was,went running out towards the land, he went to get somebalsam-boughs; in his old soiled blanket he wrapped them.He made a pack of the balsams, a very heavy pack didthe balsams make. And so when he started on his way,he had hishands on the tump-line (running from the forehead back over the shoulders). When he came into viewGoose: "Nana(round a point of land), up spoke a bigbushu iscoming into view (round the point).Do youflee, for something shall we be told."But the Goslings did not fly away. Lo, they wereaddressed by Nanabushu saying: "Trulyam I sad atheart whenever I fail to see my little brothers. Now, trulya merry time is going at the place from whence come I ;for at that place are the people dancing together. Wonderfully good are the songs that they sing. Pray, let me makeyou dance. Now, these that I have on my back are thosevery songs. And down at this spot will I lay the songs.I will fix a place yonder where I will devote (myself) tomaking you dance. Handsome will be the dance-lodge thatI will make." Nanabushu thereupon set to work makingit, with balsams he made a stockade; at only such a heightthat it could not be taken at a leap was how high he1For other versions see Nos. 1 1 and 48.
Ajipasigwltunlmri tlwigamig."Ml -r 11 cigwa tcimadci taiyang tcinlmiitiyank. Ambasa, mi i u icra gwa taiyu k."Kaga/t ni kansag agwa tawag."Ambasano, kawlndamoninim ka/a rciyag. Migtl r c i />u5 kani rna/a man aTdyu k ^{ 2 {/ -utcinlmiyag. Ayangwamisiyuk. Kagi/ wlwamwisi kagun. Mlsagu u i cigwa tciplndigayak^Ym^ nlmi itlwigamigunk."Ajipmdigawat ni kansag, kaya win mang ; kaya win daccingibis ajiplndigat.10 Ka kina ka plndiganit Nanabucu uglpa a-n udickwandam.Cigwa xNanabucu wlmadcra m a kawa minawa uganona^:"Migui u kania rna a man, aTdyu k. A pidac pasinawandisuyanmra^pi kapasigwlyan. Ml wlnigu u inanasawaya I*kababatacicimoyan. Mlsa cigwa tcimadcra man :"15 "Pasangwabicimowinan ninpidonan, nicimisitug !Nabanagatacimowimm, nicimisitug, ninpitonan."Midac cigwa a pidci udcl kima 8 , misagu kagat ka kinapasangwabicimunit."Ayansigwacimowinaiinimpidonan, nicimisitug."20 Kaga/t ayansigwa tawa11pa kicnlminit..Nanabucu ajikigitut:1"A e xi , mlcigwa pasinawanintisuyan!"Nanabucu papanimi, Nanabucu uda-ninatcicimu tawat Wagunaniwinan pimi a yasigwa taniti;^.sj .u ni kansa 8 .Aji U dota pinat ajipo kugwabinat ;minawa25 abiding pimra-yasigwa tanit ajipo kugwabinat.Ckwantank iwiti tacicimu a^V 11 mang. Intigunantaguumadwagwawabina, i u ni tam mang. Wagunaniwinan pangi
made his dance-lodge."It is now time for us to begindancing together.To be sure, the GoslingsHither, now come you out of the water."came out of the water."Harken! I will tellyou how you are to act. Accordingas Ising, so do you when you dance. Do you take pains.Don tyou fail in anything. Now is the time for you toenter into the dance-lodge."Then in went the Goslings, likewise the Loon;and alsothe Diver entered in.When all had gone inside, Nanabushu closed up thedoorway. Now, Nanabushu was about to sing, but firsthe addressed them again, saying:"Thereforeaccordingto what Isay in my song, that you do. And when Ibecome thrilled, then shall I rise to my feet. Thereuponinamongst youshall I dance. It is time for me now tobeginsinging:""A dance with the eyes closed do I fetch !A dance upon one leg, O mylittle brothers !doI fetch."Thereupon then were they much thrilled with the song,and so all of course danced with their eyes closed."Adance with the necks close up together do I fetch, O mylittle brothers !"Of course, up close together came their necks, while atthe same time they were dancing.Nanabushu then spoke up: "Behold, now am I in atransport of delight!" Rising to his feet, Nanabushu movedabout, dancing here and there, approaching (the Goslings)while he danced. Foolishly did the Goslings hold theirnecks close up together. As he took them up, he broketheir necks;once again when they bunched with neckstogether, he broke their necks.By the doorway yonder the Loon was dancing. Now,it seemed as if he heard the sound of the breaking ofnecks, thus it seemed to the Loon. Happening to open
"Misa172ajitockabit a tawa, inabit mang, na i tag ubimibo l kugwananiNanabucowan ni kansa 8 .Ajiklgitut mang: "A e^e 1 ,Nanabucukidickwanigunan!"i uanawitabacitcipagisut.a kawa a kitut mang, migu5Alta a ,Nanabucu miwanigu iniwati mangwan nwa pinanat.lTa, mang anupapisingwa i gat. Anawidac pacunagwatiniwa nibi abanabit aca i pacu Nanabucowaniajipa kublgwackunit mang. A tawa, ajitangiskagut i^mauclganang. Kaya win a i tag anupa kublba i wa a 8 a /u10 cingibis,ml gaya wlni i /u kltangickagut Ini /u Nanabucowan.Mlsa i u cigwa ajiklgitut Nanabucu: "Mlsa iu mini k ka a -klwang ka*i cinagusit l a G a u mang, kaya a^a 11 cingibis."Misa cigwa ajigu pitiwiti unimi itiwigamigunk, aniwalkigu mbiwa uglnisa c s /u i i nikansa 8 . Nanabucu ajiklgitut:15 "Arnantcigica pidci ka ciminosa ikwayan ogo /u nini kansimag?Ambasano, ninganigwa a tbwanag." Kaga madci taNanabucu ki tcibotawat mi tawangank. A pidcisa mbiwaka/rcawangitanik, mlsa cigwa madci tad ningwa a bwat.Mldac i^i 7 * 11klwitackuta anisagisitacima84 8 i /u uni kansima 8 .20 Ka^Icltad mldac i ikaga/t wlniba.>u"Ambasano, klganawantai n imwa nini kansimao-," udinan lniOO/u utcltln. "Nintclt,kanawanim gwatcinatawm awlya ningakimotimik iwa ninikansima8 ." Nanabucu ajitcangitiyakisut mldac iwiti;Ini/u25 utcltln:nayaciwaninik ajitcangitiya kidut. Mlnawa uganonanWlndamawicin anicinabag sagawa O wat."Uganonigonutcltln : "Klgawlndamon."
his eyes a little, why, when the Loon looked,it was tosee Nanabushu at just the time when he was among theGoslings breaking their necks. Then up spoke the Loon :"Look out! by Nanabushu are we being killed off." Now,when the Loon first spoke, he then cleared (the balsamenclosure), just barely getting over.Oh, but how Nanabushu did go in pursuit of yonderLoon !Ah, and how the Loon did struggle in vain to get!away And though near by seemed yonder water, yetwhen he looked back, here close was Nanabushu then;into the water leaped the Loon. Poor thing! hewas kickedon the small of his back. And in time did the Diver alsotry to escape into the water, but to no purpose, for hetoo was kicked by Nanabushu. Thereupon then up spokeNanabushu: "Therefore as long as the world lasts, thuswill look the loon, so too the diver."So then up from the shore he went to his dance-lodgeyonder, and rather a good many Goslings he had killed.Nanabushu then said: "Wonder in what especially fine wayImay cook these Goslings of mine ! Isay, am I going tobake them."Truly to work set Nanabushu building agreat fire upon the sandy beach. When a very great dealof the sand was hot, accordingly then did he begin bakingthem. And so in a circle about the fireplace he laid hisGoslings, (covering them) so that onlytheir feet could beseen sticking out. When he had finished (this work), hewas of course anxious to sleep."Isay, would have I youkeep watch of these Goslings of mine,"he said to his bottom."My bottom, do you keep watch over them, lest someonerob me of my NanabushuGoslings." lay with bottom up ;itwas over towards the cape he laywith his bottom turned.Again he addressed his bottom, saying: me "Inform if anypeople come paddling into view (round the point)."Hewas answered by his bottom saying:"I will inform you."
Nanabucu cigwasa aniniba, a pidci cigwa anibosangwam.Ajia kawabit Ia 8 a /u miskwasap anicinaba 8 sagawa a-mo:.Anicna ajiklgitut:"Piwitagsagawa*a*mog."Anicna owabamawan Nanabucowan tcangitiya kisunit5 kaya l ci- i undabasawanit. /<uAjigikitowat igi /u anicinabag:"Kagu udayanatug Nanabucu ima krirndabasawat.Ambasano, wl kimotimata wagutugwan ayagwan ima kltcangitiyakisut."Anlc, ml cigwa ki kanonigut Ini /u utcitln, amc amrrnabit10 Nanabucu; mldac ajinikawaba a-mowat8 7 -11i- !utclmaniwa,mlnawa cigwa anibosangwamu(a s a /u Nanabucu. Minawaajitibabamawat Igi /u anicinabag. Anic inabit a 8 a /u Nanabucu utcitln, pamagu mlnawa anicinaba pa u ndciminawagurnunit."Piwitag sagawa*a*mowag!"i kitowan utcitln.15 Anlc Nanabucu anu rnabit, anicna aca ki a ca u ta a moglgi /u anicinabag. "Kaga t klgaklnawick," udinan lni /u utcltan.Wagunanlwinan upapasagupinan Ini /u uutcltan. Pamagukaga t wabamatwaban lgi /u anicinabag kitaklkanoc. Kagu xmlnawa kanocici kan. Mini kigu wanibayanniwlniba."20 Mlsa gaga/t Nanabucu nibat.Midacli9iuajikigitowat igi /u anicinabag: "Ambiisa,mri /tU cigwa klposangwamigwan a 11 Nanabucu."Cigwaajimadcikwaciwawad ina kwaciwawat Nanabucowan. Ajigabawataji ijawat ima ckutawaninig. A tawa, panaguni-725 kansa 8 sagisitacino 8 8!Wawlp umo kawangawawai11!ajikimotimawat Nanabucowan. Anlc matwangwamowan.Wawlp ugicpisitapinawa ; nayap tibicko aji a-yani pan usi-
said175Nanabushu presently went off to sleep, he was soon invery deep slumber. While the bottom was watching,some people came paddling into view (round the point).Naturally then up he spoke: "Some visitors are paddlinginto view (round the point)."Of course, they saw Nanabushu lying bottom up, andalso the smoke of his fire. Then up spoke the people:must Nanabushu have yonder where the smokerob him of whatever"Somethingof his fire is lifting. Pray, let us gohe has yonder where he lies with bottom up."Well, so when he was addressed by his bottom, thendid Nanabushu look, but to no purpose ;and so whenthey paddled round to the other side of the point, thenagain into sound slumber did Nanabushu fall. Then another look at him the people took. So while the bottomof Nanabushu was looking about, then suddenly again thepeople came into view on the water. "Visitors are appearing (round the !"point) his bottom.Now, when Nanabushu looked, it was no use, for naturallyback did the people turn their canoes. "Atrulydownright liar you he said to hisare,"bottom. Foolishly hescratched his bottom. "Ifyou had really seen the people,you should have spoken to me. Don t you speak to meagain. As long as I had intended sleeping, so do I wishto sleep." Thereupon truly Nanabushu went to sleep.Thereupon then said the people: "Come, now is whenNanabushu must be sleeping soundly."Then off theytowards where Nanabushustarted in their canoes, goingwas. When they landed, then they went to where thefire was. Ah, what a heap of Goslings with feet stickingout !Quickly they dug them out of the ashes when theyrobbed Nanabushu of them. Now they could hear thesound of him asleep. Quickly they broke off the legs ;back in the same way as before they placedtheir feet
mlgu"Gwa"ltam usagisitonawa. Wawlp oposi a wa r 8 !11ni tansa 8 ,mlsa cigwa ajimadcawad.Cigwasa kuskusi Nanabucu ; ajiclplt,"Pa ,nindosamigwan.Kwatcinatawin ta irsamisowag nini kansimag."Mlsa5 cigwa uda pinang r 8 - 11!pajik usitani !ni/u uni kansiman,mi nangwana u i aji u-ndcibi tod l s /ui i usitani. "Pabapinisiwagan,mlsa gaga t krirsamisuwat igiwa nini kansimag."l sMinawa pajik umamon /u i iusitani, mlsa kayabi ajiU n-dcibitod 4 8 i /u usitani. Mldacl 8i* i /<uajimamot8 /u i imi tigAba pinisiwagan,"1 510 ajinantwawangawat awaniban awlya.;inandam. tcinatawln ningrkimotimigo nini kansimag."Mlsa 7 undcita anunantwawangawat. Wagunaniwinan nandukawatciga ; kaga t mi tawangank pimi kawawa 8 ki kabanigwan4 8 i />u anicinaba4- 8 i />u krkimotimint.8 . Misacigwa kf kwaya kwantankWagunaniwinan ajikacki tot udijibapasagupinanIni /u utcltan. Kaga tsa unickri gon lni /u utcitin.Nanabucu ajiklgitut:"Ka,mawlni i u a tagu ningatotawasi,anawiwln i ipa pasigupinag. Intawa <uningatcagiswa."Nanabucu ajimadci tat mi tigon u kwa kuwabinang a; pi20 ka s tcipiskananik, Wagunaniwinan acinisawa a nk Ickuta, mlsa 7i 11 tcagiswat mi/u utcltan.Wibago, a Tc! n ,tcl n ,tc! n ,tcl n ,"inwawasu.Ajiklgitut Nanabucu: "A n a /n ,ltci n , tcP, tcP, kaaTnwayan,kawindamawisiyan nini kansimag ki !"kimotimigowa25 Mldac iu a pidci a kac l 8 7kacank ka i nitanik11i ! utclt, midacui aci lkugabawit. A tawa, kawln kanaga ugacki tosln tcipimusat-,i 11 ajimiskwiwinit l i i />u uniciciwa8 ,a pidciugacki ton wawasa a tod lni /u u katan, anugutcimadca ;miya ta aniwa k i11 c pang! ajikaskitot tongitiya a mlt.
sticking out. Quickly they put the Goslingsinto theircanoes, and then they started away.Presently from slumber woke Nanabushu as he stretched;(himself), "Oh, Islept too Itlong! is possible that overdone might be my And so when he reached forGoslings."the foot of one of his Goslings, why, he really pulled out(only)a leg."Too bad! it is the truth that too long havethese Goslings of mine been cooking."One more foot hetook hold of, and in the same way he pulled out another foot.Thereupon taking a stick, he searched for them digginginthe ashes; but there wasn t a single one. "Bad luck,"he"It isthought. possible that I have been robbed of myAnd so with a will he tried to Goslings." dig them out(of the ashes), but with no result. It occurred to him to seekfor tracks; truly, on the beach were some footprints whichthe people must have made when they landed. Thereuponnow quite sure was he that he had been robbed. Foolishlythen as much as he could he scratched his bottom. Trulywas he angered by his bottom. Nanabushu then said : "Ah!this is not all that am Igoing to do to him, even if I amscratching him. Indeed, I will give him a thorough burning."Nanabushu then set to work piling up some wood when;a big blaze was going, he then foolishly straddled the fire,whereupon he gave his bottom a good burning.In a little while, "Tc!n , tcP, tcP, tcP,"was the sound(his bottom) made when being burned.Then said Nanabushu: "Oh,so TcP, tcP, tcP, waswhat you said, you who did not inform me when I wasbeing robbed of my Goslings!"And so when his bottomwas burned like charcoal, he then stepped away. Poorcreature ! not a whit could he walk since he was; bloodyat the testes, as wide as was possible for him to do heplaced his feet, in vain he tried -,goingdistance he could walk with feet apart.12 PUBL. AMER. ETHN. SOC. VOL. VII.itwas but a short
>c17 8Aniwa kigu wasa anttagwicin ningutingiku inabit mi tigonsanugwa kitaniwan ; wagunanlwinanudaninlsawa a iian.Kanigabi kank aci a/banabit ; a/tawa, panagu kamiskwlwa-"kwatinig Ini /u mi tigonsan. Ajikigitut Nanabucu: "Miskwa-5 blmagon uga cini katanawan i Igi /u anicinabag mini k ka/a--kiwang kaya mini k kaglcigowank. Antagii ugawusamantanawaigi/uanicinabag,ugapa kusiganawa."Misa x mmawa animadca Nanabucu. Kaga t kawinougacki tosm anuwl pimusat, a pidci sitawitiya. Ningutingiku10 papimusat owabandan cockwanabi kanig, wagunanlwinanNanabucu ajicockwatciwat. Ka kabayabonut, midac i^i - 11aci a-banabit. A tiwa, otomiglwitiyan. Kagatkagwanisaginagwatini. Nanabucu ajiklgitut: "E mlsa /u 1 i ka i, jinilkatamowadanicinabag, wa kunag ugai cini katanawa.tci a*ni a>lklwansfi s Andaofadac u^awu n samantanaw a7 li i />uv-/ O O c7>kaya dac ugamldcinawa Igi /u anicinabag."2 1 . NANABUSHUAND THE CRANBERRIES. 1Mlsa x Nanabucu anijimadcat, aniwa k ugacki ton tciminopimusat.Kumagu a pl tagucing siblns umatabin ;inabitlpanagu anlbiminan kamiskwra; kubanig mlgu s u ianijinazi-20 kang."Atiwa, kaga tigu nlbiwa ningamldcinan ; pamagua pidci kl tawlsiniyan nlngaponi tonan." Wi kwa tigwayanikNanabucu ucigabawi islblns; inabit anamibig midac kaga t1For another version see Nos. 13 and 59.
"Red179At some distance away was he come, when suddenly,on looking about, (he saw) some brambles standing indense growth without reason he walked; straight throughtheir midst. After he had passed through them, he thenlooked back. Oh, how completely red with blood were thebrambles ! Then said Nanabushu : willows shall thepeople call them as long as the world lasts and as longas there is a sky. Special delight shall the people takein them, they shall use them for a mixture in smoking."And so on his way continued Nanabushu. To be sure,he was not able to walk, in spite of his efforts ; exceedinglystiff was he at the bottom. Once while going along hesaw a place where the rock was smooth, and then likean idiot down slid Nanabushu. When he was come atthe other end of the slide, he accordingly looked back.Why, there were the sores of his bottom. itReally wasa frightful thing to see. Nanabushu then said: "Oh,thisis what the people shall call it, lichens they shall call it.And very much shall they esteem it,and as long as theworld lasts shall the peoplealso eat it for food."2 1 . NANABUSHUAND THE CRANBERRIES. 1Accordingly, when Nanabushu departed on his way,hardly was he able to walk with any comfort. After hewas come a certain distance, he came out upon a brook ;while looking about, (he saw) nothing but high-bush cranberries, and that they were of a red kind of bush. "Ah, surelya heap will I eat and not till I am; thoroughly satisfiedwith eating will I leave them alone."By the bend of thebrook Nanabushu went and took his stand;while lookinginto the stream, he then of course saw high-bush cranberries
"i8owabandank anlbiminan rrwiti agawatablgisininik. Nanabucuajiklgitut: miwaniwati "Taga, kamldciyanin." Ajitclga kwabagisut; anunandobiginigat, rnlsa kawln umi kanzlnan. Intawaa kwanabawat ajimockamut agwaslit7mlgii pimi a nwa tinl-5 kamisanik. Inabit, a tawa, mlsa untcita anlbiminan wabandank anamiblg ; mlgu mlnawa tciga kwapagisut, a tiwiiNanabucu acikitcikisklngwacing. Tci a-nigu k ajikaskitotijimawi. Anlcna klwaskwacin. Magwagu mawit kagoomanacabiskagun. Ajiba katawabit magwa mawit, kuniginln10 anlbiminan nanacabiskagut. Taya, gagat a pidcisa minwantam.Mlsacigwa mantantcigat a; pidcisa katawlsinitkaga t minwantam. Mldac kaga t wawani kacki tod pimusat.22. NANABUSHU AND THE DANCING BuLLRUSHES. 1Ningutingigu papimusat awiya onontawa sasa kwanit.Wagunaniwinan unasi tawa. Kuniginln, saga-i gans sagita-fiii15 wanig slblns, mri ma8ayanit rrwa ininiwa 8 , picicig c i iininiwa 8 . Ka kina pingwacagitiwa, kayadacaci u nit ka kinau20-u wabigunln ubata kibina-u ni. Cigwa owabamigo."A e c !c,Nanabucu, niwlnlmi i timin, nicwasugun niwlnlmi i timin.Ka^a otio-uo niwlki tcinimi i timin."Ni s tc!mi s tca, 28mlsagui ipaba nano i klyan, pabanantanlmri tlyan. Ki^ci a-nigu k klgawi to koninim."1For another version see No. 6.2Ni tclmi tca, "mylittlebrothers;"in addressing the people.for nicima tug, a form used by Nanabushu
Iblreflected yonder in the water. Nanabushu then spoke up:"Why,these are the ones I will eat." Then he divedinto the water;in vain he tried to feel for them in thewater, but he could not find them. Accordingly, whenhe was out of breath, then to the surface he rose (and)came on out of the stream; whereupon the water becamesmooth (again). As he looked, why, he was bound tosee high-bush cranberries down in the water;and so whenhe again dived into the water, poor Nanabushu fell uponhis face, cutting a great gash. As hard as it was possible for him did he weep. To be sure, he was knockedout of his wits when he alighted. Now, while he wept hefelt something rubbing softly against his eyes. When heopened his eyes while crying, he was surprised to seethat he was being gently rubbed across the eyes by highbushcranberries. Ah, truly was he highly pleased. Andso he then began eating ;after he was thoroughly satisfiedwith the eating, he was truly pleased. Thereupon he wastruly able to travel comfortably.22. NANABUSHU AND THE DANCING BuLLRUSHES. 1And once, while travelling about, he heard the soundof some one whooping. Like a dunce he went to wherehe heard the sound. Lo, where out into a pond floweda brook was the place where those men were, a vastthrong of men. They were all nude, and theyall hadflowers sticking upon (their heads). Presently he was seen.Nanabushu! we expect to dance, for eight days we"Halloo,intend to dance. To be sure, we hope for a bigdance."little"Mybrothers," this is precisely what am I travellingabout for, round about am Iseeking for a place to dance.With all(my) might will I help you."
182"Nanabucu, kagu, kanabatc kiga a ya kus. Nicwasugunwlnlmitiyang, migu kaya c ,ikagabatibi k winlmi i tiyang.""Ni s tcimi s tca, mano, kaya nm nlngammrrti.""Nanabucu, anlc mano kaya kin kltanim, kwaya kigu5 kiga a-ya kus."Anic, misagu cigwa madci tanit a l; ta, cigwa pasigwiwa^.Anlc Nanabucu kaya win klpata kibina/o na Ini /u misabigunln.A ta a a i cmit nami-i ti-i iiit ! Nanabucu ketcra, rjitnanlmit, mlsa x kaya win tibicko a rntotank. Iskwatci nro gun10 nami timint imicigwa ki kandank ; aya/kusit. Aba pic nijwasugunnami timint i anicagu namadabi a; pidci aiya kusi,kaya wlwisini. Aba pic anitibi katinik, a pitci nanontayagantamtcibwawabaninig. Micigwa Nanabucu cingicinganunlmi i tit.Mindcimigo tcibltabaninig ajimawit Nanabucu.15 Apipa prrnt. Cigwasa x plwabanini, cigwaima tibickotcayar pimi-a^kwabanini. Kunigimn, kibi tanimatini. A tawa,Nanabucu/umagwa cacaganacku kank, mmangwanalnika icinank, anicinabank ugrrcinanan. Kagat mama kadantamNanabucu, mri x u *kri nandank anicinaba ka tcino-20 tingin, krrcinang; mlnangwanai u ka ijinlmi tiwat icacaganaskon.Mlsa ima cacingicing Nanabucu, kawm okacki trsitcipimotat wawicinawm tcipasigwlt. Intawa ajinibat.A plnicugun kanibat midac 4 8 i /u pitclnag kackitot pimotat,ajinatagamayotat.
1*3"Nanabushu, don tyou do it, perhaps you might growtired. For eight days we intend to clance, and alsothroughout the whole of every night do we expect todance.""Mylittle brothers, never you mind,I too will dance.""Nanabushu, naturally unconcerned about care, you tooshould dance, but certainly you will be tired."Well, so presently they began ; ah, then they rose totheir feet. Now, Nanabushu also wore large blossomsstanding upon his head (for feathers). Oh, how they whodanced did carry on ! Nanabushu was quite beside himself when he danced, for he did the same (as the others).At the end of four days dancing, he then began to realizethat he was tired. By the time they (had) danced sevendays, then it was all he could do to sit down; exceedinglytired was he, and he wanted to eat.By the time thatnight was coming on, he grew deeply worried (that hewould not survive) before it was day. So then Nanabushulay down, trying in vain to dance. Just as the dawn wasbreaking, then began Nanabushu to cry.Then was helaughed at. Presently came the morning, soon straightoverhead was how far the light of the morning hadcome. Lo, the wind died down. Why, Nanabushu wasinamong the bullrushes, that was what he really hadseen, like people they had seemed to him. Truly surprised was Nanabushu, for he thought that they werepeople when the wind was blowing hard, so it had seemedto him;as a matter of fact, he had been dancing withthe bullrushes. And so there lay Nanabushu for a longwhile, he was neither able to crawl nor even to get upon his feet.Accordingly he went to sleep. After hehad slept for two days, he then was able to crawl, hethen crawled out to the edge of the (swamp).
Acagu" 1A,"inwani.1 8423. NANABUSHU EATS THE ARTICHOKES. lNingutingigu papimotat owabandan kago saga klnig,kuma omdna a/n, kago ajimi kwani katank, kumagu a kwani.l sMidaci i :ajikanotank"Kawlninakltamagosln ? Ki n wizumina?anln i u acini kasuyag?"5 "Askibwa nintigomin."a Anm ani ka kayag klcpin nlbiwa amukoyakun?Kagonakitini kagam?""Kawinsagu; ninglciwackata i wamin, kaya dac nimpogisikagamin. Amc mlsagui u ani kagayang."10 Nanabucu oma ajimadci tat, nlbivva omona waI8i ixwaaskibwa s ; acigisibiginat, ajimadantciga, wantcitagu tawlsini.A pidci nlbiwa ka^kitamwat kudcipasigwl. Kawln kanagalminan icra*yasl, kaga t minumadci o*.Ajimadcat, kaga tminopimusa. Kumagu a l p! tagwicing kaga t kiciwackata.i5 Cigwasa a pidci kiciwackata. Ningutingigu magwa pimusatajipogitit. Kaga t kuckupagiso; ajikwa kipagisut."Awanankanocit?" Aca minawa iwiti upi kwanang. Kaga pl umitigwablnuti kwatawan.U ,kanociciyu Magwaguk."wrpimutcigat, u^pi kwanang aca minawa, "Pu 11 !" Iwitiu pi-20 kvvanang Nanabucu kawin kago owabandan zin. "Wagunandac u i nwantaman ?"minawa, mlsagu pacigwanungani tank. Kaga pl madciba to, mlgu u i ajikatapagisut,nC , pu n8 ,"Pupu Ningutingigun8 , pun81For another version see No. 12.
"Who23. NANABUSHU EATS THE ARTICHOKES. lAnd once, when he was crawling about, he saw something that grew out of the ground, accordingly he dug itup ; something he then found on digging it up, a certainlength it extended. Whereupon he then spoke to it, saying:"Areyou not eaten for food? Have you a name? Whatare you called?""Artichoke we are called.""Whatphysical effect do you produce if much of yoube eaten ? Do you cause some sort of bodilyill ?""Not at all; we produce a painin the stomach, andwe cause wind. Now, that is the bodily effect we produce."Nanabushu then here set to work, he gathered manyartichokes;when he wiped them clean with his hands,then he began eating them, till he was quite satisfied heate. When he had eaten a bountiful supply of them, hetried to rise to his feet. He was feeling very well, trulyvery well was he feeling. When he started to go, reallyhe went walking easily. After he was come a certaindistance, truly his stomach ached. Presently he had a verypainful ache in the stomach. Then by and by, whilewalking along, he broke wind. Truly was he startled withsurprise then he whirled about.spoke to me ; ?"(he said.) The same thing over again (he heard) therebehind him. Finally he strung his bow. "Now, do youspeak to me." And as he was going to shoot, then behind him once again,"Pii!" Over there at his backNanabushu saw not a thing."And what do I hear?"And the same thing over again (he heard), and it wasthe same sound that he heard. Finally he started running,whereupon at every step he made, "Pu, pu, pu, waspu,"
"Anic""i86pimipa tod kaga pi nogiba to, kibi tcisa. Nanabucu ajikikituttttA :u ,mlgaciciyu k !" kawm kago owabanda n zin.Ningutingigu mlnawa midac kaga t anigu k ajimadciba tot,misa untcita, nS "Pu, pu nt , pu n8 , pu nt ,"inwanik. Nanabucu5 kibi tcisa. Ka kibi l stcisat, mi kwantani i kl igut/uIniaskibwan. Magicananta nimpogit."Ani ajimadcat;aninomagaskatmlnawa pogiti."E 1 ,nimpogit! Misa ka/rcini-4katang pitclnag ka-a nipimadisit, nimpogit, ta i kito.Papacig tapogisi kagawan, askibwa ka kinagu kago, kaya10 u pinlg kaya wa kunag."24. NANABUSIIU AND THE WINGED STARTLERS. 1Misa 7 u iajimadcad Nanabucu papimusat , kumagu a pitakncink owabama s pina n sa s wadiswaning, a pidcigu mockinawac i i ma wasiswaning. Nanabucu udunabi tawa, a pidciucawanima c .Udagima andacinint 15midaswi; acinPjtaciwa.1 :5 Cigwadac uganona^ Anln acini ?"kasuyag/uAnic sagisiwag Igi pina n sag.Kawm ugacki toslnawa5588Anic a pidci osagima wl ka; klgitowakuckungacmsmri uajini kasoyang."1For another version see No. 5-:Anic,:tciglkitowat. Paclg glkito"Kawln niwlsuslmin."Nanabucu niskatciklgito: "Aninkaglcinagwa^ kawlsusiwag?Klcpin tibatcimusiwag acini kasuyag, kananiwa-20 niri nim."
>run""Howi8 7e sound made. And once, as he was running along, heime to a sudden halt, he ceased running. Nanabushuicn said: "Now,do you fightme!" Of course, not aling did he see. So another time, when he really startedwith all his speed, the same thing happened asefore, "Pu, pu, pu, was the sound that was made,pu,".anabushu stopped in his career. When running he had)me to a stop, he thought of what he had been told byic Artichoke. am "Perhaps I wind."breaking Then hearted on hisway when he was come a little, ways,o-ain he broke wind. Halloo, am I breaking wind ! Andlis is what he who will live in the future shall call it,am breaking wind, he will say. Various things willlake (one) windy, (such as) the artichoke and all sortsf things, and potatoesand lichens."24. NANABUSHU AND THE WINGED STARTLERS. 1Thereupon departed Nanabushu, travellingabout; whene was come a certain distance, he saw some young ruffedrouse in a nest, and veryfullthey filled the place inle nest. Nanabushu sat down beside them, very tenderras his feeling for them. He counted how many theyrere;twelve was their number. And then he spoke tohem, asking: "Bywhat name are you called?"Naturally afraid were the little ruffed grouse. Not werehey able to speak. One spoke up:"We have no name."Nanabushu spokein an angry way:or you not to have a name? If youoti are called, I will club youto death."is itpossibledo not tell me whatNaturally much did he alarm them ;after a long whilehey said: "Why, Little Frightenerailed."is the name we are
"!" inwa,"Nanabucu!"i88"O unNanabucu;i kitu i ; "mlnangwanau ajipasigwitacinisawawat acimldcinat. Panagu kawasibiltonit, Nanabucu uganona8M un:"Napisawugu kuckungacins!Nanabucu ajigitciba pra/t. "Wawani wlnda-5mawi k kimama i wa tagwicing."1Mlsagu u anlcimadcat Nanabucu i ; pacugu anitagwicing,panagu micawabaminagwatini a i cat. "Undcitamawinsaga gan i madablyan," inandam. Kaga t saga gan umadabin,a pidcisa kickabi kani. Kaga t s:i 7i inawinagvvatini /u10 nibi.Kagatsa unicicinini mri ma ugidabi A k. pidci mai iagoklckabi kanig ka rcat, aciwanlnigatanit Nanabucu ajikl-: "Agitut tiwa, ambagicsa abating, mamwa tcigu wackinlgita r kwa abating, kayaguta ta kutcingwanat, a pidcigu kayaminugit undcitamawin ninta i cikwaskun, awagwan ka i ci-;15 kwaskunigwan mra /lU ak awldigamat ikitung a i^kwa. Kwayakigu ninta/rcikwaskun." Migu mlnawa aciwanlnigatanit."Undcita ninta/rcikwa skun."Cigwadac iwiti pina upltawa^ kamidcinit unidcanisa L \ anmka i cinawat unldcanisa 1 * ! A tawa, wantagu kawusibi tonit.20 "Awanac ka inigai nak.""Nanabucu.""Kagona?"kitigowabanAnin acini kasuyag?i kito. Kuskungacins, nintinanaban,mldac l c /ui i ka icimldciclyangit. A pidac animadcat25 ki tciba pri gunan. Ninglkanonigunan dac : Wawani wln-Napisawugu kuckungacins! "Yes, you are a little frightener!"This could1have been given in other ways; as, "Like the deuce you are a little frightener!""The idea of your being a little etc.frightener!"
"""Oh,"Nanabushu said;"that is it!" Then up to hisfeet rose Nanabushu; standing over them with legs spreadapart, he eased himself upon them. (Observing) themsuddenly groping about in the slush, Nanabushu addressedthem, saying: "Yes, you are a little l!frightenerexclaimed Nanabushu, laughing heartily at them. "CorPhew!"rectly inform your mother when she arrives."And so upon his way went Nanabushu; when a littleway on his journey he was come, immediately a wideview opened out, whither he was bound. "It seems as ifout upon a lake I am coming," he thought. In truth, outupon a lake he came, and there was a very steep precipice.Truly distant was the sight of the water. Really beautifulwas it there on the summit. When he had gone overto the very edge of the cliff, then about over the vergeNanabushu swunghis leg, saying:Ah, would that therewere a wager, and that a particularly youthful womanwere up as the prize, and that she were short from theknee to the groin, and that she were of a very handsome!figure if such could be,I would jump off,if it were saidof the woman that whosoever would leap off would bethe one to have her for a wife. Actually would I jumpoff." And so again he swung his legout over the cliff."For a purpose would Ileap off."And when at yonder place the Ruffed Grouse was come,fetching home to her children some food for them to eat,how was she to find her children !Oh, they were completely submerged in it. "Who has done you the injury?""Nanabushu.""Wereyou told something?"By what are you called?1he asked.Little Frightener,we said to him, and thereupon was when we were easedupon. And when he started away, we were very muchlaughed:at. And we were toldCorrectlyinform your
damawi k kimama rwa tagwicin/Midacls /u i ika a nicimadcatajiklgitut.Napisanakuskungaclns!nintigunan."A taya, pina unawataman pacig kaya udoda pinan pacig ;acipasigirirt, saga i ganlng udiciwinan kislblginat. Misa i u5 ka iciplni a t, mlsagwa pana ka totawat pmic acim n c tacinit.Unltcanisa ka fikina ka/ijikislblginat, aba pic ka klji tat, ajikikitut:"Ambasa 7 ,ninganosuna s wa a s a /u Nanabucu, kayawin wawiyoc niwltotawa." Ajimadcat omada a nan. Ningutingigumi ma i tayoc udabi tawan madwakaglkitonit10 Nanabucowan. Tiwa, undcita guca inabit na ta i pimiwaninigatanowan.Pina inandam :xNawatc pacu anri ca."WlkagaIni/uminawa tatotam."Cigwa minawa uniniganiwan wagunanlwinanacipasiguut a pidcii i ma tclgitawak ani-i-cisawan,pamagu Nanabucu ka i nitank: "T!" 1l15 A ta, Nanabucu tabasi, a tawa ajika kabi kisat, anicagukaco kaniglni /u u ltawagan. A ta, ajipangicing nibrkang,"Tcam u/ inwawakamicin. A," ta, ki tciwi ka papimakotcingmica kisat. Midac u i kamica klsat, ki^ci a -nigu k klslntcikamlagawa mockamo, a pidci kaga waya kwanamu.20 Anic mri/>upinanamadabit kanawabamat Nanabucowan."Pina,Cigwa mockamowan, taya, mlgu iwiti :kaplnabinit klgitowan1l"I, kagatsa kuckungaci."A ta, Nanabucowan madwabalpiwan. ml gwaya k totawiyan kimldcinagwa lgi /ut ]ie jjp s ^ imitating the whir of the grouse in flight.
Nearer191mother when she arrives. And so when he was settingout, he then said: Yes, you are a little frightener! wewere told."Well, the Ruffed Grouse took up one with her mouthand another with her claws, then, flying up, to a lakeshe carried them to wash them. And when she had madethem clean, then the same thing she did to the rest untilthe twelve. When she had made(she had finished with)all her children clean, and by the time she was done withher work, then she said: "Now, then, am I going to followup Nanabushu, and I intend doing him a trick too."When she started, she followed his trail. So by and byshe came within hearing distance of Nanabushu, who stillcould be heard talking. Ah, it was precisely at the momentshe looked when he was swinging his leg out over (theprecipice). The Ruffed Grouse thought:"Would that hemight do it again!"to the place she went. Whenagain he was making ready (to swing his leg), she happened then to fly up ;ever so near past his ear she flew,and suddenly Nanabushu heard the sound of U T!"Well, Nanabushu dodged, but unfortunately over theprecipice he fell, going so fast that the wind went whistlingpast his ears. Ah, when he fell into the water, "Team"was the sound of his fall there. Oh, for a great whilewas he falling through the water. And so when he gotto the bottom, all his strength he used in pushing backup to the surface ; barely was he able to reach the surface,almost was he on the very point of losing his breath.Naturally there was the Ruffed Grouse seated watchingNanabushu. When he came to the surface, ah, then upfrom where he fell he looked, saying: "Well, (that) reallyis a little frightener." Oh, how Nanabushu could be heard"Ruffedlaughing! Grouse, it was right what you did to
"Ki"mo:kimtcanisag. Kawm wi ka mlnawa ninga*i cictcigasi.Mlsa ajra-gwa tat Nanabucu, ajinadcat papimusat.25. NANABUSHU AND THE GREAT FISHER.Ningutinggigu papimusat awlya onontawan madwanagamunit.A pidcisa uminu tawan. "Atiwa, ambagicsa wa-5 bamag awagwanlwigwanla c a /u nagamut. Ambasa, ningawikagwawabama,"inandam. Ajimadcat Nanabucu. Aba picpayacu tawat, undcitasawin kawln pacigwanung ayasltug7ani tawSt. Cigwasa pacti owabandan ki tcigami, kunigimnemiciwutclgan ayacawikwaskwaniwan u i i ki s tcigami. Midac10 i^i^1sasipuckanik 4 8 i /u ki s tcigami midac ima ayacawikwaskuninit,pa kicidac nagamowan:"Kitciganisasi pu kag,ina a-mon.Ki"tcigtimisasi pu kag,"15 Kaga t uminwaniman. "Ambagicsa kaya nm kacki toyantci i-cictcigayan. Kawln nin nintayanicfta^zl. Kawlnina,Miciwutcig, nindakacki tosln s 4 /ui itcrrcictcigayamban?""Nanabucu, mawica nimadci^tanaban i i wa untaminoyan.A u kini tam, ijictcigan.A pidci nimpa kada. A kawa20 nlwi a ntawantan I 8 /ui iwamltciyan. Kini tamidac kayayacawikwaskwan.Mlsai i11cigwa tcimadci tayan, Nanabucunjag tci-kagu x win babini tagan wa-rninan. Mlgu^i:nagamuyantcigami sasi pu kag,25 Ki tcigami sasi pu kag,tclna a man.Kicpin,
"The193me for easing upon your children. Never again will Ido so." And so when out of the water came Nanabushu,then off he started walking about.25. NANABUSHU AND THE GREAT FISHER.And once, while walking about, he heard the voice ofsome one singing. Much was he pleased with the tune(of the singer). "Ah, would that Imightsee who thesinger is I say, am I going to ! try to see (who it is),"he thought. Then off went Nanabushu. By the time hewas in close hearing distance of him, it seemed by theway he heard him that the being was not in any oneplace. When he had a near view of the sea, lo, (he saw)a great fisher l leaping back and forth across the sea.It was at the coming-togetherof the shores of the seawhere to and fro he leaped, at the same time he sang:"The shores of the sea meet together,The shores of the sea meet together,"(such) was the song he sang.Truly was he pleased with him. "Would that I mightbe able to do that too ! I would not cease. Might Inot be able, O Fisher! to do that?""Nanabushu, long ago I began this that I am playing.Very well, take your turn at doing it. Very hungry am I.In the mean while I want to look for something to eat.So take your turn at leapingacross back and forth.Therefore now you may begin, Nanabushu. Do not dootherwise than what I have told you. Therefore alwaysshould you sing:shores of the sea meet together,The shores of the sea meet together/(thus) you should sing.If1The constellation of the Great Dipper is called the "Fisher star,"and this isthe Great Fisher referred to here.13 FUEL. AMER. ETHN. SOC. VOL. VII.
Wagunaniwinan""Ki"I9 4tcigami taski kag,Ki tcigami taski kag,ina*a*man, mldac u i kanabatc klganisabawa." Misa 7 u icigwa animadcanit.5 Nanabucu ajimadcra/nk:"Kitcigami sasipu kag,Ki tcigami sasipu kag."Migu i 11 lgaga/t ajisipuskanik. A ta, kaga tsa minwantam.Mlsa x kabagicig kawln anicf tan zlacawigwaskwanit. Aba pic10 tabi katinig, mlsa 7 gu kaya kabatibi k ; wayabaninig kawlnkanaga wra nacrta n zl. Awandcis ba pinantam. Cigwa15 waskwanit,"Kitcigami taski kag,Ki tcigamitaski kag,"ina a/m. Wantagu nawagam pangicin. Anic acisikwasat.Anumockamut inabit, kawln kanaga pima4kamiga n sininik.20 Mlnawa anugwa kagumu, mlsa / undcita kawln o\vabanda n zinkifii u tcipima kamiganik. "Paba/pinisiwagan, mlsa gaga tnibuyan!"ajikaski tot tciplpagi:Miciutclg!" Anigu k plpagi.unagucinini, mlcigwa aya kusit Nanabucu. Ningutingiguoglmi kwandan l c:i i"Amantcigickawundcri^kitut, t Kagu /win ina a-ngan. Wagunaniwinan. Nanabucu ajawik-Magwagu baba tana kamigisit awiyaonontawan madwa-25 bipaginit. "Mlmawina a 11 Nanabucu," inandam. Pinicigumadwamawiwan Ini /u Nanabucowan. A ta, intawasa madcibato ki^tci a nigfu o k. Ci^wa o madabiba to Micru dclof,"fc>
"The"WonderBut195shores of the sea draw apart,The shores of the sea draw apart,you should sing, then perhaps you mightthen he departed on his way.Nanabushu then began singing :drown." And"The shores of the sea meet together,The shores of the sea meet together."Whereupon truly the shores came together. Oh, trulyhappy was he! And so throughout the day he did notcease leaping back and forth across. And when nightcame on, it was the same the whole night long; whenthe morning came, not a whit was he anxious to stop.Increasing joy he got from When it. it was growingevening, then was Nanabushu becoming weary. Then hehappened on a sudden :thought whyit is hesaid, Don tyou sing (the other !"way)Nanabushu leaped across,"The shores of the sea draw apart,The shores of the sea draw apart,"foolishly, ashe thus sang. And in the very centre of the sea hefell. So down (out of sight) he fell. When on comingup to the surface he tried to look about, there was nota single bit of shore-line to be seen. Again he vainlytried turning the other way, but, just as before, he didnot see the shore-line. "Woe is me, for now surely Ishall die!" In distress he called out as loud as he could:"O Great Fisher!" with a loud voice he called.Now, while (the Fisher) was roaming about, he heardthe voice of some one calling aloud. "That must beNanabushu," he thought. Then presently (he heard) thevoice of Nanabushu crying. Ah, accordingly then hestarted running at full speed. Wrhen the Great Fishercame running out upon (the sea), why, there was Nana-
!"anic,196a c tawa, Nanabucowan nanawiki 8 tciami madwamawiwan.o"Cici,indacka mrr u anugrirndcibwamit a 8 a /u Nanabucu."Anic pisanigu madcra/m Mlcru dcig. Ajikwaskwanit misaundcita aci a yanik sipuskanik.Mlsa cio^wa Nanabucu kPa o-wa tat. Kaga t minwantamO O ONanabucu. "A a ,Mlci irdclg, kaga tinangwana kimanidowi .Magica nlna ta nimanidowi nintinantanaban. Intawasa 7 kinkigazazrkis. Mlsa x Iajimadcra cagamatl c /ui i8 /ui i ka i cinaganinan,"Nanabucuki tcigami.26. NANABUSHU AND WINDIGO.10 Ningutingigu papimacagamat Inabit iwiti agamikistcigamiawiya owabaman 4 8 i /u pimacagamanit, a pidcisa minditowan.Kawln kanaga a konlngitawitiyanit a kosislwan4 8 i /u mi tigo8.Anic, mlwanini 11 Windigo. Wagunaniwinan:upipagiman "Nicimisa, watcaka-a a-nowan kamamldcita-115 man! Pamacagamayan, woi nama wasa inantamNanabucu.A pidcidac unickimigon Windigo Nanabucowan."Kagatmama katc. Kuniga, Nlna ta nimanitowi, inanamutug aV11Nanabucu. Ambasano, ningaglwi tagamabato."Kaga t20 madciba to Windigo, ki tciwlba udddi tan ima pimacagamanit mi /u Nanabucowan. Wagunaniwinan acitcangitiya-
Well,"Oi 9 7bushu to be heard crying exceedingly far out on the water."There, that is on account of Nanabushu s failing to heed(my words)."So then softly beganthe Great Fisher tosing.When over he leaped, then back, as it did before,came (the shores of the sea) together.Thereuponthen Nanabushu came out of the water.Truly pleased was Nanabushu. "Ah, Great Fisher! reallyindeed you are a manitou. That perhaps I was the onlymanitou, was the Ithought entertained heretofore. AccordTherefore shall I nowingly you are to be older 1(than I).leave you."Nanabushu then went his way alongof thesea.the shore26. NANABUSHU AND WINDIGO.And once, while walking along the shore (and) lookingtowards the other side of the sea, he saw one passingalong the coast, tremendously huge was the being. Nowhere near to his buttocks were the trees in their height.Well, of course it was Wlndigo. Like a fool he calledaloud to him :my younger brother !upon the dry tailof a beaver did you ease yourself. You passer along theshore, halloo !"at a safe distance away Nanabushuthought (he was).Now, very angry was Wlndigo made by Nanabushu."Itisreally absurd. PerhapsI am the only manitouI will runexisting, may be Nanabushu s thought. Well,round (to where he is), keeping to the shore." Truly offwent running Wlndigo,in a verylittle while he arrivedat the place where Nanabushu was coming along theshore. What did Wlndigo do but get down and lay withhis bottom up. It was but a short while when up came1The passageis given literally.The sense is, "being older, you are a greatermanitou than I."
"198cing l a E a /u Wlndigo. Nagatcigu cigwa pagamacagamawanNanabucowan. Cigwa owabamigon ;anm ga icinang awiyakltcangitiyacinon. Mlgu iu anawri cigaso tawat omadwakanonigonNanabuco: "Ondas, a kawa, ninganawatcln l s /u i i5 klya /u .Wawip,ontas."A tawa, Nanabucu anigagimota tamo anin^zi kawat.Cigwa ima ododisan ; kagatsa mangitcitlwan, micicagu l L /ui ioda i ni. :Uganonigon "Nanabucu, manisan. Ninga a -kawa-a-bwanl s /ui iklya /u ."10 Kaga t ajigu plt Nanabucu manisat. A tawa, mojagmawi. Cigwasa nlbiwa ka/ir kwa kwisi tod ini /u misan,uganonigon:a Mri>uicibodawan."Nanabucu ajibodawat. Ka podawat uganonigon:"Na/>unabucu, mri ici a ntawabantan i^ wa kawatabwana kuyan15 l s /u i iklyawic. A pidci wana kwa k, magica tagita kwitini^i 11 kiwisancis."Kaga t animadca Nanabucu. Anlc mocag mawi, a pltcisagisit.A pidcigu i^^wa wayanina kwatinik i^i wa mi tigumi kan, kayai u sasagati kwaniwaninik. Ajimadcat icatW120 acimlnat;o o* udinan : "Tawa t,tawa t,tawa A t rnditcin!laV uNanabuco."Kawminawm tagita kwitin iwa kiwlsancic?mi tignandawaba n dan, wana kwak."Ba kanag iwaA tawa Nanabucu. Midac gagat animawit, pmicigu25 wasa anitagucin. Pamagu anrrnabit, ta tiwa, cingusanklbimiba towan ajiganonat:Nistclmi s tca,mnip nongum."1Tawa t,tawa c t, t.awa c t !"Oh, oh, oh!" a masculine exclamation denoting anger,often applied angrily to dogs when in the way or when disobedient.
i9 9Nanabushu to where he was on the shore. Then (byNanabushu) was he observed what was he to see but;somebody lying with bottom pointing up. Accordingly,when he made an attempt to hide from him, Nanabushuheard (Wlndigo) saying to him: "Come hither, wait, Iwant to make a small meal out of you. Make haste, come!"Alas ! Nanabushu began weeping silentlyon hiswayhe came to whereover to where (Wlndigo) was. Presently(Wlndigo) was ; truly big was his anus, and in plain viewwas his heart. By him was he addressed, saying: "Nanabushu, go gather some fire-wood. I will first roast your body."Truly then up from the shore went Nanabushu to gatherfire-wood. Poor fellow! all the while was he crying. Afterhe had piled up much fire-wood, he was addressed: "Now,do you kindle a fire."Nanabushu then kindled the fire. After he had kindledthe fire, he was addressed: "Nanabushu, now go youhence to seek for something which I can use for a spitto roast your old body on. (Let it be) very straight, elseperhaps your old spleen might be forced out."Truly away went Nanabushu. Now, all the time washe weeping, he was so scared. So a stick with a verybig curve he found, and it had many twigs. Then hestarted going over to give it to (Wlndigo);this he said tohim: "Oh, oh, l Such was the way Nanabushu acted.oh!""Would not your old spleen be forced out by that?For a different one do you seek, one that is straight."Hapless Nanabushu !Thereupon truly off he wentcrying, (going) till he a long wayoff was come. Andsuddenly, while looking about as he went, why, here wasa Weasel whom he addressed as it went running past:"Mylittle brother, I am now goingto die."
"2OOKibi tcisawan ini /u cingusan. Ota taganabamigon ajiganonigut:"Nanabucu, wagunac wa/u-ndcinibuyan?""Atawa, migimnri 7 11wra^kawinawatclt wa c a /u WindigolB /ui imya /u . Kawminakitanisasi?" : "Nama-Ajiganonigut5 dapinagu laV u Windigo?""Kawm, tcangitiyacin, micicago iwa utclt, kaya l iv:i /uuta."Nanabucu, mmotcisa ningawikagwanisa. Maskwatidac win klgapagusanimin kago. Intawa dac kicpin kagototawisiwankawm nintanisasi."10 Klgitowan Nanabucowan :"Maskwat kicpin nisat, tcipi-l si icagantaman/u klya /u klga i ci-i-n." Ajikanonint Nanabucoa/>u: Mri icipindomun ^iYwa. niyawic."lA taya, kagat minwantam Nanabucu. Pi /u abwana k( }wanicicininik i lwa mi tig antawabandank, kaya a pidci1c5 wana kwutinig ;mldac /u i i ka/klcka arnk. Aniji madcitot,kayabi kltcangitiyacinon miwa Wlndigon. Uganonan:"O o wa udabwana kun." Mldac ima ajigitcibagwltIni /ucingusan, panagu ani irtanawasanit. "A tawa, ambasanoklni tam kiga irji toniyabwana k."20"Kawm," udigon mi/u Wlndigon: "kinigu uji ton."Nanabucu udoda pinan iiwa mi tig ; pitclnagigu watapinanguganonigon "Kawasa, Nanabucu, ningi tcisasa-:gita a*. Nintigwa awiya uwipa kandan wa i^ ninta i a-yap."Nanabucu uganonan: "Kacitina unaka kirirtcin. Wa-25 wlpigu apwan u i nlya /u . Kama gaya wlsasa ku kwatamaniwa mya /u ."
"And2OIIn its flight stopped the Weasel. By it was he gazedup at when by it he was addressed: "Nanabushu, whyare you going to die?""Alas! because a light meal does that Wlndigo intendto make of my body. Could you not kill him?" Thenhe was addressed by it :issaying the Wlndigosittingdown ?""No,he lies with bottom pointing upward, and in fullview is his anus, likewise his heart.""Nanabushu, nevertheless I will try to slay him. Andas a reward for myself I shall expect some kind of blessingfrom you. So, therefore, ifyou fail to do something forme, I would not kill him."Up spoke Nanabushu: "As your reward for killing him,I will make you proud of yourself."Then was Nanabushutold: "Therefore do you put me in the bosom of yourgarment."Ah, truly pleased was Nanabushu. The roasting-spitwhich he sought to find was of excellent wood and verythat was what he had cut. When he wentstraight ; andthither taking it to him, still yet was Wlndigo lying withbottom pointing up. He spoke to him, saying:"Here isyour Then it was that hespit." pulled the Weasel forthfrom the bosom of his garment, and away whirled its tailas it flew in."Oh,well! then do you take a turn atmaking aroasting-spit.""No,"he was told by Wlndigo: "do you make it."Nanabushu took up the stick ;as soon as he pickeditup, he was addressed by the other saying: "Impossible,Nanabushu, my heart beats with greatfear. It seems asifsomething is about to bite off the cord of my heart."Nanabushu addressed him, saying:"Make haste andimpale me upon (the spit)!Hurryand roast my body!Or, if you wish, you may fry my body."
inabitMinawa klgitowan:UE[knca. Ml guca kagat H/>u202, kawasa, Nanabucu! kawasawiwanantaman."Nanabucu oma udaniga kikabiwi tawan. "Ocrcr, kacitinaunaka kirirtcin !"Nanabucu, acikawa kwitiya-5 sanit ; mlsagu 4 8 /ui ikaga t kra ninibunit. Kanibunit pi irndcisagitcisawancingusan.a pidci ka-i cimamoyawakantamogubananIntawasa 7 ? ."ningawawaci-a Nanabucuudoda pinan aciglslblga wat. A pidcisa ka plnabawanat,TO wagunaniwinan wapapiganan unatawabaman. Kami kawat"Atawa, nicimisa !amantcigicnawatc utcagiswan mi /u wababiganan. A pidci ka ijiwabickisinitka klci a t, mldac I 8 /u i i misiwa aciwawacra t cingusan wana;kagwatciba ton."kwano uma katawanawanan."Ningataga15 Kaga t cingus kagwatciba A to. tiwa, kaga t piciganimu.Nanabucu uganonan: "Mi saguna iu acimamoyawaminan.Ninibunaban cingus. Mldac u ika-i-cinagusiyan papongina ta. Mldac/u i mini k ka/a- klwank ka icinagusiyan.; j:iAmbadac kaba kawmin." Nanabucu ajimadclyacagamat20 I 8 /ui iki tcigami.27. NANABUSHU COMFORTS HTS GRANDMOTHER.Ningutingsa anipapimosat cigwasa udababandan o kumisankapi u-ntcikana pan. Kagatkayabi kra- tani utclmanini.Kaga^tsa minwantam Nanabuc ctayoc /ui ipimadisinit.Anigu plta i tag madwamawiwan :madwa-"Nojis!"
203Again he spoke: "Oh, impossible, Nanabushu! Impossibleindeed, I am now growing unconscious."really Perhaps, !Nanabushu then went up close and stood beside him."Oh,do hurry and impale me upon (the spit)!"-WhileNanabushu looked on, then down to the ground fell(Wlndigo) with his bottom ; thereupon truly was he dying.When he was dead, then out from thence came the Weaselrunning."How now, my little brother! Wonder what (I can do)so that he may be very thankful ! Thereforethen will Ipaint Nanabushu took him him." up (and) then washedhim in water. After he had made him thoroughly clean,what should he do but seek for white clay. After hehad found it, whiter still he burned the white clay. Afterit was made exceedingly white, then he had itfinished,the Weasel at the end ofwhereupon all over he painted ;the tail he paintedit black.how yourun."uNow, just you tryand seeTo be sure, the Weasel started running. Oh, how reallyproud he was! Nanabushu spoke to him, saying: "Therefore in this manner do I render thanks to you.I wasdying at the time, Weasel. And that is the way you shalllook onlyin the winter-time. And as long as the worldlasts, this is the way you shall look. Therefore I nowtake leave of you."Nanabushu then departed, keepingalongthe shore of the sea.27. NANABUSHU COMFORTS HIS GRANDMOTHER.Once, while travelling along, he came in sight of wherehe had left his grandmother. To be sure, there still washer canoe. Truly pleased was Nanabushu that she wasstill alive. When he went up from the shore, at thatmoment he caught the sound of her voice crying:"O
"20 4rnatamowan. Anida pabit Wwa andansiwit, kunigimn,kicingicinon, ami kwan kigicinon. Nanabucu ajikanonat:"Noko, nintagwicin.Ka^kwabatawanga/rganit5 toni. "Cicl,matci a !nimog NinglgagwanisaganimagmatciwabicaclwicagI 8 /u utami^kwanini i iupra pagi-lgi /uwlnanapagansumiwat."Ajikanonat mlnawa: "No ko, kaga t kuca nintagwicin."Nanabucu oma ani i-jipmdigat ;udani u di tinan. "Noko,kaga t kucagu nintagwicin." Wagunanlwinan wawanigu10 udabi totclnan, a^pidcigu wlnisiwan, kaya ima usklciguninkmi tawangowiwan. Midac ajisagisi a t Nanabucu o kumisan,agaming ijiwinat."Noko, intawa misawa kabingwacagitobinin."Kaga^ wawmga ugi tcikunaya a n ;acikislyabawanat,a pidcigu upini a n. Ka pmi a t aji ijat iintat.15 Ka kina uckra yiTn ublsi konan. "No ko, />umri iciklwataima antansiyang."Mlsa x katagwicinuwat andawat uganonigono kumisan :"Nocis, kawln win nimpa kadasi. Magakuckwamagpajik nanta wabantcikan, ml i ma 11 tcimi kamanwanicicingwlsiniwin."20 Nanabucu ugalkikipitonanin ka*i*cinank picicigIi5:l is;/uimaga kuckwamag.i /u pimita kaya wlyas!A tiwa,"Noko,kaga tigu klgaminowlsinimin."Nanabucu mlsana u ipitclnagminowlsinit.
205my dear grandchild!"was the sound of her voice crying.When he went up (and) peeped into her little dwelling,lo, there she lay, by a spoon she lay. Nanabushu thenaddressed her, saying:"O Imy grandmother! am come."Dipping up some ashes with her spoon, she threwthem toward (the speaker). "Begone, vile creature! Ithoroughly loathe those wicked martins that wish tosadden me."Then he spoke to her again, saying:uMy grandmother,in reality have I come." Nanabushu at that moment wenton in he went over and took hold of her.; "My grandmother, in reality have At I come." last he put his armstenderly around her waist, and she was very unclean, andthere in her eyes was sand. Thereupon out of doorsNanabushu took his grandmother, to the shore was wherehe took her."My grandmother, therefore entirelyof allyour clothes will I strip you." Really of every singlepiece of clothing he stripped her then ; by washing hemade her clean, and very clean he made her. After hehad made her clean, then he went home. With clothesall new he dressed her."My grandmother, now let uswhere we dwell." And so whenreturn to the little placethey were come at their home, he was addressed by hisgrandmother, saying: "My grandchild, I am not hungrymyself. In one of the birch-bark boxes do you search,for there will you find some food that is nice."Nanabushu ripped open the birch-bark box. My! whatshould he behold but a vast store of grease and meat!"My grandmother, in truth, shall we be well supplied withfood." Nanabushu then for the first time in a long whileate a hearty meal.
"Cigwa2C>6"A28. NANABUSHU SWALLOWED BY THE STURGEON. TMisaajitibi katinik ; weyabaninig ayabi andansiwiwat.Aba pic nawa kwanig uganonan o kumisan : "Noko, kanabatcningacacigatab. Kawlnina wawabanaban kitayasln?""Nojis, kaga t nintaiyan."5 A taya, kagat minwantam Nanabucu.a lNo ko,ambasaniwlwawabanabl. Intawa u i kitclman ningayabatciton."Nanabucu ajiposit micawagam A aji cat. i pidci micawagamka tagwicing, anlc ki st 7"Mlsatcigami, oma kadacigwagwaskwapitcigayan,"i kido. Nanabucu ubona katdn10 4 i /u umlgiskan ;kamicaklsanik madcra m :"Micmamiigwa, pinawil kuntci a n i ku kaya 11 .Micmamagwa, pinawa kuntci a n i ku caya"."Midac i i ma na itag ayat as a /u miclnamagwa. Mamwatcidacima unowangiganig mlsa ima siniguskagut.15 ingutci anu i ca, mlsa 7 untcita 4 8 i /u siniguskagut i smigiskan.Kaga pisa oganonan adi kamagwan:2"Adii /nKaga pikamag,ambasano, nawatantarna /u Nanabucu iwa wawabanaban."Kaga t acinawatatank l fi/u i i uwawabanabanini. Ki tciwlckaniowawabanaban.W11Ajiwrkubidot, ta, mlsa20 mlsa x mlsa 7 wa l !", tiyan omo kibinan adi kamagwan.3"Isa,kawin kin kinantawanimisinon ! Klwinantanwawabanaban.1For other versions see Nos. 7, 29, 61.2 Adi kamagwan, "white fish;" literally,"caribou fish."
"20728. NANABUSHU SWALLOWED BY THE STURGEON. 1And then night came on; on the morrow he remainedidle at their little home. And when it came noon, hespoke to his u:grandmother, saying My grandmother, perhaps I shall grow weary with being idle. Have you nota hook and line?""My grandchild, to be sure,I have one."Oh, truly pleased was Nanabushu."My grandmother,therefore do I wish to fish with hook and line.Accordinglyyour canoe will I use." When Nanabushu got into (thecanoe), then out to sea he put. When very far out onthe water he was come, for it was the sea, Here is whereI will fish with my hook and line,"he said. Nanabushucast his hook into the water;when it touched the floor(of the sea), he began singing:"O !big sturgeon comeswallow me, here is my decoy.O big sturgeon! come swallow me, here is my decoy."And so at that very place the big sturgeon happenedto be. And it was there that he felt a rubbing on thecheeks (by the hook). At last away he tried in vain togo, but exactly as before he felt the rubbing of the hook.Then he finally spoke to the Whitefish, 2 "Osaying: Whitefish!please seize that bobbing (hook) of Nanabushu s withyourmouth."Truly then it seized that bobbing (hook)with its mouth.There was a hard pull on the bobbing (hook). When hepulled on it, "Ah, that s it, that s it, that s what I want!"Presently he drew the Whitefish to the surface of thewater. "Bah! 3 I don t want you. You befoul the bobbing(hook)."3 Isa,"Bah!" an exclamation of reproach 5with most Ojibwaonly by the feminine sex.dialects it is uttered
208Kaga t intawa cupagidandan /u i i wawabanaban. Intawaajiklwat adi kamag. Cigwa anitagwicin. Micinamagwanajikakwatcimigut:"Anintac a kitut?""Ka,^Kiwmantan i u wawabanaban,i kito Nanabucuta ninantawanima."5 Miclnamagwa yaMisa keyabi onowangikanig sinigwisanig i^Va uwawabanabanini.A pidcisa umiguckatantan miclnamagwa."Tagfa, kin, namao^us, awinawatantan."o" *o ...Tokisani i u wawabanaban. Ajiwfkubitot Nanabucu10 uwawabanaban, mlsa 7 nasao a kitut :"Misa wa tiyan."Omo kibanan !ni /u namagusan. "Isa,kawln km kinantawanimisinon! Kiwinantanc /u i iniwawabanaban."Minawa ubagitantan namagus. Ajimadcat-,tagwicinguclogimaman uganonigon."Amc a kitut?"15 "Kawln kuca km kinantawanirnisinon. Micinamagwayata ninantawanima."Misa 4 /u ingutci aji cat miclnamagwa. Kawasa i ugackitoslnpa kan tciwawabanabinit. uAcimadcisawma-a^ Na11nabucu! Mini k ningitacl kag wmickri t !" Nanabucdwan20 unawatantamawan isiwa uwiiwabanabanini.Nanabucu migu i u ajiki tciwibitot i fii /u wawabanaban.Inabit micawao;am, o minisans inantam wandcimo kibinik.Mlnangwana iu ucigwanani !ni /u miclnamagwan. Cigwasaningutingigu panagu kasaswanik u tawagan. Minangwana25 u ckogamigut mlgu ui i ikigitciman. Mlsagu a pan aciwanantank;wl l kasa mi kawi. Ma kawit,"Waginuganing nintaiya,"inantam. Inabit, icpiming ki tcimaskimut agotanik ;
""2OQTruly, therefore, (the Whitefish) let gofrom his mouththe bobbing (hook). And so back home went the Whitefish.Soon he came home. By the big Sturgeonasked: "And what did he say?"lwas he"Oh, you befoul the bobbing (hook), said Nanabushu.lt is the big o Sturgeon oI want.And so once more against his cheeks rubbed the bobbing (hook). Very much was the big Sturgeon annoyed:"Isay, you, Trout, go seize it with your mouth."There was a gentle pull on the bobbing (hook). Ason his bobbing (hook) Nanabushu pulled, so the samething as before he said: "This is what I want." Out ofthe water he pulled the Trout.you are not theBah !one I want. You befoul my bobbing (hook)."The Trout was the next to letgo from his mouth thebobbing (hook). Then he departed when he; got home,by his chief was he asked: "What did he say?""You are not the one Ireally want. It is only thebig Sturgeon I wish."Thereupon away went the big Sturgeon. He found itimpossible to make (Nanabushu)fish elsewhere with hishook and line. "Confound that Nanabushu! He has beenpestering me so long as to me!"anger He then seizedhold of Nanabushu s bobbing (hook) with his mouth.Nanabushu thereupon held tight to the bobbing (hook).As he looked out over the broad sea, an island he thoughtwas appearing on the surface of the water. But ithappened to be the tail of the big Sturgeon. Then of a suddenthere was a continuous ringing in his ears. Ithappenedthat he was being taken down into the water togetherwith his canoe. And so straightway he lost his wits;after a long while he came to. When he was revived,"In a circular place amI,"hethought. While lookingaround, up overhead a huge bag was hanging ; ithap-14 PUBL. AMER. ETHN. SOC. VOL. VII.
inantamc> c>2 IOmimigu i u acimamasi kanik. Mlnawa iwiti inabit wa kwayalawiya owabaman tacika kawatabinit. Acipasigwlt Nanabucu; aciwanabi tawat, ajikanonat: "A tawa niclmisa,anlndac acra*yayan?":5 Agawagu pimadisiwan. Cigwa kigitowan mlsa kaya km kf kuni k a s a /u micinamagwa.""Nanabucu,"Abapinisiwagan!"Nanabucu. "Ambasano,wlndamawicin anti ka tacigunik.""Kawlnmac; iwitinawaya kwucink cingwak mri witi10 ayawat igi /u 1wacackwatowag midac iwiti;anantawayamban ;piniwapamagwa Igi /u wacackwatowag, nibl kangidac pangicinogIgi /u ucackwatowag mldac 4 8 /u i; natagwana-o nagitwamidac ima klnawatamit micinamagwa. Nanabucu, ambasa7 ,kigawlndamon. Mlginini u oda c i kayagotanig. Am-815 basano, kicpin ayawanan /u i i mo koman,Nanabucu dac udaiyan u i mo kuman. Wagunamwinanka a mawat.pang! ajitca:Madwagigitowan micinamagwan"Kaga tnisasagita a ."Nawatcidac anigu k ubaciba a-mawan I 8 /u i i uda*i-ni.20 Mlnawa madwa^io-itowan: "Ka^a tO nimani 4 kag a^a /u<^>Nanabucu Madwakanonimawan :krkunag."kldawlskiwigusl wa s a /u Nanabucu. KagaNanabucu.""Kawasa,t matcri ciwabisiWagunamwinan ajibabacipa-a-mawatl s /u i i uda i ni.Wacackwatowag,"cones;"it is also the name of the leathery hard shell-like
2 I Ipened to be in motion. Again while looking yonder atthe other end he saw some sort of a creature seated,swinging back and forth. Then up rose Nanabushu tohis feet ; taking his seat beside him, he then addressedhim, saying: "My poor little brother, and what is thematter with you?"And barely alive was the other. Presently he said :"Nanabushu, and so you too have been swallowed by theBigSturgeon.""(Thatis)me where itdreadful!"thoughtwas you were swallowed."Nanabushu. "Please tell"Oh, it was over yonder; where a pine hangs out overlthe water is a place where there are some cones;it wasthere Iclimbed, searching for them I bit off the;cones,letting them fall, and into the water they dropped ;andso when we were hauling them ashore by canoe was thetime that the Big Sturgeon seized me with his mouth.Nanabushu, come,I will give you some information.Behold, that is his heart which hangs from up there !Please, if you have a knife, do pierceit."Now, Nanabushu possessed a knife. And so what didhe do but give the heart a gentle prick.Then was heard the voice of the Big Sturgeon saying:"Really,I am afraid inmy heart."So harder still(Nanabushu) piercedhis heart.Again was heard the voice of him, saying: in"Trulydiscomfort am I for having swallowed Nanabushu." Thenwas heard the voice of some one addressing him: "Why,you would not be free of harm from Nanabushu. Trulya baneful beingis Nanabushu."What should he do but stab away upon the (Big Sturgeon s)heart.fungi found on various trees, the poplar in particular; it maymeant here.be that is what is
"2 12Anigu k madwagigitdwa s s: "A,pana kinibut kitogimaminanAmc kagitotawank! ? Madclnacina takackratcipimadisit. Intawasagu manu mri* 11ka/rcraryaguntcing."Kumagu ya piaji a boskantcisat.5Anlc ml cigwa krki kanimat Nanabucu kra bockantcisanit,ajiganonat wadabimadcin. Anlc adcitamon Ini /uwadabimat, miwanini 11 kaya win ka l kunigogubananlni/umicinamagwan a c a /u adcitamo. Mldac a l p! ajikigitutNanabucu:uAmbasano rrma no kumis utagamlming10 tawri-ci a gwaiya a-gu wa s a /u micmamagwa ; ningaki tciminwantam."Mlsa 7 gaga t na i tag 4 e ima aci a-gwaiya a gunlt. Ningutingigua l pidci mamatcisawag. Mlmawlni u iklmicagamayau udinan lni /u adcitamon. mri /0U ka i cigut,""Taga,15 bagutcinag."Anlc anawigu kinwabi katini i i wa omo kuman.Nanabucu ajimadicwat, ki tciwl ka ubagunacwan.Aba pic bagunacwat oganonan adcitamon: u lA a u adci,tamo,saga a n."Kaga l tajisaga-a nk l a s a /u adcitamo, kaya win Nanabucu20 ajisaga arnk. Kasaga a nk, utciman usagisi ton. Mlsacigwa anici kupit, ajiplndigawat o kumisan. A pl ka 4 plndigawatini /u o kumisan, ajikanonat: "No ko, mlsa x u iklnisagla e a /u miclnamagwa. Ambasagu awimadcinama kan.""Nojic,kawin kanabatc kitanisasl l a e a /u micinamagwa."25"Kawin kuca anica klwri nisinon. Naska kuca naziblta,mri ma tciwabamat."
"My21 3Loud sounded the voices of them, saying: "Yea, goneis our chief now dead ! What can we do for him ? It isdifficult to be able to bring him back to life. So therefore he may just as well be left to drift uponthe water."It was some time before (the Big Sturgeon) came upto the surface of the water.Well, now, when Nanabushu learned that (the Sturgeon)was come up to the surface of the water, then he spoketo the one by whom he sat. Now, it was the Squirrelby whom he sat, for it was the Squirrel that had beenswallowed too by the Big Sturgeon. And so then Nanabushu said: "Pray, yonder to my grandmother s landingplacelet the Big Sturgeon drift; I shall be greatly pleased."And so truly that was precisely the place where itdrifted ashore. And by and by they were much shaken"It isup. possible that he has drifted ashore,"he saidto the Squirrel. "Now, therefore, will I open him at theOf course ratherbelly." long was that knife of his.When Nanabushu was cutting him with the knife, he wasa long time cutting a hole through the body. By thetime he had made a hole through him with a knife, headdressed the Squirrel, saying: "Now, Squirrel, do yougooutside."To be sure, then out went the Squirrel, and Nanabushutoo went outside. When he had gone out, he then tookout his canoe. And so when on up from the shore hewent, he entered into where his grandmother was. Afterhe had gone into where his grandmother was, he thenspoke to her :grandmother, now have I slain theBig Sturgeon. So please do you go dress the Sturgeon.""My grandson, you could not possibly slay the Big,Sturgeon."not a whit am I"Why, deceiving you. Just let us godown to the water, and there shall you see him."
"A2I 4Kaga/t a s a /u mindimoya ajinaziblt, a c taiya, ki tcigigon yan."Noko, misa wa 8 a /u kanama/kanat.""Mri />u , nojis ka/rcinama/kanag."29. NANABUSHU, THE SWEET-BRIER BERRIES, AND THESTURGEONS. 15 Weyabaninik ajimadcat Nanabucu, saga-i ganmg ododisa4 c /u i anicinaba 8 ; kuniginln, ininiwan kaya wlwini nlciwa 8;kwlwisansa 8 ,umdcanisini. Pajikidac pakan i kwawan ningutciima tawan, a pidcisa usagri gonIni /u ininiwan."Kaga tsa, Nanabucu, ambasa, wlwin ima a u i kwa."10"Niclmisa, kawasa ninta icictcigasl.Kawm potc kabayaTnintawlwislnan klcpin wlwiyan."lni /u"Nanabucu, manogu,tabwa tawicin."u misa u i tabwa tonan." Misa x ,kaga t widigamatli kwawan.1 5 Amc, mri/>ucigwa anitagwagininig ; kayadac papa kantawag, anlc mamawadisitiwag Ini /u ininiwan. "Misacigwa8 ntcimadci taiyanki iwa tcinotcigl go n Anlc iwayank." kagatajinotcigi n go n: iwawat, adi kamagwa 8 ki tcinlbiwa unisawa 8 .Anlc adcidagona ku kawag. A pidcisa nlbiwa unisawa 8 .20 Ningutingigu acikackatininig Wma andacikl n go n i*kawat;misa pan kikackatininigs /u i isaga i gan. Abapic kakacka-"itininig, Ambasano," kito Nanabucu: "intawana klni tamawakiga*a mwananig Igiwa kldatcitagotakaniminanig."
215Sure enough, when the old woman went down to thewater, why, (there was) a great fish."My grandmother, this is the sturgeon which you aretodress.""Very well, my grandson, then will I dress the sturgeon."29. NANABUSHU, THE SWEET-BRIER BERRIES, AND THESTURGEONS. 1When the morrow came, then off started Nanabushu at;a lake he came upon some people ; lo, there was a manand his wife; there were two boys,their children. Andthere was one other woman who lived in another place,very much was she loved by the man. be "To sure,Nanabushu, come, do you take to wife the woman yonder."little brother, I could not possibly do it. Not"Myeven for a brief periodwife if I should marry her."of time could I have her for a"Nanabushu, never you mind, but do as I tell you.""Very well, then will I do as you say." Thereuponhe married the woman.Well, it was now getting well on into the autumn and;truly(Nanabushu and his wife) lived apart from (the otherfamily), but theyvisited back and forth with the man. "Itis now time for us to set to work gettingfish."Now, tobe sure, when they went to get fish, whitefish in greatplenty they killed. Now they made a rack to hang themwith head down. Ever so many they killed. And oncethe place froze up where they were fishing; accordinglyall frozen up was the lake. Seeing that it was frozen,"Come,"said "onNanabushu; that account let us firsteat up those (fishes) of yours which we have hung upwithhead down."1For other versions see Nos. 7 (p. 49), 28 (p. 207), 61 (p. 467).
2l6Anlc, mlgu iu gaga t acictcigawat. Kumagu a pitcibiboninigajigitamawat, mldac a l ta wlnawa ug!ngo n *i miwa.Cigwasa madca Ia 8 a /u Inini; anitagwicing wanagucininig ;a tawa, kuniginln ka u ndcikusinigwan. Mldac awininiS acio^anonat Ini /u wlwan : "Mlmawini u i kanabatc tcikitcinon-J otayabaniciyang. Intawasa mlnotcningaklyusa."Anlckaga t ajiklyusat, kawinsa kago uni tosln. Kaga t sanagatini;wl ka ku pajik pinawan uplnan. Kaga plgu pa kadawag.Ningutingigu kawm kanaga oplnasln Ini /u pinawan.10 Misa 7 gaga t ajipa kadawat. Intawadac ugini 8 unantunawawan.Mlsana 4 8 i /u ugini 8 ajiamwawat, wankitci cigukawanantamog.Ningutingidac minawa ajimadcat papanandawlginiwata pidcigu kisinani kayadacigu grkatci. Saga i ganing aji-15 madablt. Mldac ima anasama tawaninig anrijat a pidciguumi kawa 8 l s /ui iugini 9 . Amc papagiwayanackimutacingudaniblnawa n8 .Ningutingigu anipimacagamat, pamagu kagonwantank madwasininig ima mi kwamlng. Aji nabit ikagok ra tani. Wagunamwinan nimina ku na n zi kank ; ; payacwa-20 bandank, kuniginln pikwa k ma ku tawagan asawawink !Aji O doda pinank wlwawanbandank, pamagu awiya wand-: "Tawacikanonigut t,tawa t ! Klnina klpi kwa k wata pinaman?"Ajikanonat: "Kawm, anicagu niwlwabandan." Papa kiwis25 ajikanonigut : "Kigikatc mawln."
Well, that was what they truly did. And later in thewinter when they ate them all up, there still remainedthe fish (of Nanabushu and his wife).Then off went theman he arrived at where he went l in the ;evening alas ; !he found that they must have moved camp. Thereuponthe man spoke to his wife, saying:"There is a doubtfulchance if we shall be able to live through the winter.Therefore on that account I will hunt for game."Sotruly off on a hunt he went, but he could not kill anything.To be sure,it was a trying time;once in a long whilehe fetched home only a single ruffed grouse. And at lastthey were in want of food. Then by and by not evena single ruffed grouse did he bring home. Thereuponthey were truly hungry. So on that account for sweetbrierberries they went to seek. Although theyhad sweetbrierberries to eat, yet by degrees were they starving.And another time when he set out to seek for sweetbrierberries, the weather was very cold and he wasshivering. Out upon a lake he came. And so when hewent along yonder sunny side, in abundance he found thesweet-brier berries. Now, into a miserable cloth bag heput them. And by and by, while going along the shore,he suddenly heard the sound of something fall yonder onthe ice. When he looked, something was there. Thereupon he went out upon the ice, going up to where itwas when he; got a near view of it, lo, (it was) an arrowfeathered with the ear of a bear! As he started to pick(the arrow) up to examine it, all at once by some onethere was he addressed: "Hold,hold! Is the arrow yoursthat you are picking up?"Then he spoke to the being: "No,Ionlywanted tolook at it." Pilferer then was addressed: "You are cold,nodoubt?"1At the place where he and Nanabushu had been in camp together.
"A!"udigon218"Kaga tningfkatc.""Taga, kabotawanin, intigu kigfkatc." Kaga t nadagakowanpodawawan. Kaki tcibotawanit, aTta ickutangcingobln uda paginani ; kayadac gagltciwan madwaglgito-5 wan: "Ba kiwis, kawmina kitamldcisman !ni /u nintaciganan?"u,ningamidcinan." Opi a cawagamawapina magon.Ajiwabandank, kunigimn, kaskami kwanowan ! Anic a pidcil spa kada, mldaci i acimldcit. Udanuwri ckwantanan."Kagu7; "manogu ga kina mldcin."10 Ml cigwakici tanit, kimackwatciplta kisinanit. Cigwapasigwlwan, "Pa kiwis, wagunan i ci /ukapinondaman?""Ka, uginig. Kagatusagu nimpa kadamin. Mlna igi /u"waam wangitwa.Kuniginm, upimi-u ta pinamini 4 8 i /u umackimut, pltawai-1 5 yaT ka^anmaminit ; acislgwabinanit, a pana tcatcatclpanacipangicininit udoginlma 8 . "Atawa, ugri niga a 8 l c /u i iunldcanisa 6 !" inantam. Aninimina kowan anita kunaminitlis/u i umackimut5 klmadwasigwai gawan.Kunigimn, inabit, kanawabamat udacimockina a ni i^ma20 umackimutang mi /u mi kwamln. Uganonigon Pa kiwis ,amba, nimina ku Pa kiwis. "Ambasa", wlpisintawicin wa i -ninan, mlgu gaga t rr u tcipa kadayan klcpin nondawisiwanka i ninan. Pa kiwis, ambasano! ompiwanan wa c a u mi kwan.Owiti dac waga kwagamiwank mri witi ka a-ba toyan ;25 o O magu tcinimina kuyan, mri ma awiya kiganontawagA a e Pa kiwis 1 !, Kungwa-u- k! Wagunactcibibagimi kwa :
"2I 9"Indeed,Iam cold.""Well, I will build you a fire, for it seems that youare cold."Truly, then on the ice went the other towardsthe shore to build the fire. When he had a greatfiregoing, then right into it he flung some balsams ;and ashe was taking off his moccasins, he was heard to say:Pilferer, would you not eat those stockings of mine ?""Very well, I will eat He had them them." flung overto him from across the fire. As he looked at them, lo,there was the dried tail of a beaver !Naturally he wasexceedingly hungry, and therefore he ate (it).He triedin vain not to eat it all up."Don t!" he was told; "youmust eat it all."Now, when he was ready, he put on the moccasins ofthe other. When he rose to his feet, "Pilferer,what isthat you are carrying on your back?""Oh,sweet-brier berries. Really we are in want of food.Those are what we are going to eat."Lo, the other went over and took up his bag on the;inside between two layers he got hold of it when out;he poured them, forthwith in every direction fell his sweetbrierberries. how ill he treats his children!" he"Oh,thought. Then out on the ice went the other, carryingin his hand the bag as he went; then was heard thesound of him (chopping on the ice).Lo, as he looked, he observed him filling up his bagwith the ice.By him was the Pilferer addressed ;accordingly out on the ice came the Pilferer. "Hark! do youlisten to what I intend to tell you, for surely you will gohungry if you do not heed what I tell you. Pilferer,listen ! do you put upon your back this pack of ice. Andover toward this other end of the lake is the way bywhich you are to run; for as you go by this place onthe ice, then will you hear them yelling at you: Halloo,
"A/>u22Opamondank?Iwiti dac anigu plyan mrr a plkabonrr kwa.Kawm klgawabamaslg /u !gi kabiminri*ca ir l kwa. TclgayaTdac andayag tcikistciwanatinag, mrrwa kanantawabandaman.A pldac wabandaman, mri ma ka icinlsatciwayan.5 Ugida kidac krrcaiyan, mri ma ka i-cipagitciwaba kamat.Kagu 7 win plyabanabi kan. Gikicapidac ml u i tciplcayag;a 8 a /u kimindimoimlc. Aiyangwamisin, kagu 7 win bablni tawicikan. A a u ,m! i u cigwa tcimadciba toyan."Nimina kuba to Ba kiwis.Ajikaski tot aniguk madclba to.10 A taiya, tcibagamanimatini. Awiya onontawa 9 :pipaginita e Ba 1 kiwis !, pimiba*rwa A a /u , kungwa u k !"Panagu8"Ukabitclnguskwanik.u 8 u 8, , , kungwa 8 wata !"A taiya mldac !kaga t madciba rwat. "Intigwa cigwaguningagungwa-u-gu," anantank. Cigwa ubacwabantan c e /ui i15 a ki. A pl ta ku katang a l ki, awaniban awiya ;ml-ikrponi i gut. Anibabimusat, udani a ntawabandan 4 8 i /u tclwanatinanik.Cigwa gaga t owabandan ;anri jinlsatciwat.Tagwucing ugida ki, ajibagitciwaba kamat Ini /u umi kwarnlman.Kawln kanaga a kawa abanabisl. Aniciklwat.oo.....y20 Ta.wicinof antawat, a tawa wlwan namadabiwan l kaya 4 8 /uiunltcanisa 8 . A pidcisa pa kadawa 8 .Uganonigon wlwan :"Anma?Intigwadaci ko ubmabamn ugimn, kitinanimininaban."
And"How22 Iis he(there is the) Pilferer Give him a push ! ! Whatcarrying on his back? And when you go up fromyonder shore, then will you be left alone by them. Youwill not see them who are to pursue after you. Andnigh the place where you live is a great depression inthe ground, so for that you are to seek. And whenyou see it,then from there shall you descend the slope.And when to the summit (again) you get, then there shallyou put down your pack. Look not behind you. Thenin the morning hither shall come you and your oldwoman. Do you be careful, pay heed to what I havetold you. Now, then, it is time that youthe run. 7were off onOver the ice went the Pilferer running. With all thespeed he was able he started running. Ah, what a galethere was behind (him)!Somebody he heard calling aloud :"Halloo, the Pilferer isfleeing by! Come on, give hima push!"forthwith rose the din of ice cracking."Hu, hu, hu, hu, let us give him a push!"Ah! thereupon he truly started fleeing."It seems asif I shall now be given a push,"he thought. Presentlyhe was in close view of the land. When he steppedupon land, gone were the beings ; accordingly he was leftalone. As on hisway he walked, he kept looking forthe place where there was a great depression. In a while,sure enough, he saw it ;then on down the slope he went.When he came on the (other) summit, he put down hispack of ice. Not a moment did he wait to look back.Then on his homeward way he went. When he wascome at home, there sat his poor wife and those childrenof his.Very much were they in want of food. He wasaddressed by his wife :is it ? Itsaying seemedthat it was his wont to bring home sweet-brier berries, insuch manner have I been thinking of you."
"""A"A222Ajikanonatwlwan:"Kagumanido nindanucawanimik."ningutino inantagan, ganabatcMlsa 7 pmic ka/rcikawicimowat. Kawm kago umldcislnawa8 .Magwagu5 wlwan :tibi kadinik unicka Pa kiwis. AjikanonatMindimoya,unickan."Gaga t mindimoya unicika."BabP tcIn taga, madcata, pacu r ima kigai camin."Mlsagu cigwa animadcawad. Caylgwa udababandanawaima ki s tciwanatinanik. Anisagatciwawat, a tawa, anm10 ka i cinank Pa ; kiwis ! A pidci mockinablni 4 8 /u i ki s tciwanatinan.A tiwa, panagu namawa 8 kasagicigwananinit.a 11 ,agwawabinatanik.""Naskaginln, mindimoya 11 ! AKumagu mini k udagwawabinawa 8 . a 11 , mindimoya,kaya kin mini k kakaskomatwa pimiwanan."Aco O ciwa-1 5 ni kanawat, cigwadac ajiklwawat ajiplndigawanawat andawat.Kaga t motcigisiwa 8 8 /u i i unitcanisiwa. Mlsa cigwa ajitcibakwawat. Ka*i ckwawlsiniwat, a 711 ambadacp, kagatawiagwawabinatanig.Midac kaga t ajimadcawad. Cigwasa umadci kawawa.20 Anawi guca, ki tcinibiwa udagwacimawa 8 . Kawm kanagaubacinanasiwawa, kabaglcig udawanawa,i-i ma antawatinawanawat. Misa cigwa agwawana kukawat. Anicawawaganint agwatcing udagonawa 8 . Aba pic ka klcl tawat,amc mrV u cigwa 7 8Nanabucu kl kitamwat /u i iugl n go n i*ma 8 .25 Wagunanlwinan acimawaticiwat l a s a /u Nanabucu. Anln
So223Then he spoke to his wife, saying: "Take no thoughtwhatever of that, for maybe by a manitou am I reallyto be blessed."And so time passed on tillthey lay them down to sleep.Nothing had they to eat. And while it was yet dark, upfrom bed rose the Pilferer. Then he spoke to his wife,saying: "Old woman, do you rise upTo be sure, the old woman rose upfrom bed."from bed."Put on your moccasins now, let us be going, a shortway over there will we go."And so then away they started on their journey. Intime they came within sight of the place of the greatbasin. When they came out upon the summit, why, whatwas the Pilferer to behold !Veryfull of water was thegreat basin. Why, nothing could be seen but the tailsof sturgeons sticking out."Just look, old woman !Come,now, let us fling them out !" a certain number of themthey flung out. "Now, then, old woman, as many as youcan carry do you make up into a pack."When theymade up their packs, then they returned, carrying theirburdens into where they lived. To be sure, pleased weretheir children. And so then they cooked some food.When they had eaten, "Now, then,therefore let us ingood earnest go flingthem out of the water."Thereupon truly they departed. Presently they wereat work on them. Oh, but a vast number of them theydrew out of the water !By no means did they get anywhere all of them, all day long were they hauling them,over to where they lived they hauled them. Thereuponthey then set to work making a rack (to hang the fisheson). They removed the scales from some (which) theyhung up out of doors. By the time they were done withtheir work, then it was that Nanabushu had eaten up allhis own fish. What should Nanabushu do but go for a
224ka-rcinank !aniplndigat Nanabucu ajiklgitutmldcisasf kisl ! Kawininac wlni u ikigigatasi. Antidac o*oka-u ntcinanatwa ogo u namawag?": "A-a-a-e 1 ,"Migui u , nldcisazfkisl, rrma nintota rbaninang mrrma5 ka irndcinanangwa Igi/unamawag.""Ambasa, ki kino a mawicin anln ajictcigayanlnisatwa."s /ui i"Ka, pisanisagu ki pimina kwa l a c a /u nimindimo i mic.8Mldac/u i i ka klci tod plmina kwan, mldac l s /ui i nm ni tam10 ka-ijimadci taiyan ki trci a-g I a 8 a /u wa-u mi tciglyan. Mldac4 8 i /u ka klci a g nindonda i baninang ml i wa nawatc ninglmis tca l ton 4 e i /u nindonda i baninan. Mldac ima mamwa tcidackigicap kigi tcibotawa I a 8 a /u nimindimoyayim. Ka/i citakubicitl s /u i iplmina kwan ;kata k kubicit, ka i ciba kublyan.15 Kumagu a l pl anitagwicinan nama niwabama. Acipacipawak,acito to kabigibitoyan I 8 /ui ipimina kwan acikitcitabacit l a c a /unimindimo i mic. Misa pl kanisak a s a /u nama. Mlnawaka-i ckwa-a-wasoyan, minawa ka ijipa kublyan. Mri /<ukabagljikka totaman. Mlsagu i u wandcinama kayang. Naim-20 bucu, ninkackika O ninan anita kun.""O u ,misa i u kagabagijik ka/rcittcigayan,"ikitowanIni /u Nanabucowan. Mlsa pan aniklwanit. Pitcmagikuaniba kintanang Nanabucu 8 iwandawat, oganonan wlwan :"Mindimoya, kigakomin. Ambasanogu awimadciblmina-25 l kwan, misa nangwana wlnawa odontaibaniwang wandcinanawatI 8 /ui i namawa 8 .Kaga t kawln klgapa kadaslminkicpin kacki toyan 4 8 i /u tcibimina kwayan."Kaga t ningakacki ton 4 8 i /u tcibimina kwayan," udigon
"225visit. What was there for him to behold as he wententering in Nanabushu then spoke up ! :Why, why, why,my old friend ! You are getting just the kind of foodwe like. Now, where did you kill these sturgeons?""Why, my old friend, yonder from our hole in the icewas where I killed these sturgeons.""Oh,do you teach me how you did to kill them.""Why, simply to work making some cord set this oldwoman of mine. Thereupon, when she had finished withthe cord, I then in turn began making what I should usefor a spear. And so when I had finished it,I then enlargedthe size of our water-hole. Accordingly, on that verysame morning did my old woman build a great fire.After that she bound me with the cord;after she hadme bound, then down into the water I went. When Iarrived, after some little time on the way, I saw a sturgeon.When Ispeared it, I then jerked upon the cord;then outmy old woman drew me. Now, that was when I slew thesturgeon. After I was warmed by the heat of the fire,then again down into the water I went. And that waswhat I did allday long. And that was the way wefished for sturgeon. Nanabushu, (the one that lies across)our doorway do you take as you go."this is what I will do"Why,throughout the whole ofevery said Nanabushu. And thenday," straightway homehe returned. As soon as Nanabushu drew open the entrywayof where they lived, he spoke to his wife, saying :"Oldwoman, we have some food given us. Now, pleasedo you set to work making some cord, for it is the truththat from their water-hole was where they killed thesturgeons. Really we shall not be in want of food ifyoucan make the cord.""Truly,I shall be able to make the cord,"he was told15 FUEL. AMER. ETHN. SOC. VOL. VII.
226mi /u wlwan. Anlc, mlsagu cigwa mindimoya unabit piminakwat; kaya win Nanabucu odoci ton anit. Wayabaninikmisa cigwa kfklci towat kaya 4 8 /u iplmina kwan. Mlsagucigwa kigicap. Mlnotc madcawag Ini /u wlwan : a pidcikisinani. Aba pic cigwa tagwicinowati i ma udonta-i baniwang,a kawa ogagagwatciman ini /u Pa klwisan :"Anln,mtcisasl kisi, ka/rcictcigayan klcpin mbiwa aninisagwa?""Taya, pisanigu tabaswawag."Aba pic Nanabucu kaki tcibotawat, mlsa 7 cigwa pa kublt.10 Altawa, mmotc ki tcikisinani. Wlwan kasagisitayabinikanigut,Nanabucu ajipa kuplt. Kumagu a pl anitagwicink,namawan owabaman Nanabucu; ajipacipa wat, uto kibiton4 8 i /u ubimina kw^anim; ajigitcitabanigut lni /u wlwan. Kaga tminwantam namawan nisat. "Atiwa, kawm ba pic ninda-15 iyanicfta n z!Mlnawa ka i ckwa akabagljik." wasut, ajipakublt.Mlsa x kayabi namawan wabamat, ajipacipa wat.Mlsa x kayabi to to kipitot 4 9 i /u pimina kwan, mlnawa acikitciwabinigutIni /u wlwan. Misa 7 kayabi namawan nisat,mldac kaga t ninwandank a s a /u Imindimoya, kaya a8a /u20 Nanabucu.Anlc Pa kiwis anica ugra gwantcima 8 anamiblg u namawa8 ,i mlya ta nl n aj, pidci kaya mamanatisinit u i namawa G .Mlnawa anupa kupl Nanabucu, kawln kago owabanda n z!n.A pidci a kwanabawat, intawa acimockamut. Mlnawa ajra/-25 wasut, kayabawasut pa kubi mlnawa. Mldac kaga t wasa7anu i cat. A pidci aya kvvanabawat, intawa acimockamut.
227by his wife. Well, then it was that the old woman satdown to work making cord and Nanabushu too made a;spear. When the morrow came, then they were donewith their work and with the twine. It was now morning.Determined were he and his wife to : itgo was exceedinglycold. At the time when they came to their water-hole,they waited first to inquire of the Pilferer "How, my:old friend, am I to do in case I should happen to killheaps of them ?""Why, they are easily dried."When Nanabushu had a great fire going,then into thewater he went. Oh! it was extremely cold. When byhis wife he was bound at the feet, then Nanabushu wentinto the water. When he was come, after some little timehe saw a sturgeon;when Nanabushu speared it,he jerkedon the line;then was he drawn up by his wife. Trulypleased was he to kill a sturgeon. "Why,not a momentwill Istop all the day After he was warmedlong." bythe fire, then again he went into the water. And soanother sturgeon he saw, which he speared. And so whenagain he jerked upon the line, then again was he drawnout by his wife. Accordingly, when another sturgeon heslew, then really pleased was the old woman, and Nanabushu too.Now, the Pilferer, by the way, had put back into thewater some sturgeons, only two, but sturgeons that werevery ugly looking. Again into the water went Nanabushu,but to no purpose, for he did not see anything. Whenhe stuck it out to the very last breath, accordingly, thenup to the surface he came. Again was he then warmedby the fire. After he was warmed by the heat of the fire,he went into the water again. Thereupon truly a longway off he went, but without result. When he had goneto the end of his breath, thereupon up to the surface he
228A tawa ! a pidci krkatabawa. "Awas intawa klwata,"i kituNanabucu.Ajikiwawat. Kumasagu mini k udanuklpimamawa 8 8 /u i iunamamiwa . Aba pic ka kitarnwawat, mlsa cigwa Nana-5 bucu wmi tam pa kadat. Ningudingigu nantawikimwa,agawagu uplna 8 l s /ui iugini 8 x. A pidcisa kawm unisitu kagusla 8 wi kwa wankitciciku ; pa kadawan Ini/u wiwan. Ningutingigumadca Nanabucu ubabagiwayanackimut 4 8 /u ikawuna pitod.Ani ijimadcat, a t /pidcisa kisinani. Cigwasa /10 aninantawikinlwa, pamagu ningutingigu saga i gan matablt-,a pidcisa kmugamani. Anasama tank inaka kaya anl ija.Aniwa k udaniml kawa 8 ugini. A tawa ! a pidci krkatci.Ningutingigu anipimacagamat, pamagu kago nwantankmadwasininik ri*ma mi kwaming. Aji i nabit, kago owa->(kwa k kra tani ma kutawagan15 bandan. Ajinimina kut, piasawawint. Nanabucu kacitina omamon. Ajigintcitawagunanank,pamagu kanonigut awiya:klbi kwa k?""Nanabucu, kina 8 /u i i8"Aye , nmsa, nicin, nimbi kwa k."20 "Kawln win kri- kitus! a pl Papa kiwis cawanimag.""Kaga t kawm nln nindobi kwa k osln, nicl n .""Nanabucu, kigi katc mawln.""Aci-Taya! Nanabucu ugi s tcikanawabaman. :Oganonanwinan kigl katc ! Nindabwac kuca."25 "TaVa t, ta wa t, ta wa t! Kawln kuca win kri^kitusiPa kiwis a pl cawanimag."
came. Poor fellow ! he229was very much chilled by thewater. "Off for home now let us go!"said Nanabushu.Then back home they went. And in the course oftime they ate up their sturgeons. And by the time theyhad eaten them up, then was when Nanabushu had aturn at being hungry. And once while looking for sweetbrierberries, only a few of them he fetched home. Scarcelyany nourishment from them did the woman get ; continuallywent Nanabushuhungrier became his wife. So once awayafter tying his old wretched bag of cloth secure. As hestarted forth on his way, it was extremely cold. In awhile he was going alongin search of sweet-brier berries,when all of a sudden out upon a lake he came; verylong indeed was the lake. Along by way of the sunnyside he went. But a few sweet-brier berries he foundalong the way. Poor fellow ! he was so very cold. Now,once while going along the shore, there was a suddensound of somethinghe looked, he saw something. When he went out onthat he heard fall on the ice. Whenthe ice, there was an arrow feathered with the ear of abear. Nanabushu at once took it. As he shoved it intothe snow, he was suddenly addressed by some one saying:"Nanabushu, is that your arrow?""Yes, my little brother, it is myown arrow.""That"Really,was not what the Pilferer said when I blessed him.""Nanabushu, youAh !it is not my arrow, mymust be cold."little brother."Nanabushu was closely observing him. He spoketo him,"Howsaying: can you say that 1 I am cold!Why, Iam sweating.""Come, come, come! the Pilferer certainly did not saythat when I blessed him."1Aciwinan, "How can you say that,"... an adverbial expression.Itmightbe put in this form : "The idea that" . . .
"A" 1Akawm230"Icta, kaga t ningl katc!"u, Nanabucu, kabotawin."U, potawacicin." Kaga t acinataga kut Nanabucu.Acipodawanit. Ka ki tcipodawanit, aTtawickuta cingubl5 uda paginani. "Amba, Nanabucu, awazun."Ta taya! Nanabucu ajra/wazut.Cigwasa 7 tajikagPtciwan kaya tacigltaciga nawan. Acikanonigut"Taga, Nanabucu, mldcin Ini /u :nindaciganan.""A n ,aciwman Midcin !Nindanimucuwlnakamidciyan10 Ini /u gitaciganan?""TaVa t,ta^va t ! Kawlnkuca win krr kitusl Pa kiwisa l plcawanimak.""Icta, kaga t ningamldcinan."Kaga t ubra^pagidoni. Kumiginln, kaskami kwaniwan !15 "Nanabucu, kagu x win ckwantangan."Nanabucu mlgu ima wanimo k ka u ndcipldomut.ajimadantcigat a c a /uCigwasaNanabucu, kuniginln, tapimipasigwlwanudoda pinamini 4 8 i /u umackimut. "Nanabucu, wagunani i 11ka pimondaman?"20 "Ka, ugimg kuca kapimomagwa."Udatcitwapinani, panagu tcatcatclpan pangicino."Tawa t,tawa t ! Kwa tcinantawln klga rnigata. Anlnwmi u i wandcitotaman ?"25"Nanabucu, pisan ayan. Kawln win kri- kitusi a pl-Pa klwis cawanimak." Aninimina kowan klmadwasikwa-igawan. Mldac ma pma wanit i umickimutang i Ini /u mi kwamin,"Nanabucu, ambasa x !, pisindawicin Klcpin/>utawiyan, mripapani-klgawabanicizl. Umbom wa s a /u
""231"Why, yes,to be sure I am cold!""Very well, Nanabushu, I will build you a fire.""Good, build me a fire."Truly then over the ice towardsthe land went Nanabushu.Then the other built a fire. After he had a bigfiregoing, then on both sides of the fire he piled"Come, Nanabushu, warm yourself!"now Nanabushu warmed himself.Ah !the balsams.Ere long the other took off his moccasins and removedhis stockings. Then by him was (Nanabushu) addressed :"Now, Nanabushu, do you eat those stockings of mine.""Indeed, why should you say to me, Eat them! AmI a dog, that I should eat those stockings of yours?"Come, come ! The Pilferer really did not say thatwhen I blessed him.""Why, yes,of course I will eat them."Truly, the other flung them over to him. Lo, it wasthe dried tail of a beaver! "Nanabushu, do not leave anyof ituneaten."Nanabushu thereupon secretly put some awayin the bosomof his garment. When Nanabushu began eating, lo, theother rose uponhis feet (and) picked up (Nanabushu s) bag."Nanabushu, what were you carrying upon yourback?""Why, only some sweet-brier berries was I carrying."The other turned (the bag) upside down and let themspill,and straightway in every direction they fell.!Stop, stop There is a chance that you will do (us)harm. Why have you done that?""Nanabushu, do you keepsilent. The Pilferer did notthat when I blessed him." Then out over the icesayhe went (where) he could be heard (chopping).And sowhen out there he was putting the ice into the bag,fail to"Nanabushu, come, do youlisten to me! If youheed what I say, then you will not live through the winter.
" lA"" lA>mi kwam, awa kwagam klga232rciwananan. Oma tciniminakuyan,pacu anitagwicinan, a a e 7 Nanabucu, kagoubimontan- - a l a /u , kwungu ir k !klga-rni tam. Kagu abanabikan. A p! mlcaga kuyan kawln ikayabi kiga ni t ta n zl.5 Mldac iwiti, tclgayaT andayag,tci a-ninantawabantamantciwanatinag. Mi kaman dac, mri ma msatci /u kam-ijaiyan.Ki klcamatciwayan mlnawa, mldac 4 c i /u ka-i cipagitciwabakamata 8 a /u mi kwam. Kagu x win abanabi kan. PamadacCkigicap klgapmapim a 8 a /u kimindimo i mic. Mlsa 4 c /ui 10 cigwa 7 tcipa kawininan."Aciumbiwanat Nanabucu, ajimadcat, anigu k madci ba to.Pacugu tagwicing awlya onondawa 8 : e e 71 , wagunanlNanabucu pamontank? A a/ukwunku u- k!" Ta! mldac,kaga t anigu k madciba to. Kakacitinagu pacu 7 pitclngwus-15 kwani. "Intigu mfpi kaga kwugwa u inantamkuyan,"/uNanabucu. Wagunaniwinan ajipagitciwaba kamat Inilumi kwamiman.lA a /u , kwungu u- k !" i kito Nanabucu.A tawa !wantagu kagat kago owabandan zln. Mlnawaumbiwana. Kwatcigu majaga kuba tod, mlnawa ubagitcwa-20 ba kaman. a /u , kwunguirk!" i ckito. Pa kita i-gaIni /uumi tigwabln, kawln kago owabanda n zln pagwanagu icipapakita i ga. Mlnawa udombiwananan Ini /u umi kwamman.Misa / cigwa acimicaga kut, ani icigu plt ; kaga t unantawabandantciwanatinanik. Kaga t omi kan 4 8 i /u wanatinanig.
hesaidAh233Put upon your back this ice, (and)to the other end of thelake shall you carry it. As you go hence over the ice,when a short distance on your way you have come, then,Halloo, there! Nanabushu has something upon his back -come on, give him a push! youwill hear. Do not lookback. When you get across the ice to the shore, nolonger will you hear the sound. And then over there,nigh to where you live, you should seek for a greatdepression in the earth. And when you have found it,then down the hill should you go. When you come outupon the summit again, then you should put down yourpackof ice. Do not look back. And not till in themorning shall you and your old woman gofore now shall I leave you."Then up Nanabushu lifted his pack, as he departedwith allspeed, he started running. And when a shortto look. Thereway he was come, he heard (various) ones :"Halloo, there!what is Nanabushu carrying upon his back? Come on,give him a !" !push and then, to be sure, with allspeed he started running. And of a sudden close byrose the din of roaringice. "It seems that now am Inearly pushed over," thought Nanabushu, What shouldhe do but lay down his pack of ice. "All right, givehim a !"push Nanabushu. Poor man ! not a singlething did he really see. Again he took up his pack.The instant he gained the shore from the run over theice, again he laid down his pack. "Very well, give hima push!"said. He swung to hit with his bow, butnothing he saw; and blindly did he strike to hit.Againhe took up his pack of ice. Thereupon, when he cameoff the ice onto the shore, then on up inland he went;truly he sought for the great depressionin the earth.To be sure, he found the hollow space.In time, whenhe was come at the top the hill, he put down his pack.
"Ambasa234Cigwasa kata kwamatciwat, ubagitciwaba kaman.Ajra/banabit,panagu namawa 8 kasablnit. Ani i cikiwat. Anrrjipmdigatandawat,"Atawa, wabang klganama kamin.Kaga t pa tanlnowag namawag kawabamagwa."Misa 7 ajitibi kat inik. Nayagigu unicka. NanabucuAjikanonat wlwan: "Ambagickanaklki kanda n zln tcinama ?"kayanunickan. KanantakincAjimadcawat ijawat iwiti kawabamat /u i i namawa 8 .Kuniginm, a pi anisagatciwawat, anln ka i cinamowat?10 Wandcitagu ka ska stanigwan /ui i i wanatina !Inabiwat,iwiti a pidci nawatinang pajik kra biwan Ini /u pikwa kuctigwananamawan.Agawagu nabopiwagamisowan anukabacimawat.A tawa !kagatsa mindcinawazi l a s a /u mindimoya.Nanabucu kanona :"Indackakago kiglpablnitarnitug."tanatamowat. Kawm wi ka15 A tawa! wandagu gaga t a plkago ubidosln anukro sat Nanabucu. Ningutingigu oganonanwlwan 7 :,unapi ton mackimut s /u *i i kababamiwanayan.Minotc nlawinantawi irkimwa."Ajimadcatl sNanabucu. Aniwa k udanimi kawa /u i iugini 8 .Cigwasa20 ani u-nagucinini. "Kawmkanaga intawa nindaklwasl,"inantam Nanabucu.30. NANABUSHU AND THE WOLVES. :Ningutingigu saga i gan omada kun. Ajimadcl a-daga kut,wabigamanig pacwabandank, awiya owabaman pimadagaiSee Series I,No. 7, p. 49.
"235On looking back, (he saw) vast numbers of sturgeonmoving about in the water. Then on his homeward wayhe went. As he went on into where he (and the others)lived, "Hurrah! to-morrow will we fish for sturgeon. Truly,many are the sturgeons I saw."And so night came on. And before it was time, upfrom bed rose Nanabushu. Then he said to his wife :"Doplease rise up from bed. Do younot know thatyou are going to fish for sturgeon?"Then they departed to go to the place where he hadseen the sturgeons. Lo, when they came out upon thesummit, what were they to behold? Why, completely drymust the basin have become ! Asthey looked, yonderin the very centre of the basin lay but a single, large,round-headed sturgeon. And scarcely any soup did itmake when they tried to cook it. Ah ! but truly disapnot getting more sturgeons).pointed was the old woman (atNanabushu was addressed : No doubt but that you musthave failed to heed what was told you."NeverAlas! by degrees then were they really starving.a thing did Nanabushu fetch home when he went out invain to hunt. And once he spoke to his wife, saying:"Well, tieup the bag which I will carryfrom place to place. In spite of illluck, I will goas I wanderseek forsweet-brier berries." Then departed Nanabushu. A fewsweet-brier berries he found along where he went. Thenwas the evening coming on. "Not at all, as matters stand,would Igo back home," thought Nanabushu.30. NANABUSHU AND THE WoLVES. 1Now, by and by he came out upon a frozen lake. Ashe started forth on the ice, as nigh to the narrows of the1For other versions see Nos. 8 (p. 73), 9 (p. 85), 44 (p. 373).
"236kupa tonit; aca mlnawa, nlwiwa 8 .Kuniginln, maTngana c !Ajiplpagimat:aNi s tcimi s tca, a kawa, kawabamininim !"Kaga t kipitciba towa8 aciwawanabinit aninasi kawat.;Ajiganonat:Nltcisasrkizl, anti acayag?"5 crc/"Ka, witi, kicika tikwaning, mrrwiti acayang. Nibinunkkra santcigobanig ogo kitocimag, ki tci a yaban/uuginisawabamn. Mldac iwiti acayang.""Atiwa, ml gaya nln iwiti acayan, kicika tikwaning, -4 8 i /u tci a niwawltclwinaguk."10 Anic, mri/>usicigwa wunagucininig."Anlc/u i, Tcltclgwanowis, 1 aninanta irninamasiwan,4magica takisina tibi kat. Taga, kimicoma i wa tani a-ntoirninama."Anic, mlsa 7 tgaga Nanabucu aninanta U ninamat. Kawasa15 ni tawusasi, anuwltclwat 4 8 i /u ma lngana 8 .AjikanonintNanabucu: "Ambasino, antotamangigu pimiba l toyang, mlkaya km katotaman."Taya, kaya win totam. Anic mldac i u kawln kago 4 8 i /uoso, mldac 4 s /u iwlnag l s /u i i wasowat. Kawln kanaga nomag20 cigwa animaskawa kwatininig."Kaga t mlmawlni iu tcinibut kimicomanan, maskawakwatininigc i iwlnag. Intawa kico tdwata." Mldacla s a /upajik maTngan ubi tawajan 3 aciwlwa kwapitciga tanig.1The name by which one of the young Wolves was called.
"Come,"O237lake he drew, he saw some one running past over the ice;then some more, four of them. Behold, (they were) Wolves!Then he called aloud to them :my little brothers !wait, I wish to see you."To be sure, they came to a sudden halt;then they satdown, while he went up to where theywere. Then hespoke to them, saying: "Myold friend, whither are yougoing?""Oh,over here, for the place of cedar boughs,is wherewe are bound. Last summer did these nephews of yoursmake a cache there, a great bull (moose) they killed then.Now, that is the place (for which) we are bound.""Why, that is the place, too, for which I am bound, -to the place of cedar boughs, so therefore it ismywish to go along with you."Well, it was then evening."Now, Thin-Tail, 1 do you go find a place where to camp,for perhaps it will be cold in the night.Isay, let youruncle find a place where to camp."So thereupon, truly did Nanabushu go to find a placeto camp. Not at all was he familiar with (their way of)travelling, as he tried going along with the Wolves. Thenwas Nanabushu told :as we do when we rundo too."along, so in like manner should youAh, and he did the same. Naturally, there was nothingwas what hein the way of a tail, therefore his penisused for a tail. It was but a verylittle while before itwas frozenstiff."Surelynow without doubt will our uncle die, for thathis penisis frozen stiff. Therefore let us warm it for him."Accordingly, with the top blanket 3 of one of the Wolveswas itwrapped about the head. And very awkward washis aspect as he tried in vain to run along. In time he2Referring to the tail of a wolf.
"Anlc2 3 8A pidcigu wasi tawinagusi anupimiba tod. Cigwasaa pidci tabinawanig."Misa/oma tcinibaiyang."umi kan"E 1 ,kawasa , kitagfkatcimin.""Taga,kin Tcltcigwanowis,"Inimawan Ini /u a kiwa"zl5 ma i nganan.Gaga t mldac l s /ui i nantukabacit a pidci omi kan anasa-7"Mlsa oma tcinibayang."Anlc mlsan uto-a-maninig.kwakuwabinanan.lA a /u , Nanabucu, podawan," ina Nanabucu. Anlc10 misa 7 Nanabucu anawibotawat. A kawa klci kisagon uglcibawabinan.:Ajiganonint "Nanabucu, anlnna antotamanwrpotawayan? Nackasa, kanawabamicin antotamink wapodawangin."Kunigimn, Ini /u a kiwa n zlmaTnganan pasigwlwan,u kwa kwisininig Ini /u mlsan acipacitcikwaskwaninit ;15 mlsa 7 ickuta ajipiska kunanik.Cigwasa 7 tibi kadini, ajikawicimut Nanabucu. A tawaNanabucu ! a pidci nondagusi, a pi tcigl katcit.pl"Icta, kimicomanan mlmawlni-r* 11 wlkawatcit, intawatawaca i-k,"20 Pajik pa ijlnanawaninit.Wibago amatciblso. "Cl, kagatsa o u animwanowic nindabwackagunwlbagu minawa gl katci. Ajinonda-!"tawacai- k minawa kimicoma i wa."gusit, "Anlnta, plPajik ajigikitut: "Ingutcikuca ugra* pagiton anubl-25 tawaca-a-g." Kaga t minawa ipa crrnanowaninit/uinima-rnganan.Mldac na u iajiwabaninig. Cigwa kigicap ajikanonintNanabucu: "Nawakwag mra- pl ka-u di tamang 4 8 /u i asantcigwan."
So239found where there was excellent shelter from the wind."Now,here is where we will sleep,"said Nanabushu."Why, impossible! we mightbe cold."say, you, Thin-Tail, (go look for a camping-place),""Ithus to one said the old Wolf.It was so that when he looked for a place to camp, hefound a place that was exceedingly windy."Here is wherewe will sleep."So a great pile of fire-wood he heaped on."Allright, Nanabushu, do you kindle the fire,"wastold Nanabushu. So accordingly Nanabushu tried in vainto kindle the fire. He first tried twirling a piece of cedarwood. Then he was addressed: "Nanabushu, how do yougo about when it you want to make a fire? Just look,observe me (and see) the it isway done when fire ismade."Behold, the old Wolf then rose to his feet, (and)over where lay piled the heap of fire-wood he leaped ;thereupon the fire blazed up.It was now getting night, when down to sleep lay Nanabushu. Poor Nanabushu ! he was heard making a veryloud noise, he was so cold."Ideclare, our uncle no doubt is about freezing todeath, therefore put another cover over him."One then laid his tail over him.In a littlewhile he became awake because of the warmth."Oh,how really much am I made to sweat byfounded tail of a !"dogthis conin a little while he was againcold. When he was heard making a noise, "Why, putanother cover over your uncle," (said the old Wolf).the cover whenOne then spoke up: "Why, off he flungI tried to put it over him." Truly again the Wolf laid histail (over him).And so by that time it was day. Then in the morningwas Nanabushu addressed:"Bynoon is when we shallarrive at the cache."
"Akawm240Ajimadcawat, udanang pimusawag !ni/u wida l kiwa n zlyanmojag unlganri gon. Ningutingigu uganonigon a c kiwa n zl:maTnganan "Nanabucu, ambasano, intawa, kagu 7 usowalkan i i wa klnag, osam macimagwat. Intawagu acictciga-5 yamban mi i u icictcigan tcipimusayan."Nanabucu mlsa 7 gaga t acictcigat, mlsa / pitclnag minopimusat.A pidcigu udibi a-I8 /u 8i i ma rngana.Cigwasatagwicinog asantciguning. Aca tana kamigisiwa8mona a -minit asantcigun. Oganonigon wita kiwa n zlyan : "Nanabucu,10 mlsa cigwa tciwlsiniyang.4A4a /u ,wltci i wan tcimo ka a*-sandcigung."Kaga t Nanabucu wltcl i wa i 8i /umo ka rgadanig asantcigun. Cayigwa owabandanan Nanabucu. A tawa, wato-spa kunisagon kaya /u i ianaga kwan katawananit. "Tawa t,15 tawa l t, awanamwinanag ugo u />u! Mri win wi ka mldcislmIni /u mi tigucan!""Nanabucu, kagu 7 ikidu kan. Naska pitclnag kigicap,kigaminowlsin."Pang! mina 4 8 i /u udopa kunisag kaya iu anaga/kwan.20 "Kaguxwin nontatibi k wabandangan. Pama kigicapkawlsinimin." Misa x cigwa tibi katinig Nanabucu ani kwacinguda l ton ^ ^i^ kamlnint. Ajinibat Nanabucu. Ningutingigu,tibi kadinik wagunanlwinan owabandan i-i wa kamlnint.A tiwa, kuniginln, mo n sonagic ml wa u i wadopa i kunisagunk25 ka i cinank, mmawa wanaga kwan ml Ini /u ocobln. Migu8ii /u acipa kwandank, kaga t uminu pitan. Mlsa 7 mlnawaacra- pi kwacimut.30Cigwasa wabanini, panagu kamodtigisinit 4 s i /u ma*rngana8 , wandagu gaga t minowlsiniwa 8 .a 711 , Nanabucu, kaya km ablginan kidacamigowin."
241When they started, behind walked he and his old comahead. And once hepanion who always had him keepwas told by the old Wolf: "Nanabushu, I beg of you,really, do not use your penis for a tail, for it smells toovile. Therefore, according to the manner youare accustomed so (to), you do when you travel."Nanabushu then truly did so, whereupon he then travelledwith ease. And very well he kept pace with the Wolves.In time they arrived at the cache. Already were the othersbusily at work digging up the cache. He was addressedby his old companion: "Nanabushu, it is now time for usto eat. Come, go aid in the work of opening the cache."Truly, Nanabushu aided them in the work of openingthe cache. In a while Nanabushu saw (what was there).Why, it was choice fire-wood and some bark that theywere taking out."Stop, stop, you rascals! Why, neveris this wretched wood to be eaten.""Nanabushu, do not say that. Just youwait till in themorning, youwill have nice food to eat."was given him of the choice wood and the bark.A little"Do not look at itduring the night. Not till in themorning shall we eat." Thereupon, when it was night, thenNanabushu placed where he lay his head that which hadbeen given him. Then to sleep went Nanabushu. Byand by, in the night, what should he do but look at thatwhich had been given him. Why, behold, a moose-gutwas that which had appeared to him as choice fire-wood,and the bark was tenderloin. Accordingly, when he bitoff (a piece), he truly found itsavory. And then he useditagain for a pillow.In time came the morning, and forthwith pleased werethe Wolves, and very heartily indeed did they eat."Now, then, Nanabushu, do you too unwrapthat was given you."1 6 PUBL. AMER. ETHN. SOC. VOL. VII.the food
" 1Auci242Nanabucu ajiwabandank, a tawa, ml gayabi udobakunisagkaya 4 8 i /u wanaga kwan. Ajikanonint Nanabucu :"Tibikunksa kiglwabandan o*o .""Kawmning!wabanda n zm."5 "Nanabucu, kitanabitacin tibi l kunkklpa kwandamowanan."s /u i i"Intawa,acami k kimicoma-i wa."Mlsa gaga t acama, twandagu gaga Nanabucu tawlsini.Nanabucu: "Intawa kiwan. Kama-Cigwasa 7 ajikanonint10 tcita i ko kimintimo i mic kamldcit.""Kuwm, osam pa kada. Manu kawidclwininim."U, Nanabucu, kawldclwiko. Ayangwarnisin, kwaya kwi i ciwabisin. Wabank kigagusimin. Wra-ntawantciwagogo /u wkidocimag, moson wra*ntawabamawan.15 Mlsa x weyabaninik ajigusiwat. A pitci kigicap madcawa 84 8 i /u udockinawamiwa 8 ;wfkadac animadcawag NanabucuIni /u wlda kiwa n zlyan mada arnawat ma Ingana 8 .Nayawalkwanik mri/<ukawanigubanan 4 8 /u i moso 8 .Pacigidaciguklmadcinicawaniguban, mlsa 7 pima a nawat. Ningutingigu20 upimwackitiwinini !ni /u ma-rnganankl-a-ni a tani. Nanabucuajikanonint: "Nanabucu, anita kuna u mi /u ubl tawacan a 11kitojim.""Anmta katotaman animumowic ka-a nita kunaman?""Taiya,Nanabucu! kawm klta i- kitusl."Ma-rngan aji-25 o ta pinang, kuniginln, ma katawagin udontcimamonini; !ni /uma rnganan pa pawiwabinaminit.8"Nicimisa, nm ninganipimiwitowan nintocim /u i iubl tawacan."Mlsa 7 anicita 4 kunamawat.
243When Nanabushu looked at it, why, it was yet choicefire-wood and the bark. Nanabushu then was told: "Lastnight you reallylooked at this.""I did not look at it.""Nanabushu, you have left the mark of yourteeth onwhat you must have taken a bite last night.""However, do you feed your uncle."Thereupon truly he was fed, and thoroughly indeed wasNanabushu satisfied with food. Presently was Nanabushuaddressed: "Thereforego you back home. We will sendby you some food for yourold woman to eat.""No,she is too hungry. Please let me go along with you.""Very well, Nanabushu, you may go along with us. Doyou be careful, in the right way do you conduct yourself.To-morrow we will move camp. For some game dothese nephews of yours intend to hunt, for moose do theyto hunt."expectAnd so on the morrow they moved camp. Very earlyin the morning started their youths ;and a long whileafterwards departed Nanabushu and his old companion,they followed in the path of the Wolves. At about noonwas when they laid plans how to get at the moose. Now,one pursued after the moose, whereupon theytrailed after(the moose and wolf). And once some fresh droppingof the Wolf lay along the way. Nanabushu was told :"Nanabushu, as you go along, pick up the top blanketof yournephew.""What am I to do with the foul dropping of a dog,that I should pickitup as I go along?""O Nanabushu! you should not saythat." When theWolf pickeditup, lo, a black cloth he picked up fromthe place ,the Wolf then gave it a shaking."Myblanket."little brother, let me carry for my nephew his topThereupon, as he went along, he carried it for him.
"A244Misa 4 8 i /u ani rcinlca rga kawanit anrijawat lni/u ma r-ngana 8 .Ningutingigu mi tigunk pata ka kwisinini 4 8 /u iwibitani Ini /u "NackamaTnganan. kuca ! kitocim kapitakwaa-gwan. Taga, kltcigubiton, Nanabucu, kitocim I 8 /ui i5 umi tigwanwi anitakwunamu 1 .""Anlnta katotaman animwabitic kanita kunaman ?""Nanabucu, kagu r i kitu kan." A kiwa n z!maTngan acikltcigwandank. Kunigimn, mi tigwanwi udontcimamon.nm ninganitakunan.""Taga,10 "Nanabucu, kagu 7 win ingutci pagito kan. Kigasanagrakitocimklcpin ingutci a pagitowat."Ningutingigu papima a nawat 8 /ui i, kunigimn, a pidcipacigini udadagwanasawan nlpitayabanigusinit. Nanabucukanona : "Awanan km kaci kagwan kitinandam?".15 Udicinowan Ini /u matci kawa a t, ajiklgitut : "Napisa nacwlna a 11 mindimoyanc wina-/<ua Ogowi s tcagu miwagugukanagaciwawat.""Kawln, mlsaf wa 8 a u kanagaciwat."Anipapimusawat. Cigwa a pidci ka kra/niguban. Nin-20 gutingigu owabamawa 8 cingicininit. e e^, kawlnninawlnkigigagoslmin. A a /u , Nanabucu, ucl tan,lkadacimosukayankkawici tomin."Anlc Nanabucu anu rnabit, kawin awiya owabamasintcra-binit mo n son. Anlc miya tagu u iumiskwlwagunaganik/25 weyabandank. A pidcisa tatapisinlwa 8 . Nanabucu ajimanajitat,mldac ima a 1 cat a i tag cingicininit Ini/u pacik lni/uma-I nganan. Wagunamwinan upapasiguntciwapiskawan."Atcimatclsta c a! mini k klgitanawa?"
""245And so along the trail the Wolves made in their pursuitwas the way (Nanabushu and the old Wolf) went. Now,once there was sticking out of a tree the tooth of a wolf.Oh, look !yourdentally.nephew sInephewmust have struck the tree accisay, pull it out, Nanabushu, carry along yourarrow !""What am I to do with the miserable tooth of a dog,that I should carryit as Igo along?""Nanabushu, do not saythat." The old Wolf took itout with his mouth. Behold, an arrow he took out."Isay, let me carry it along.""Nanabushu, don tyou fling it away. You will makethings difficult for your nephew if you throw it away."Then presently, while trailing after the Wolves (and themoose), lo, (they saw that) one of them went with draggingfeet through the snow as they moved abreast in line. Nanabushu was addressed :Which one do you think is swifter ?"He pointed to the one that trailed along in difficulty,then he said: "Why,this one here isnothing but an oldhag. Now,these are the ones that will lead in the run.""No,this is the one that will be in the lead."On then they went walking. Now, very hard were theypressing the pursuit. Then by and by they beheld theothers lying down. "Halloo!why, they are getting ussomething to eat. Come !on, Nanabushu, get ready aplacefor us to dress the moose we will make."Naturally, Nanabushu tried looking about, but to no:purpose he saw nothing of any moose that was there.Now, the only thing he saw was some blood on the snow.Thoroughly sated was each one with food. Then Nanabushu went for some balsam boughs, and the way hewent was directly where one of the Wolves lay.Whatshould he do but give him a kick to make him stand up."Forgoodness, sake! have you eaten so much as that?"
>c"246Tcanga kwanowan.7"Kagatsa kiwawisagicka Nanabucu.Kagu 7 icictciga kan, Nanabucu. Kanona Nanabucu :11,"Pisanayan. Klcpin mlnawa /<ukago wltotaman, mri kawinAklgacamigosi." taya, Nanabucu anigu k ano kl. Kawa-5 na l pl uglcl kanawa 4 8 /u i watacimosu kawat. :Ajiganonawat7"Mlsau ikiglcl taiyank." Papasigwlwa 8 pimi cawa 8 i i i makra picimoni t kawat. Cigwa pacik cicigagowawan, mlgu/u ipacig I 8 /ui iusaglni ajimiziwapangisininik. Kaga t mamakatandam Nanabucu, kaga t minwantam ; wantagu10 ba kic nanagamosiwi, apl tciminwandank a c a /u Nanabucu."Ambasa 7 , agwawanaGawana pl uglci tonawa l sickukata."klcisa/kwawat Nanabucu a pidcisa7i /u agwawana k. Mlsa 7 pitcinagtawlsini. Aba pic tapikadinik,ajinibawat. Cigwa wabanini. Kigicapigu kigito-15 wan Ini /u a : "MlsakiwanzimaTnganan cigwa tcigl a- kayamban.Anlc kawln wfka awiya ninganawabamigosl 4 8 /uiwaya kayanin. Intawa a kawa padagwlngwacinuk."7Kaga t padagwmgwacinowag. Anic Nanabucu kaya winpadagwlngwacin. Indigunata madwaganagantciga, inantam20 Nanabucu. Wagunanlwinan pangl odontcikanawabamanna i tak udacigagwatigwantamini u i u kan. Wagunanlwinanajipicagwantaminit. A tawa ! a pidcii i ma usklcigunkacipangisininik.Nanabucu misa 7 acigiwaskwackagut. Anicagu 7ta kabawanint wandcimi kawit. Kami kawit, kanona :25 bucu, kanawabamiwamban 4 8 /u i a kayan.""Nana-
"247Up he raised his head. "Really, you hurt me with yourkick, Nanabushu. Don tyou do that again, Nanabushu."Nanabushu was told: "Bequiet. If you intend doinganything (like that) again, then youwill not be fed."Oh, but Nanabushu labored hard. In a little while theyfinished working on where they intended to dress themoose. Then they said to him: "Therefore are we ready."Then up they rose to their feet (and) came over to theplace where they had spread out the balsams. Presentlyone began to vomit, whereupon the whole of one forelegfell. To be sure, amazed was Nanabushu, really pleasedhe was and duringall the while he hummed a song, sovery pleasedwas Nanabushu."Come, let us make a meat-rack!"In a little while they completed the meat-rack. ThereNanabushu becameupon, when they had finished cooking,thoroughly sated with food. When it began to grow dark,they then went to sleep. In time came the morrow. Andin the morning up spoke the old Wolf: "Therefore nowwill I make some grease from the bones. Of course, byno one am I ever observed while boiling grease from thebones. On that account you shall first cover up your faces."To be sure, they covered up their faces. Now, Nanabushu covered uphis face too. It seemed that he heardthe sound of bones being cracked with teeth, so thoughtNanabushu. What would he do but take a littlepeep athim atthe very moment when he was gnawing ravenouslyupon a bone. What should (the Wolf) do but let (thebone) slip from his teeth. Poor !(Nanabushu) right squareacross his iteyesfell. Nanabushu was then knocked outof his senses. It was only by having water splashed uponhim that he was revived. WVfter he had revived, he wasaddressed :Nanabushu, youI made grease from the bones."must have watched me while
" 1A"Mi248Misa u i minawa acitibi katinik; cigwa wabanini. A pidcikigicap kigitu Nanabucu:s tcatcigwa wra^kayan. Kawmanistca wl ka ninganawabamigo s c ctc!/ui i wa/a- kayanin.Intawa padagwmgwacinuk."5 Amc, ga kina ajipadagwlngwacinowat, Nanabucu madwawa-i-gablgwa*a*nk Ini /u u kanan. Amc, a pici pimiti kwacinonIni /u a kiwa^Ima rnganan. Wagunanlwinan udaninazikawan. Kamamot udo kanim, gi^ci a niguk u kwagananingajiba ki ta/o wat. l/<utWantagu gaga mriajitayapita-10 ganamat. Kagatsa sagisiwag igi /u wawosiwat. Tawa 7 !ajita kabawanawat. Gaga t pang! kago ina ma kawinit :/>u"Nanabucu, intawa mri ijickwa tan, usam wltclwigoyan,anodcigukiticiwabis.""Kawln,manogu kiwltciwininim !"i$/U , Nanabucu, pisan ayayan kawltclwigo."Wayabaninig kabaglcik wlsiniwag. Cigwa wanagucininigklgitowan Ini /u a kiwa^z! ma-I :nganankamadcamin tcigusiyang.""IntawasawabangAnlc Nanabucu nawatcigu clnganima. "Nanabucu,20 ambasa, wabank klwipa kawinigo.""Kawln. Ambasano, I a 8 a /u pacik nintocim ningawitcraryawakicpin inandaman. Kawm wl ka c kagota-i ciwabisisi.""Anlcna, Nanabucu, kammin aV u ninidcanis. Kigilkanimin manitowiyan, mi i wa />uu-ndcimininan."
249And so it was night again ;then came the morrow.Very early in the morning up spoke Nanabushu : "Andnow I want to make some grease from the bones. Neverfor the mere sake of observing am Iwatched when makinggrease from bones. Therefore cover up your faces."Now, when all covered their faces, Nanabushu could beheard breaking up the bones. Now, in plain view, withhis head resting on his side (facing Nanabushu), lay theold Wolf. What should he do but go over to where (theWolf was). When he had picked up his bone, then withall hismight upon the back of his neck he struck him.To be sure, he then laid him out completely with the blow.Really scared were they who were his children. Poorfellow! they then dashed cool water on him. Indeed, alittlesomething was said (to Nanabushu) after (the Wolf)had revived: "Nanabushu, therefore now you had bettercease, too much have you been in our company, and youdo things you should not.""Nay, please let me go with you!""Very well, Nanabushu; if you behave, you may goalong."On the morrow throughout the whole day were theyeating. When evening came on, then up spoke the oldWolf: "Therefore to-morrow will we depart to find anotherplace to camp."Now, Nanabushu was somewhat disliked."Nanabushu,come! to-morrow we will part company with you.""Nay.Please let me remain with one of my nephewsif it be yourwill. Never will anything (harmful) happentohim.""Ofcourse, Nanabushu, I will give you one of mychildren. I know that you are a manitou, for such is thereason why I give him to you."
2503 1 . THEDEATH OF NANABUSHU S NEPHEW, THE WOLF.A taya, kagat minwantam Nanabucu. Wayabaninigkusiwa^. Pacigigu utociman kaya wlnawa ingutcigu icimadcawag.Uganonigon Ini /Ll udociman :"Nanabucu, pacugukiganibamin."Misa a i na a-nat udociman. Kumagu a pl5 cigwa owabaman ani tawanini k namadabinit. "Nos,mro matcinibaiyank," Nanabucu udigon. Ka rskwawlsiniwat, awaningwami.Klciginibat. Magwagu nanamadabit pamaguwandcimawinit Nanabucowan. Ajidclcabinat. "Ci,indaskanm nimanabamigutug," udinan. Cigwa tayanibanit, kusku-10 siwan. Amc, tana kamigisiIa 8 a /u ma-rngan."Anm anabandamanklmawiyan?""Atawa, nindocim kimanabamin. Wabang a c a /u mo n swl piminicawat. Ambasano, kagu"ickwa pagito kan 4 e /uimi tigons slblnsing misawagu cigwa tababamatI15 mlgu iu wrrcimindcimantan."a 8 a /u mo n s-,Cigwasa 7 wabanini. Kigicap madcawan wi piminicaiganit,Nanabucu animadca, udociman pima a nat. Cigwasa 7 acikawanitl isi /u uci kawanigubanan lni/u mo n son. Anlc, a pidcislgwanini. Misa i u a i-na a nat kaya mri wa i u acinama-20 tonit ini /u udociman;mi tigons ani-a^pagitoniti i-ma pangi
3i. THE DEATH OF NANABUSHU S NEPHEW, THE WoLF. 1Ah, truly pleasedwas Nanabushu. On the morrowthey moved camp. And with one of his nephews hewent off in another direction. He was addressed by hisnephew saying: "Nanabushu, not far away shall we stopfor the night." And so he followed in the tracks of hisonephew. Some distance on the way he saw (his nephew)seated in a spot free from snow."My father, here is aplace for us to sleep,"Nanabushu was told. After theyhad finished eating, he made ready to sleep. He thenhad a nap. And while (the Wolf) was yet sitting up, allof a sudden into weeping burst Nanabushu. Then hewaved to him with the hand. 3 "Foh, (I) fancy that heprobably is having a bad dream about he said of him.me,"When (Nanabushu) had sleep enough, he then woke up.Now, busy at work was the Wolf. "What were youdreaming about, that you should weep?""Ah, my nephew, I had a bad dream about you.To-morrow youwillpursue a moose. Please don t youdelay throwing a stick into the brook, even though youare then in sight of the moose. Now, do try to keep thatinmind."Now the morrow was at hand. In the morning, when(the Wolf) departed to go in pursuit (of game), Nanabushuset out in the trail of his; nephew he followed. Now, bythe trail he made, (the Wolf) was 3stalking the moose.By the way, it was well on towards spring.That washow he trailed up (his nephew), and that was how hecould tellby the trail (what) his nephew was doing ;1For other versions see Nos. 10 (p. 89), 45 (p. 389).2 In a disdainful way.3 It takes a great deal of manoeuvring to come upon the moose and not be discovered.
252slblnsiwa kamiganik ; cigwasa tapabamaniguban Ini /u mo n son;midac kaga t ki tci anigu k madcanigubanan Ini/u odociman;midacl s /u i icigwa tabibinanigubanan a 8 a /u maTngan a pidcipang! slblnsiwa kamiganik. Migu mmotc acawikwaskwa-/<ui*i5 nigubanan, ka/ijidiskf kag siblns, midac ima nanawagamka ijipangicink. Panagu kasaswanik Ini /u u tawagan.Mlsagu 4 s /u i kawln kimoskamuslg. Anlc mlsa kiwanandanktci-a^pagitod i u mi tigons.Nanabucu cigwa odababandan sibi pimi tigwayanik, l pana10 udociman pa kublkawanit. "A tawa! mlmawlnini-i u klnisabawatI a 8 a /u nindocim." Ani iji-acawa U t;miziwa nlzatciwananu i ca. Mlsa 7 kawln inkutci unamaasln.eGitcra niguk ajimawit Nanabucu;mlsa 7 kabagljik pabamawit,anunantunawat Ini /u udociman. Skwatci midasuo^un o anu-15 nantuna i gat, mlsa 7 kawln umi kawasln. A pidcisa cigwakawanandam.Ningutingigu nisatciwan icimadcat I 8 /u i isibi, ningutingsapapimacagamat, owabaman uglskimanisin agosiniti i manibl kang ima inabinit. Wagunamwinan ugaglma a n ;20 pacu7ododisan. Anawi icinawatinat, pangri-gu upicigupinan.Midac 4 8 i /u ka-i- pinagubanan, mri* u klnlskawayantipata s a /u uglskimanisl. Ajiganonigut uglskimanisin:"UtcltayapNanabucu mwlwlntamwaban win Ini /u u tojiman.""Tiwa, nicimisa 7 !wagunanwawlntamawiyan?"
253(he saw) that (his nephew) had flung a small stick aheadon going down into the dry bed of a little brook; (hesaw) where (the Wolf) had come in sight of the moose atthe time;and then really with great speed was his nephewgoing at the time ;and then now was the Wolf overtaking(themoose) at where there was a dry bed of a very smallbrook. But in an unguarded moment, when he tried totake it with a leap, apart spread the brook, and so farout yonder in the middle of the stream l he fell. Andat once there was ringing in his ears. And then he didnot come up to the surface. W 7 ell, this was because hehad forgotten to throw the little stick (ahead of him).Nanabushu then came in sight of a river that wentflowing by, straight on down to the water he trailed his"Alas!nephew.it ispossible that that nephew of minehas drowned." Then on over to the other side he went;everywhere downstream he went, but in vain. And sonowhere saw he a sign of him. With great affliction thenwept Nanabushu ; whereupon all day longhe wanderedweeping, as he sought in vain for his nephew. For fullten days he sought, but without result, for he did not findhim. Completely now was he starving.Now, once while down the course of the river he wasgoing, once while he was walking along the shore, hesaw a kingfisher perched aloft (and) looking down intothe water. What should he do but slip stealthily up toit; nigh up to it he came. In an attempt to grabit hejust missed catching it. And the place where the kingfisher was seized at the time was by the tuft on its head.Then he was addressed by the Kingfisher saying: "Aboutthe anal gut of his nephew was I going"Omy little brother! what were you goingto tell Nanabushu."to tell me?"1A stream that of a sudden and miraculously came into existence the momentthe Wolf disobeyed the warning.
254"Ka,kitocim. Ninganawabama ima nibrkangmra<ukri nabiyan; kanawabamag. Nanabucu, ambasano, klgawlntamonka i ciwabisit l a s 11awa mantcinawasiyan. MlginmrrIka/i cra yat a 8 a /u kitocim :ugimamicibici uglwuda pinanIni/u5 kidociman. Imadac sagitawag iu slbi mri ma ayag iY 11mlnisinatawanga ;mldac ima andaciklciganicit a 8 a /u ugimamicipiciklcpln mica kwatinig. A pidci minuglcigatinig mlpitclnag agwa tat rrma mlnisinatawangang. Nanabucu,kicpin babmi tawisiwan, kitawabama a s a /u kitocimiwayan,10 klpa kuna kuca a s a /u kidocim. Mlgu 4 8 i /u ka/i citabwa tawiyanka i ciwabisit i Y wa ka u-ndciwani-a t kidocim.Pa tanlnowan kanawanimigut. Kicpin idac win nondawiyan8i/u i ka i ninan, imlgu u wato tawatigu, tcitotawitiban.Ambasano mi tigwab klga u cra/. Kl kici a tidac, mlnawa15 klga-u citon s /u i ipikwa k -wa i i kayabatci toyan. Klgaminin/uisikanaba i-gayan."Nanabucu ominigon pajig mi /u uska n jmi. Ajikanonigut:"Nanabucu, mra wa kanaba-i gayan 4 8 i /u kibikwa k. Mamwatcidac apaskwackwai ml a u ka-u-da s tcablyan. A pidac,20 Nanabucu, wi pimwat, kagu"win wlyawink pimwa kan.Tcina tacink mri tinunk kapimwat ayangwamisin. Wlpisindawicin.Kayas i ianusagan tci u ji toyan, a pidcigu klgamistcatoni icanusagan. A, kicpin a/ta manidowiyan,miya ta iu kago tcina pinanat. Manidowi ugimamicibicl.25 Misagu l s /u i i mini k aciki kino a-monan. Ayangwamisin,kagu xanwa tawici kan."1The water-monsters of lakes, rivers, and seas. 2 From the fibre.
255"Why,about your nephew.I was watching for himyonder, where I was looking into the water- he was theone I was watchingfor. Nanabushu, listen ! I will declareto you what happened to him for whom you have a longing.Now, this was what became of :your nephew the chief oflthe big lynxes has seized your nephew. Now, yonder,where the river flows out into the open,is an island ofsand; and it is there the chief of the big lynxes whilesthe day away when the sky is clear. When the day isvery pleasant, then from the water he proceeds out uponthe sandy island. Nanabushu, if you heed what I say,you can behold the skin of your nephew, for flayed wasthat nephew of yours. Therefore shall you believe melost him.concerning what befell your nephew when youBy many is he guarded. Now, if you harken to what I sayto you, then whatsoever you may wish to do to (the chiefof the big lynxes), that you may do to him. Thereforea bow do you make. And when you have finished it, youshall next make the arrow which youare to use. I willgive you what you shall use for a point (on your arrow)."Nanabushu was then given one of the claws (of thekingfisher). Then he was addressed: "Nanabushu, thatis what you shall use for a point on your arrow. Andof all things,it is from flag-reed3that youshall obtainyour bowstring. And when, Nanabushu, you are readyto shoot him, do not shoot him in the body. Where hecasts his shadow 3 is the place for you to shoot him. Doyou be careful that you heed my words. Likewise a raftshall you build, and very large shall you make the raft.Oh, if you were only a manitou, then would you be ableto get him under your power! A manitou beingis the chiefof the big lynxes. Now, that is as much as I shall impartto you. Take pains, do not fail to follow my words."3Shadow and soul are associated together as the same thing.
256"O un , mlgwetc wandamawiyan. Mackut, tcipicigantamankiya /uklga-i-cH-n.""Mlgwetc, Nanabucu, Wwa a kitoyan."Mlsa cigwa Nanabucu madci tad wawacra/t ugiskimanisin.5 Cigwasa ka klcra/t,"Mrr u iciwabandisun, ugickimanizl,"udinan.Misa gaga t ajiwabandisut, gaga t piciganimuuglckimanisi.7"Mlsaca s a /ui u ka icinagusiyan tcra nra- kiwank,"i kido Na-10 nabucu. Mlsa 7 Nanabucu ajimadcat, msatciwan icat.Pacugu tagucink, kaga t owabandan saga i gan. Wagunaniwinanudoci ton/u i iI 8anusagan, a pitcigu umi s tca ton.Ka klci tot, ajiposit aji ijat ima minisina tawanganik. Wagunaniwlwinanajikabat ima rni tawangang. A taya, awiya15 pimi kawawa^ anotc , awiya pimi kawawa 8 . Mlsa 7 cigwanayap ajiposit, ingutcidac ugaton 4 8 /u i utclman. Misacigwa madci tat umi tigwabln uci a t kaya I 8 /u i iupikwa k ;uji tod kaya 4 8 i /u kanaba a*nk, udocka n jlman naba i gagat.Wawinga ka klci tot, cigwa tibi kadini. Misa cigwa ajiwa-20 baninig, Nanabucu ajiklgitut: "Ambasano, tawi a nwa tinkabaglcik, kayagutciwlmicakwa k."Nanabucu oma nawatciguno pimmg aji a-satisagu kasut.Cigwa prrcpagotcinonini /u kisison, owabandan kagicibatciwaninik 4 8 i /u saga i gan.Ni tam omaka km mockamowan, kayagu anotcigu i i wisa25 manido 8 ,ka l kina awiya mlgu 4 8 i /u pamlcagwa tanit iminisinatawanganik. Mlgu iu piminibanit anint."Ambasano, aiyangwamisin," i kito au ma kwa :"Indigu
257"Oh, (I)thank (you) for what you have told me. Inreturn,I will make you so that you will be proud ofyourself.""(I)thank (you), Nanabushu, for what you say."And so then Nanabushu set to work painting the Kingfisher. When he was done with him, "Now look at yourself, Kingfisher,"he said to him.It was true that when he looked at himself, really proudwas theKingfisher."And this is the way you shall look till the end of theworld," said Nanabushu. Thereupon Nanabushu startedaway, down the stream he went. And when a short wayhe was come, sure enough, he beheld a lake. Whatshould he do but build a raft, and very large he made it.When he had finished it,he then got aboard (and) wentover to yonder sandy island. What should he do but goashore upon yonder sandy beach. Lo, living beingsleftthe signs of their footprints, all kinds of living creaturesleft the marks of their tracks. Thereupon then back onhis raft he went, in a certain place he hid awayhis float.Thereupon he set to work making his bow and his arrow;he also fixed what he was to have for a point, his clawhe used for the point. When all his work was entirelywhen it wasdone, by that time it was night. Thereupon,day, Nanabushu spoke, saying: "Now, let there be a calmthroughout the whole day, and may there be a very clearsky!"Nanabushu then, in this placebut towards thewoods, became a poplar. When high the sun was risen,he beheld moving circles upon the water of the lake.First a toad came up to the surface, and then the variousmanitous, every living being then came forth from thewater out upon that island of sand. And as fast as someof them came, they went to sleep."Please be careful,"said the Bear. "Itsurely seems17 PUBL. AMER. ETHN. SOC. VOL. VII.
258kuca Nanabucu klganawabamigunan, nintinandam. Amantcisanaka/r kitogwan a s a /u kitogimaminan."Inabit Nanabucu, panagu kawasatigusanik. Ningutingsakunigimn, micibicln!pamagu nawagam wantcimoskamunit ;5 Gaga t :minditowan, pinabiwan, madwaglgitowanbucu awati kanlbawit, asatlsagunk krrcinagiru*.""NanaAnintigu madwagigitowa 8 :"Kaya t ayaban a c a /u asatisag.""Kawm, mlgu ya s a /u ka icinagwa U t."Anintidac i kitowap;: "Pa katciofananta manitowit ta i cioo10 nagirir naska guca 7 , miciginabi k, awititibina kwablga 11 ."Kaga t pimadcawan kinabigon. Cigwasa 7 udodisigon,mlsa 7 ajikaskabigi tanit anigu k. Anlc kibanamu Nanabucu.Kwa tcigu wa pagitanamut, acra/nawantciganit. Aniglgitowan:la c a /u ! Anm1 5 kayawit?""Mitigkagri cinagusit Nanabucu7kawln tabwa a nda n zi a s a /u ugima. "Taga, ginma kwa, awibasagubic. Ml guca a u Nanabucu."Cigwa pi a yawan Ini/u ki^cima kwan. Cigwasa udotisigon,ajibasagubinigut. Wibagu uponi i gon, anijimadcanit.20 "Amnkaglcinagwak Nanabucu kayawit? - - Mri -u ici a*-gwa tan."Kaga t pimi a gwa tavvan. A pidci nawayaT kawicimowan.Nanabucu ajikanawabamat, kayabi ku wandcimayawikwaninit. "Wrkagasa a pitci tawiposangwami, ka kinagu25 kaya i si /u udockinawama 8 tawiposangwamiwa 8 ."
259that by Nanabushu are we being observed, thus do I feel.(I am) curious to know what our chief may have to say."While Nanabushu was looking, everywhere was theresplashing of water. By and byall of a sudden far outupon the water something came up to the surface; behold,(itwas the) Big Lynx! Truly big was he, hitherward helooked as he came. He could be heard saying:"Nanabushu is the one standing yonder, the form of a poplarhas he taken."And some could be heard saying: "Longsince hasthat poplar been there.""No, it isreallyhe who has taken on its form."And some said: "He is not so powerfula manitou asto take on such a form. Why, Big Serpent, do you gocoil round about him."Truly hitherward came the Big Serpent. When (Nanabushu) was reached, then did (the Serpent) squeeze himtight. Of course Nanabushu held in his breath. Just ashe was about to breathe, then the Serpent thought it afruitless task. Away he "Awent, saying: tree that! Howis itpossible for Nanabushu to become such a thing?"But the chief did not believe (what the Serpent said)."Isay, you, O Bear! go claw him. It surelyis Nanabushu."Then hither came the Great Bear. When (Nanabushu)was reached, he was clawed it.by And in a little whilehe was let alone, then away started (the Bear)."How isitpossiblefor Nanabushu to become so? Thereforecome you out of the water."Truly on out of the water it came. In their very midstitlay down to sleep. As Nanabushu was watching it,every once in a while it would lift upits head to lookaround. "Would that itmight fall into deep sleep, andthat all itsyouths might sleep soundly too !"1 Willed by Nanabushu.l
260Kaga t ka kina nibawa 8 .Cigwasa Nanabucu nayap anicinabaw 1 , ajiicat udanusaganing.Niminawa kru ajrcrdoti tank rrma antacinibanit.Ajikabat, anasawayaT anitata ku kl iY 11 manido 8 .Cigwasa5 udodisan Ini /u ugiman. A pidci waca pinit upimwan.Kawin kanaga kuckupagisusiwan. Paba pinisiwagan!si iKayabi pajik udaiyan /u upikwa k ajimamot. Midaci i ma pitclnag atcina tacininit, acipimwat. A tawa, kuckupagisowan.A tawa, ki tcibawi tigowanini, agawagu ododi-10 tan i u udanusagan. Mlsagu iu cigwa anini kiblnik 4 s i /usagaigan kaya i u wadciwan. A tawa, sagisi Nanabucu.Cigwa ima pibonlwan Ini /u ugickimanisln ajikanonigut:"Nanabucu, mlsa i u iniga a t a 8 a /u pamadisi pan crcrmaa king."15 Panagu kawanataganit, anode awlya. Kwa tcigu na kibinitnayaps /u 8i i mi tigo mi a-, pl acinogimocka a-ninik. Kunigimn,anrrska tani."E e e^," udigon ugickimanisln,"Nanabucu kawln kinisaslugimamicipicl!"32. NANABUSHU SLAYS TOAD-WOMAN, THE HEALEROF THE MANITOUS.20 Misa x nayap a kublyanigiban kra* kublyani k. Aba picnayap ka a- kublyanik, mlsa 7 cigwa wawanigu udonabandanwa tat. Midac i i ma wa U ntclt 4 8 i /u tayoc wlnantuna i gat.
"26lSure enough,all went to sleep.In a while Nanabushu became a human being again.Then he went over to his raft;he poleditalong as hewent over to where they were asleep. When he wentashore, in among the manitous he steppedas he wentalong. Presently he came to where the chief was. Squarelyin the side he shot him.No surprise whatever did (the manitou) display. TooHe had yet one other arrow, which hebad (for him)!took. And so there, where (the manitou) then was castinga shadow, was where he shot him. Behold, then was (themanitou) startled with surprise. Oh ! but there was amighty rushing of water, and barely did he reach his raft.Thereupon then under water went lake and mountain, oneafter the other. Oh, afraid was Nanabushu ! Then yonderwhere he was, alighted the Kingfisher by whom he wasaddressed: "Nanabushu, therefore now have you doneinjury to them that have been living uponthis earth."Oh, everywhere were they swimming about, beings ofevery sort ! And as the trees were about to disappearunder the flood, then was when the water ceased rising.Lo, the water receded, leaving (the earth) as dry as before."Well, now,"he was told by the Kingfisher,bushu, you did not kill the chief of the big lynxes!"Nana32. NANABUSHU SLAYS TOAD-WOMAN, THE HEALEROF THE MANITOUS. 1Thereupon back to its former depthdid the waterrecede. When the water got to where it was before, heaccordingly then with care selected a place where hewould have his lodge. And so from there he intendedyet to seek (for his nephew). And so while wandering1For other versions see Nos. 18 (p. 145) and 46 (p. 399).
"262Mlsa / kayabi pabamatamut, ningutingsa awlya onontawanpiminagamunit:"Akiya kwag nimbicinawicin, nimbicinawicin sa".A kiya kwag nimbicinawicin, nimbicinawicin sa n ."5 Udini tawan awiya piminagamunit. Wagunanlwinanuna n zrtawan. A pl tababamat, kunigimn, umaka kln pimiyantcikwaskuniwan.Wlgubln pamotaminit, kaya ciclgwananupimiwinanini udodananingta kubisowan. Nlbiwadac lni/uwlgubln bamondaminit ajimawinanat. Aji U disat, anlc,10 a pidci mindimoyayan."Noko, amn wandcinagamoyan?"Nanabucu kuca winantubi kasu. Miwaninu"Ka, wayabadakin ono /Ll wlgubln kabimondaman. Nanabucu kucac/uwin ka pimwatIniugimamcibicln."s"No ku, anln win /u i i wa irndcinandobi kasut a 5; a /u1 5 Nanabucu ?""Ka, kawlnac win mlgu iu ajisagisininik l c /u i iubikwaa s a /u Nanabucu. O 8 o /u odana mri ma pa u ndclyan. Midacima ayawa pimadisi a s a /u ugimamcibicl."lks"No kumis! amn dac win u i iWwa kipiminagamuyan?"20 "Ka,kawlnac win nlnanantawra/nan *a 8 a /u ugima, mldaci u ana-a man i^wa nanandawi a g:A kia kwag nimbicinawicin."Mlsa i u a pidci ginin nimino tago. Nagamun unicicin."1Other translations of the song would be: "From the beginning of the worldhas the sound of my voice been heard; From the ends of the earth is the sound
"From"O2 6 3about weeping, he once heard somebody going alongsinging :"From the ends of the earth do I come with the sound of my rattles, sa".come with the sound of my rattles, sa n *."From the ends of the earth do ISuch was theway he heard some one sing while goingtowards the sound ofalong. What should he do but gothe being. When he came in sight of the being, lo, (hesaw that)it was a toad 3 leaping along from place to place.Some bast she bore upon her back, and some rattles shecarried bound to her heels. Now, a gooddeal was thebast she carried on her back when he rushed up to her.On coming up to her, why, she was a very old woman."Omy grandmother! for what reason are you singing?"a snare is "Oh, really to be laid for Nanabushu. Andto bethis bast which Icarry upon my back is the thingused for the purpose.It was Nanabushu who really shotthe chief of the big lynxes."my grandmother!pray, whyfor Nanabushu?"is a snare to be set"Oh,well! it is for the arrow of Nanabushu, which isnow sticking out of (the chief of the big lynxes).Fromthis town yonder do I come. And over there hardlyalive is the chief of the big lynxes.""Omy grandmother! pray, what was that you weresingingabout?""Oh, why, we are ministering to the chief;and this iswhat Ising when I am attending him :the ends of the earth do I come with the sound of my rattles."It is so much pleasure Iimpart when I sing.The songisfine."of my coming heard." The second rendition is preferredto the first, but the onegiven in the story is preferred to all.2The old Toad-Woman, mother earth.
"No ko! anti tinunk ?"namadapiyan"Apitcigu mayawickant mi ku ima andanapiyan. Iwitacka/rcictcigawat, abi ta kackikibita ;mldac iwitiawasayaTcingicink a 8 a /u nintogimaminan."5"Antidac win H*uandayan?"ima a kwa"Migu kwag antayan. A pitcigu aga n ssa /u i iniwlgiwamans. Kayadac niciwag nocisag, a pidcigu paplwiclyowagkwlwisansag ; miya tagu Igi /u watigamagwa.""No ko! anm win rr u ka*i*cinawa a t Ini /u Nanabucowan?"10"Ka,kanawm ugl u da pinamawan Ini /u odocimini. A pidciNanabucu usagi a banln mi /u udociman. Mldac l s /u i i klniskia t,ka irndcipimugut."ei infi "A,amnguta win aci kawagubanan au ugimamcibicmxwa mamawagubanan!ni /u udocimini? Kawmsa win aga n si15 manidowisl a 8 a /u Nanabucu ajinikasut."Uta taganabamigon:n"Nya , magicakin Nanabucu!""Ta tiwa! Kawln mlni k i/uikitakaganonigusl Nanabucufiawit. Mawica kitanlwana*u*k klcpin awiyan Nanabuco.No ko !taga, minawa madclan !kinagamun Kawln gwatc20 ningi kanda n szm /u i ikinagamun."Amc kayabi:kia "Akwag nimbicinawicin, nimbicinawicin, sa".A kia kwag nimbicinawicin, nimbicinawicin, sa"."uWagunaniwinan Nanabucu uniwana wan. Taga, awa-25 naniwmana a u matcimindimoyacic."A taya, Nanabucusumatcrkawani ipa kunat, wawlnga uba kunan. Ka ki-
"NonsenseAh2 6 5"Omy grandmother! at what place do you sit?"In the very middle of the doorway is where I always sit.Now, this is what they:have done apartition divides thespace in two equal parts ;and so over on the other sidelies that chief of ours.""And where is ityou dwell?""Why, yonder at the edge of the forest do I dwell.And very small is that littlewigwam of mine. And thereare two of my grandchildren, and very tiny are the boys;now, they are the onlyones with whom I live.""Omy grandmother! how was it that (the chief) angeredNanabushu ?"he"Why, actually took hisnephew away from him.Very fond was Nanabushu of his nephew.It was on thataccount (the chief) angered him, which was why he wasshot (by Nanabushu)."the chief"Now, pray why should he be so treated byof the big lynxes as to be deprived of his nephew byhim? By no means a small manitou is he who goes bythe name of Nanabushu."She lifted her head and looked up at him: "Ah,me!Nanabushu !"perhaps you are! Not so long as this would you be held inconversation if it were Nanabushu. Long ago would youhave been clubbed to death if I were Nanabushu. O my!grandmother do start that song of yours once more !Not exactly yet do I know that song of yours."So once more :"From the ends of the earth do I come with the sound of my rattles, sa".From the ends of the earth do I come with the sound of my rattles, sa"."What did Nanabushu do but club her to death. "Well,Nanawhat a fool this wretched old woman (was)!"bushu then set to work flaying her, from every part he!
266cipa^kunat, a pitci agacPyi kasu Nanabucu. Wagunamwinan/uajiplsikawat lni umaka klwayanan, wawlnga udapickawan.PangI oma upwaning uga kikickawan. Ka plsi kawat,Ini/uuclcigwanan udondanank uda kupinan, kaya Ini /u wigupln5 udompontanan. A, Nanabucu ajikwaskwanit ajimadcra nk :A ki a/kwag nimbicinawicin,nimbicinawicin, sa".""Aki-a/ kwag nimbicinawicin, nimbicinawicin, sa".A pitcigu kiclwa piminagamut. Caylgwa udababandanodana. Aba pic a kwa kwanig tagucing, kagat owabandan10 wlgiwamans."Mima wmi i11ka i tank,"inandam. Kumagua plsinagwatiniwanIni /u wigiwaman. Amc, a pitci anigu kpiminagamu,nontawa piminagamut.Pajik ajikikitut: "A 8Mri/>ucigwammawa tcia-wisagaswa a k.", cigwa mmawa ko konan pitwawitam.15 Ml cigwa ani U di tank wlgiwamans, nayagigu pisaga a*mo ckwlwisansa 8 . "Noko, kitagwicinina?"s"Aye , nosisitug, nintagwicin." Amciplndigat, wagitcitclngwannamadabiwa 8 C 8 /u i i osisa 8 .Wagunaniwinan pacigIni /u osisan owabamigon ma klka kikickawat i i Ini/u uma-20 ka klwayanan."Noko, amn win i i ma kri cinagusiyan?Anicinaba wacaga a/ngkidicinagus.""Ka,nimbigwa tagl icl kamani ku Ini /u wigupln wra ntawapi kasut a s a /u Nanabucu."A pidcisa ki tci anigu k naganun. Mlsa gaga t ka prijisa-
267removed the skin. After he had finished flaying her, verysmall then Nanabushu made himself. What should he dobut get into the toad-skin to wear in it, every respectdid he fit into it.Slightly here on the hip he tore it.After he had got intoit,then he bound the rattles tohis heels, and put the bast uponhis back. Ah ! as Nanabushu went leaping along, he then began to sing:"From the ends of the earth do I come with the sound of my rattles, sa".From the ends of the earth do I come with the sound of my rattles, sa"."And very loud was the sound of his voice as he wentsinging. In a while was he come in sight of the town.When he was come at the edge of the forest, sure enough,he saw a small wigwam."This must be what she spokeheof," thought. Farther on was a view of the wigwams.Now, ever so loud he sang as he went;he was heard ashe went singing along.One then spoke up: "Yea,now once again comes thesound of our dear grandmother singing. Therefore nowto smoke."again should you invite her to the gatheringThen presently, as he was about to arrive at the littlewigwam, but before he got there, out came the boys."Omy grandmother! have you"Yes, my grandchildren,come home?"I am come home." When inWhatshe entered, then on her lap sat her grandchildren.should happen to him l but to be seen by one of hisgrandchildren at the place where he had torn open thelook thattoad-skin. "Omy grandmother! why do youway there? Like the skin of a human being is the wayyoulook there.""Oh,I wore itthrough while at work on the bast (tobe used for a snare) that is to be laid for Nanabushu."As loud as she could she sang. Thereupon truly was1Gender is confused here, but it is given as in the text.
"268gaswa i nt, midac ka ijimadcat. Cigwa ko konan ubacwabandan4 8 i /u wlgiwam. A tawa, ckwantank anln ka/rcinankudocimiwayanan kipickwantaigawan. Mlgu iu wipitani;acigigisininik.A tiwa Nanabucu !mlgu u /ui acislgisanik Ini5 usklcigon. Kagagu ajiki s tcimawit, wawicwm a l pl anipakintanank.Panagu a pitci mockinawa8 wananatawi*i wanit.lIckwantank aciwunapit. Kaga t owabandan 4 8 /u i kacki l kipitanik,midac iwiti antanwawitaminit !ni/u ugiman mamatwanit.Cigwasa 7 madci tawa 8 nanatawrrwanit. Mlsa i u10 ajipacitcitaku kiwat iwiti antanwawitaminit lni /u mwa kunanit.Amc pa tanlnowa 8 .Cigwasa 7pacunagwatini kaya win 4 8 /u i tcimadci tad, cigwakaya win wlnanantawrrwa. A taya, Nanabucu ajimadci tat,umatciwabinan Ini /u clclgwanan, a pidci anigu k :nagamuI 5"A ki-a/kwag nimpicinawicin nimbicinawicin, sa".A ki a kwag nimpicinawicin nimbicinawicin, sa"."a p!Ina a m. Caylgwa pasigwl ajiicat ugimamicipicln. A tawa,ani o nabrtawat, wantcidagu waca pmit I i 8 xli wa ubikwa kklsaga kusinini. Mlgui u pagitanamunit, ana kuskanik.s20 Wawanigu udota pinan /u i i ubikwa k acicicigwanawat.A ta 7 Nanabucu, ajipasiguntcisat, acika kikiwabickawat Ini /uumaka klwayanan, mlgu ima wantcipapicigunint. A a eMmlsa i u piya pitcinanat C a 8 a /u Nanabucu mi /u kitogimaminanin."
269she invited to the assembly to smoke. Accordingly thenshe went. Presently our grandmother was approachingnigh to the wigwam. Oh, in the doorway what shouldhe l behold but the skin of hisnephew then being usedfor a flap over the entry-way. And there still were leftupon it some of the teeth (of his nephew). SorrowfulNanabushu ! then did tears pour from his eyes. Andalmost did he weep aloud, especially when opened theflap on his way in. Throughout every part was the spacecrowded with them who were to heal. By the doorwayhe sat down. Sure enough, he saw that there was apartition, and it was over beyond he could hear the soundof the chief as he groaned in pain. Already began theywho were to do the healing. Thereupon (the throng)stepped over to the place where they heard the sound ofhim who was suffering.Of course they were many.Now the time drew nigh for him also to begin, nowhe too was about to begin healing. Well, when Nanabushu began, he began wielding the rattles with a swing,very loud he sang:"From the ends of the earth do I come with the sound of my rattles, sa n .From the ends of the earth do I come with the sound of my rattles, sa n ."(Thus) he sang. Presently uphe rose to his feet whenhe went over to the chief of the big lynxes. Ah, whenhe went over to sit beside him, squarein his side wasthe arrow sticking out. Accordingly, when he breathed,then to and fro moved the arrow. Now with care (Nanabushu) seized the arrow, which he worked back and forthinto him. Ah ! when Nanabushu sprang to his feet, hethus tore up that toad-skin of his, whereupon they triedin vain to catch him there. "Alas! it was to kill thischief of ours that Nanabushu came."1Gender is confused here, but it is given as in the text.
A270Migu ima anro ntcipa kibinat ini /u udocimiwayanan.A tawa, mlgu u ipa/a^kublnik pimoskaaninik, anunatciba r-wat 4 8 /u iudanusagan. A tawa, mintcimigu cigwa udanupacwantan,cayigwasa mldac a ta ustigwan anisagibatot.5 Caylgwa udababandan, agawa udodi tan mldac; aciposit9 /u i iudanusagan, a tawa Nanabucu, skwatci na kiblni kwatciwan. A ta/, ki tcikabaya*! kayabi klmoskaanini. E 1anicagu kawanataganit i 8i /u awaslya 8 kaya igi /u pabamisanit.Anintigu udanaposi a 8 paplwicri nit ;ivvidac win mamandi-10 dunit anicagu sa kikwagumowa 8 . Po tcidac migu i u kintablckaminit4 8 /u 7i utclman. "Misaa ki kang klgataiyaslmin,"inandamog.kawln wi ka minawa,aMimawmi-i u kaga t pata tcigayan," inandam. Oganona 8awaslya 8 : "A tawa mlsa u 8iklwanrkayan /u i i a ki.AmbagicI 815 i ipang! pra-yayamban/u a l ki !Ambasa, kawm ina awlyaodabltosm 4 8 /u i a ki? Klcpin cacagowisiyag ml iu ga kinatciniboyank. Minotc mini k na tagogiyag, nantawabandamul8k /u i i a ki.Kagu 7 win mamawmu kagun, aiya kowatckigamadcam."20 Mldac a s a /u mang ni tam kanonint :nantawabandan"Taga", kin,8 /ui i a ki.Ayangwamisin wlpldon."ni tam"Anlc,mlnotcsa,"i kito a s a /u mank. A ta, a 8 a /u mankta a , pa n kwaglt. A tawa,nontagusl: a wlwiwi "A !", wl kagu klyaboska a-guntcisawan. A tawa acimangwan25 wada pinat. Nanabucu ka/u da pinat, acibabwatanat, mlsa 7nayap krpimadisinit. Ajikanonat:"Anln,kawln ina kigl-
And then from its place he tore off his nephew s skinas he went. Oh, thereupon, as the flood came, as thewater rose, then he fled, seeking to find his raft. Oh,at the very moment when he felt he was getting near toit,then already was he going along with only his headout of the water. Presently he came in sight of it, barelydid he get to it;and when he got aboard his raft, poorNanabushu (saw that) now under water were the mountains.Why, for a great while did the water rise. Well, to swimaimlessly about was all that the animal-folk and the beingsof the air could do. Now, some that were tiny he triedto put aboard ;and those that were big hung to (the raft)by their chins. Yet, for all that, his float was weigheddown with its burden. "Therefore never again shall webe upon land," they thought.it is"Perhapstrue that I have done a wrong (whichmay never be herepaired)," thought. He spoke to theanimal-kind, saying:"Pityit is that Iforgot (to fetch along)some earth. Would that Imight have brought a little !Now, is there no one able to fetch some earth? If youcontinue passive, then shall we all die. Even so, do you,as many as are good at diving, go seek for some earth.Do not allgo together, one after the other shall you go."Accordingly the Loon was the first to be addressed :"Isay, you, do you first gocare that you"Well,fetch it."seek for some earth. TakeI will try,"said the Loon. Lo, a crywas heard to give: "A,the Loonwlwlwi!" Oh, then down hedived into the water. Why, it was a long time beforehe came back up to the surface of the water. It was apoor dead loon (Nanabushu) then picked up. After Nanabushu had picked him up, he then breathed upon him,whereat back to life he came. Then (Nanabushu) spoketo him, saying: "How now? Did you not come in sight of
tcra/naclkatababanda n zin272s /u i i a ki?"AjikarionigutNanabucu: "Kawinkanaga ningltababa n dazln, mi a p! ka-rciwanantaman."A pitci sagisi Nanabucu. "Ambasa, gin ami k, taga kin.Pamagu nipuyan mri />utaman. Kagu win magwa5 pimatisiyan pigiwa kan."A taiya, misa 7 kaya win a kawa nondagusit ami k.A pan kwagltla fi a /u ami k. A tawa! pabima kwaciwat l a c a /uami k, mlgu u i cigwa wanantank anutababamat;4 8 i /u mitigos ,misa ka i ciwanantank.10 Mlsa 7 Nanabucu, aya kawabit. A tawa! ningutingiguki u ndcaboska a gun tcisawan mlnawa /uudagwacimanIniami kwan utclmaning."A tawa, acimadcl, mlsa x kinisabawatniclmisa!" Mlsa minawa ka ijipabwatanat, misa / nayap: "Anmkrpimadisinit. Ajikanonat ka i ?"ciwabisiyanc"A15 tawa, mlgu u i itababamagwa mi tigog, mi a piciwanantaman.""Amcna, misa gaga t nibuyank. Intawa mri/<uka i*-kinana tagoglyak icimamawlnuyu k. Iwitac ka icictcigayak,pamagu nibuyakklgayanicl tam."20 A taiya, anic ga kina mini k na tagoglwat acigoglwat.sAnic inandam nigik tcibltot /u i i a ki.Cigwaa kawa nawatcimowag,a pa/n kwaginit, a taiya, tci a yanagotcininit.Mini k pabima kwaciwawat, anintigu tcibwadababandamowatmri u ajiwanantamowat. Aninti dac kaya abi tawa tig25 mi tigunk mri - uajiwanantamowat; misa 7 kawin kanagapangi awlya ubldosln 9 /ui i a ki.Anicaya tagu, kawanagun-
273the earth?" Then was Nanabushu told: "Not even didI come in sight of it,for when (on the way down) did Ibecome insensible."Very much afraid became Nanabushu. "Now, you,Beaver, do you (go). Not tillyou are dead shall yougive up. Do not return as long as you are alive."Lo, therefore the Beaver too, before (he went), was heardgiving forth a cry. Then down dived the Beaver. Alas!as down through the water the Beaver was going, thenwas when he became unconscious; (itwas when) he triedin vain to get sight of the trees that he lost his wits.And now Nanabushu was keeping watch. Alas! by andby up to the surface he came, and he drew the Beaver upinto his canoe."Ah,what a pity,now that drowned ismy little And brother!" so again, when he had breathedupon him, then accordingly, as before, (the Beaver) cameback to life. Then he spoke to him, "Howsaying: didyou fare ?""Why, just as I was coming into view of the trees,then did I become insensible.""Well, then,it is certain that now we shall die. Therefore then do allyou that are good at diving go hencetogether. And this is what you shall do, not tillyou aredead shall you give up."Behold, naturally, all that were good at diving thendived into the water. Now the Otter thought that hewould fetch the earth. So before starting they (all)whooped, then down they dived, (being gone) oh, till they(were drowned and) came floating to the surface. Of asmany as went into the water, some became unconsciousbefore they got sight of the earth. And now some werehalfway down the trees when they then lost their wits ;whereupon not even a small bit of earth did any onefetch. Yea, of a truth,1 8 PUBL. AMER. ETHN. SOC. VOL. VII.afloat on the water were all those
" lA274tcininit mini k anugl kogmit. Ajra gwabiginat, mlnawaajibabwadanat, mlsa nayab ajipimadisinit ka kina. Mldaclsiu i :anigagwatcimat"Awanan ka pacwabandank 4 c /u i a ki?": "NmsaNigikidac / klgito nlntanugipacwabandan."5 "Amnigu wa pl?""Kawm win abi tawa tig nawatc paci/ ningrirsabandan4 8 i /u a ki."x"Taga, mlnawa, nigig."OOjO -TMlsa ora^a t ajikoglt, pabima kwaciwat :tcibwagOua kwana-"10 bawat, mri cigwa tababandank C 8 /ui i a ki mindci migupacwabandank, aciwanantank. A tawa! Nanabucu untci a-8boska a guntcisawan."E mlsa 7 , gaga t Intawaniboyank."nayap udoda pinan. Babwadanat ajigagwatcima:ka ijiwabisiyan?""Anmx15"Misaundcita kawm nindakacki tosm nm tcibidoyamban."A tawa Nanabucu mlsa !gaga t sagisit. Tiwa, uglmikwanimanlni /u wajackwan. km."Taga Minotc, wa-,jack,kogln."20l"Anic, mlnotc mano kaya mn ninganisabawa."a/u, wajVck, aiyangwamisin."Ta, waja^k osou odompinan ; cayigwa, kwatcak ! inwawagamicinon.A ta x !waja^k pabima kwaciwat, ningutingiguutababama 8 8mi tigo. Kawm anawi a pidci a kwanabawasl.Cigwa abi tawatig mi tigunk ododi tan ; mlgu x cigwa x wa-25 nantank tagwicing iwiti asking. Ajikana kantank i 8i /u a ki",kaya anint unintclnk ugani kibi ton. Mri ma utcitca l kank
"HowConsequently,"Now275who had tried to dive. When he drew them out of thewater, again he breathed upon them, whereupon back tolife they all came. And then he asked of them, one afteranother: "Who was it that got a near view of the earth?"And the Otter "Ispoke up: myself tried to get withineasy view of it, but without success.""And how close?""WhyI saw the earth."I was more than halfway down the trees whensay, once more, Otter.""IWhereupon truly down he dived, down into the waterhe went;and before he was out of breath, then he camein sight of the earth. And the moment that he got withineasy reach of it, then he became insensible. Alas ! Nanabushu(saw) him come floating on the water."Oh,therefore certainly now shall we die !"just asbefore, he took (the Otter) up. Breathing upon him, hethen asked of him :"Why,did you fare ?"it seemed fated for me not to be able to fetchhome (some earth)."Poor Nanabushu !thereupon truly was he scared. Behold,he remembered the Muskrat.you, despite ourfailure, Muskrat, do you dive into the water.""Well, anyhow, I will try;but I too shall drown.""Good, Muskrat, do allyou can."Ay! the Muskrat lifted his tail; then "kwatcak!" 1 wasthe sound he made as he dived into the water. Ah ! asthe Muskrat was on hisway through the water, he byand by came in sight of the trees. Not so very muchout of breath was he for all that. In a while halfwaydown the trees was he come and when he; got to theearth, he then became insensible. When he took someearth in his mouth, he also took up some in his paws.1The sound of the water as he went down.
2769 /u i i uso u kaya wlnaga tig. Magwaguajitcanga kuskanigNanabucu a kawabamat, a/tiwa ningutingigu undcra/bockaa gundcisawan wantcitogu kapikwa kwataguntcminitigu.Mlnotc ododa pinan Nanabucu. Anica totank, uba ka kin-5 intclbinan. .A tawa, a ki uglkaska kunintcantamini. Mlnawaacawinintc mlnasab, a ki uduntcimi kamawan. Ima udcitcakayanink udici a-ntawabandamawan, kayabi a ki umi-^kwunamawan ;kaya iwiti pindcikuna/ nawatc 11 nlbiwa udontcimikamawan. Mlsa ajibabwadanat mi i* u mlnawa ka iji-10 pimadisinit.Acibasanks /ui i a l ki, "Mlsa(8 /ui ikaga tcigici toyan 4 c /u ikra*-a ki." Nanabucu acibodatank, kunigimn! minisansgwantani. Mig^ aca wl pimi-a gwa tanit l c /u i i manidowanca 6 ,ajikanowat:"Ba ka, pama nawatc mi s tcag agwa ta kag."15 Mmawa ajipodadank, ki stciminis kra-gwantani. Mldacima ki s tciba tanmatinink ka ijibotatank, mlsa cigwa pimadislwaganimunit/u manitowanca 8 . Mlnawa madcici i tapabwatatank 4 8 i /u a ki.Ajiganonat Ini /u kaclsanit ka kakwan:"Taga,klwitasan o O a ki amantc anigu kwagwan20 oo /u a k ki."Gaga t ajimadcat ka ka k. Kumagu kla pi tanti, cigwatagwicinon ajikanonigut."Kawln a pidci mi tasinon."Mmawa acipodadank, kabaya*! taci tababwadadank.Mlnawa oganonanIni /u :kagakiwan25 wlki kadan amantc aniku ckwagwan ii /u"Taga,a ki."km kagagi,
277Then there between his groins he flunghis tail and hisstiffened penis. Now, while Nanabushu was watching forhim, why, by and by (he saw) the poor creature floatingon the water (looking) quite (like) a ball that was carriedon the flood. Even so Nanabushu reached down andpicked him up. Doing it in play, he opened out (theMuskrat s) paws. Why, (the Muskrat) was holding fast tosome earth in his clinched paw. Likewise in the otherpaw, in just the same way, he found him with some earth.There in his groins he sought to find him with it, evenmore earth he found upon him and there in his throat;too he found him with much more. And so when hebreathed upon him, he then came back to life.When he had dried the earth (he found on the Muskrat),"Therefore now am I about to create the earth." WhenNanabushu blew his breath upon it,behold ! asmall islandfloated on the water. Accordingly afterwards the smallanimal-folk were eager to go out upon it,when he thenspoke to them, saying: "Wait! not till it is larger mayyou go outit."uponWhen again he blew his breath upon it,a great islandwas floating on the water. And so upon the place wherehe had blown his breath there was much earth, whereuponthen began the little animal-kind to feel themselves secure.Once more he began breathing upon the earth. Then hespoke to the swift-flying Bird-Hawk, saying: "Now fly youround about this earth and see how large this earth is."Sure enough, away went the Bird-Hawk.For some timewas he gone,in a while he came home. Then was (Nanabushu) told by him, "Not so very large is (the earth.)"When again (Nanabushu) breathed upon it,for a longwhile was he busy breathing uponit. Next he spoke tothe Raven, saying: "Now, you, Raven, do youfind out howbigthis earth is."
mi>uMlsa!"2 7 8Kaga t ajimadcat l a s a /u kagagi. Amantcltug tasuglsisanantit kagagi; wl ka tagwicin. Cigwa tibatcimu : "Kawmninglmi l ka n zm amantc aniku kwagwan I o 8 o /u a ki, migu i uka/rcindntaklwayan."5Nanabucu dac ajiganonatIni /u :kagagiwan/>utcipiciganimoyan klga rcrrn. Anln i*i ka"Ambasa,icipiciganimoyan?""Nanabucu, i^wa klmicakwa k ka i cinagwa k klyocawackwag,ml 7 *!* 11 ambagic ici i yan."10 Misa x gaga t Nanabucu kro cawaskunat. Kagagidacka icinagusit mri /u /<uNanabucowan.SERIES III. Nos. 33-38.33.NANABUSHU FEIGNS DEATH TO MARRY HIS SISTER.Amc, micigwa alndawag, Nanabucu uclmayan widigaman.Mlsa x piboniciwad rrma, ningudingigu inantam Nanabucu :"Amantcigic15 nicima i i /u tciwldigamagiban!"ka-i cictcigawabanan 4 s i /u misawanimakla s a /ucigwa kinantamikwantank,misa 7 aci a/ kusfkasut. Mlsa kaga t uga tinigona pidci. Kaga tisa ugagwa tagian Ini /u uclmayan, mlsa 7cigwa: "Kuniga migu*i kaga t tcinibugwan wa s a /u nisaya ninandam a s a /u i kwa. Mldac cigwa ka i nandank udinan20 mi /u :usayan "Minagu kaga t l c /u i i ?"tcinibuyan udinan.Wo O dac ugli gon a :"Kuniga pidci kamanandam !"ugri*-nan mi /u uclmayan.8krr,""Ayekitu a s a /u ilkwa;"kaga t ninganagagwatagantam."
ously sad." 1The younger of the Foolish Maidens.(thus)"Truly then away279started the Raven. It is not knownfor certain how many moons the Raven was gone ;after"I havea long time he returned. Then he told, saying:not learned how large this earth is, so therefore I cameback before I could find out."So Nanabushu then spoke to the Raven, saying : "Come,so that you may be proud of yourself will I make you.In what manner, then,do you wish to feel pride in yourself?""Nanabushu, as it looks on a clear day when the skyis blue, so would I have you make me."Thereupon truly Nanabushu colored him blue. Nowsuch is the look of the Raven, he was made so by Nanabushu.SERIES III. Nos. 33-38.33. NANABUSHU FEIGNS DEATH TO MARRY HIS SISTER.Well, so then there they dwelt, Nanabushu dwelt withhisyounger sister. And so while they were passing thewinter there, then once thought Nanabushu: "Wonderhow I shall do to marry that little sister of mine l whomI desire!" And so he began seeking for a way, whereupon he made out as if he were sick. And now trulyby her was he nursed very tenderly. Truly, so much caredid he make his young sister bestow upon him, that atlast (she began to :think) Wonder now ifmy big brotheris really going to die !"thought the woman. Andso when she had had this thought, she said to her elderbrother: "Is itreally true that you are going to die?" shesaid to him. And this she was told: "Wonder ifyouwould feel very sad about it!" he said to his younger sister."Yes,"said the woman; "truly,I should be griev
280Idac ugri nan mlnawa na kwa tawat Ini /u ucimayan:"Kuniga kiga rnantam 4 8 i /u ka/rninan. Ambasa, kigaTnin8 /ui i ka/rnantaman. Mlsa win cigwa kagat 4 8 /u itcinibuyan,"ugi i nan !ni/u ucimayan. "Anlc,ka icictcigayan wlsiniwin5 klgata ton rrma katacicinan," ugri nan Ini/u ucimayan."Migu i i* ajipapagantaman i i u aninan, anlc kawasa i i wlntcipimadisiyamban," ugri nan Ini/u ucimayan. "Miya tagu iuka i ciwabantaman i i ma tcrrcipa^agitandamamban,i i maanikwacinan tci a -t toyan iu wlsiniwin. Po tcidac nlngamldcin.10 Mlsa / i u kadicictcigayan."Midackagaka i cisaka kinat. Kawlndac ugina i-nasm, mlgu maiplndik antawat ka i cicininit. Midac mo n jag mawi Ia 8 a /ult ka i cinibunit mi /u usayayan I a 8 a /u ikwa,i kwa, mlsa x kagabagljik mawit. Midac kaga t ka i cictcigats15 /u ( i i kra- tot 4 8 /u i wlsiniwin i i ma anikwacininit. Misa x ,tasing patagwicingin pra ntawabandank 4 c i /u mldcim imaka af tot, kaga t owabandan ajiganjlcininit. "Kaga t mmangwanaumldcinatug,"inandam.Midac ka*a-nimadcanitcin mi /uucimayan, mi cigwa nniskat20 wlsinit; anica nibu kasu. Midac acictcigat 4 8 /u i rrma anikwacinga tanik, iu wlsiniwin ajipapazagapi tod. Anlc mlguwlsinit kanimadcanitcin.tasing i i* u ajictcigat, kayaNingutingiku anitagwicing, I a 8 a /u i kwa wawabigunotciyan25 nupa kita O wan, utanupaplnowan. O O dac udinan :pimra/cawiba tdnit owabaman i i ma utickwantaming ;uta-"NingI-
28lAnd this he said to her when again he replied to hisyounger sister: wonder if"(I) you would consent to dowhat I am to tellyou. Therefore I will tellyou whatyou should be willing to do. The time is now truly athand when I should die,"he said to his younger sister."Now, what you should do is to placefood there whereI shall lie buried,"he said to his younger sister. "Now,this request do you heed, according as I tell you, forthere is no hope at all that I shall live,"he said to hisyoungersister. "So all that I can now look forward tois the food which now and then you will offer ;therewhere I restmy head is where you will put the food.And of necessity shall I eat it. Therefore that is whatyou shalldo."And so truly,when the woman s elder brother was dead,then did she dress him ready to put away. But she didnot bury him, so there inside of their dwelling-place waswhere he lay.And so continuously did the woman weep,even throughout the whole of every day she wept. Andso, truly, what she did was to place the food there wherehe laid his head. Accordingly, as often as she came toexamine the food which she had placed there, truly shesaw where (the dead) had left the mark of finger-nails."Surely, in good sooth must he have eaten it,"she thought.And so every time that his younger sister would goaway, then would he rise from where he lay (and) eat ;he was only feigning death. And that was what he didto what lay there where he laid his head,at the food hekept scratching. Now, that continually was what he did,and what he ate every time that she would go away.Now once, upon her arrival, the woman saw a mousecome running across the entry-way ;she tried hitting it,butwithout success, for she failed every time she tried to hit it.And this she said to it: "Ithoroughly detest that hateful
"A""Wmtamawakan,"udigon!",".""282gagwasaganimala e a /umatciwawabigundtcrrc win awimidcitnisaya n yan acimimak." Midac agut Ini/u wawabigunotcl7yan:pina udigon Ini/u wawabigundtclyan.lO s owidac ugrrgon Ini /u wawabigunotclyan: Kitaglwmtakisayan5 mon ri u ananimi k aV11u wmdamawicin ! Maskut, nimpmdcipimagananklgaa camin, wmtamawiyan."1A Umi/u "Anicawawabigunotclyan. kucakitotak i i kinibu krrnantaman. Kawln kuca kaga>u10 nibusl. Anica kuca totam. Mlginmigu ka a*nimadcawadcincigwauniskat. Anica kuca kiwTtotak. O o* kuca kitinanimik,Ambadacsa witigamag, kitinanimik. Ml guca anicawantcidotank 4 s i /u nibu kasut. Ml guca rr u ananimi k kiwindamonwawani," udinan 4 a 8 a /u wawabigunodcl. "Mlsagu15 mini k aciwlndamonan," udigon Ini /u wawabigunotcra n."Ambasano, ayangwamisin, po tcigu tciwldigami k, mrr 11anantank."lt"Mmangwanai uilkitu a u i kwa. Misa kawln kayabikaskandangiban l utaiyasln. Misa 7 klwabinank ajikiwat.20 Cigwa plndigat antawat, uba kingwabinanIni /u usayayan.Amc mawi pa klngwanatIni /u usayayan, o O tac udinan :"Amc, misa intawa tcipagitanimak wa 8 a /u nisaya, mlsaintawa tcina i nak nongum kiciga k," i kito a c a /u i kwa."Amantcigicka ici-a*wagan wa s a /u nisaya! nirigawaci a25 mawln." Misa 7 aciwawanantank i i u aniwawajra/t. Cigwa5" Kaskandangiban, literally, it is a construction meaning1sadness she was in." Most Ojibwa dialects would have the noun kaskandamowin,"her sadness"in the"sadness."
28 3Mouse, for he is the one that keeps eatingwhat I feedmy elder brother." And this she was told by the Mouse :"You should by all means tell him about it,"she was toldby the Mouse. And this she was told by the Mouse: "Iwould have told you what designs your elder brother hadon you.""Ah,do tell me about it! In return I will give you(one of) my bladder-pouches (of grease) to eat, if you tellme about it.""Good!" she was told by the Mouse. "Why, only atrick is he playing you, to have you think that he is dead.Not really ingood earnest is he dead. He is only shamming. Now, it is really true that just as soon as you aregone, then up he rises from where he lies. Why,he isonly deceiving you. This really is his thought of you,Would that Imight marry her! (such) is his thought ofyou. Such really is the foolish cause of his feigning death.So what his actual is Idesign upon you have now toldyou plainly,"to her said the Mouse. "Therefore such isall I have to tell you,"she was told by the Mouse. "Iwarn you, take care ! for he is determined to marry you,and that is his desire.""So that is the intent!" said the woman. W 7 hereuponshe carried (her) sadness l no longer. Leaving the placethere, she went back home. When she entered into wherethey lived, she uncovered the face of her elder brother.Still was she crying when she uncovered the face of herelder brother, and this she said to him: "Well,the timehas now come for me to give my elder brother up forburial, hence it is for me to bury him this very day,"saidthe woman. "Would that I knew what to do with myelder brother ! I should paint his face." And then shewas at a loss as to how she would paint him. Then she2 It is the custom to paint the face red at burial the5 design is round.
uglkanonigon:"O er284ijrrcin," ugrrnan Ini/u ucimayan,"Klwitasklcig mri u ijipru ugrrnan Ini/u ucimayan,cin,"Midac kaga/t ksrrcrrgutIni /u ucimayan.Ka kijra t, cigwa kimadci ta krirji tot wani kan, midac5 ka i jipagunagwatank o a ki. Mlsa 7 kacictcigat a 8 a /u i kwa.Misa x cigwa kinan zi (kawat usayayan,i-i ma kiciwinat owanikaning.Midac ka-rcra dcita klwabinat, ka-ijiningwa a nk.Midac cigwa klmadci tad mi tigon kri na kwagawat i i maka paginatIni /u usayayan ;nlbiwadac mi tigoni i ma ugrr-10 na kwagawan. "Mlma i- aniwa k tcibwanawi u- pan nomag,"kri-nantam l a s a /u i kwa. Midac acikanonat Ini /u wawabi-:gunotclyan "Ambasano, wldo kawicin," ugri nan. "Ka i*-cimlnat 4 s /u iwaga kwat : "Ambasano mawi x n, kagabagljiktcimadwa i gayan. Nisaya 11 !klgai natam tcimawiyan.15 Minotc nlwimadcinicima. Kagu x wl ka kibi twa/i ga kan,"ugri-nan ini/u wawabigunotclyan. Mlsa x ka/rcimadcat a 11i kwa pabimiba tot.Misa x ,Nanabucu cacingicing pisintawat ucimayan mawinitkagabagljik, wo O dac kri*nandam :"Ningri niga a- niclma,20 ambasano ningawabama."Mi cigwa klwrkwatcru t. Misa xka ijikaski u t,anm ka-i cinang ima ka paginigut mi tigo 8ayaplta kucininit. Onontan madwa/rganit ucimayan. Midacka ijinasi tawat, anuanri nabit;kawln wabamasin antanwawasininigi*i* u waga kwat. Kuniginin uglwabaman wawa-
was addressed by him saying: 1 "In this manner do youpaint me,"he said to his younger sister. "Round aboutthe eyes, there do you paint me,"he said to his youngersister.Thereupon truly was he painted by his youngersister.When she was done with him, she then set to workmaking a hole in the ground, whereupon she dug clearon through this earth. Such was what the woman did.And so then she went to get her elder brother, shefetched him to yonder hole in the ground. And whenshe had pitched him in head first, she covered up the hole.Thereupon she then set to work felling trees over theplace where she had flung her elder brother; and manya tree she felled over the place there. is "Itpossiblethat for some time he will be unable to get out," thoughtthe woman. Thereupon she spoke to the Mouse, saying:do"Pray, helpme!" she said to him. When she had givenhim an axe,"Ibeg of you, cry! throughout the whole ofevery day I would have you heard choppingCOhere.my elder brother! is the way you shall wail. In themean while I will try to flee from him. Never letup withthe sound of your chopping,"she said to the Mouse.Thereupon off started the woman, running as she went.And so, while Nanabushu lay there listening to hisyounger sister crying throughout the whole of each day,this was his thought:"Ifeel sorry for my little sister,so I willgo see Then he her." began trying to get out.And when he had succeeded in getting out, what was heto see at the place where he was thrown but (numerous)trees piled up high. He heard the sound of his littlesister chopping. Thereupon, when he went to where heheard the sound of itwas, he looked, but without result;he did not see her there where the sound of the axe was1For the dead to speak is not inconsistent with Ojihwa beliefs.
"ugriugl2865bigunotclyan madwa/rganit. Ajina n zi kawat l ajinlwanawat.Awananlwinan ! madcra/nim wawlto kawat !"ugrrnan.Mlsa ka/r kitut : "Kawlnpo tc kigawanrrsinon anti kanlcayan."kaga t krklwi tanantuwatcigat. Kaga t Mlsa udo-lkawi a*n animi kawanit, mlsa 7 ka ijimada a nat. O O dacugri nan: "Amnti pl tcag a ki waa pa-i yan? Po tcigukiwldigamin," ugri nan.Midac a*a*wati i kwa piminijimut, cigwa ugi kanimanpiminica U gut. Midac ka/rnantank wa s a /u i kwa : "Mimawm10 kaga t tcinicit,"kri nantam. Saga i^gan umada kwan.Inabit kuma a pl owabandan ubaclwaninig, awiya owabamannlbawinit, nabanagatawanIni /u anicinaban weyabamat.Mlsa ka i cimawinanat, nayagigu uglplpagiman, wo O widacugri nan :"Nosa,manito nimpimamltawi rk nan.i !"15 Kawm kanaga uglkanonigusln. Mlnawa ugl kanonan :"Nosa,manido kuca nimpimamltawii k !"ugrrgon:8"Aye , indanis," ugri gon ;ugri gon ; "cibagata a n." l"onan. Mlsa7o*ma pimi ijan,"Midac kagat i i ma ka a nrijat inabit, abanabamat ani-20 cinaban pamomanit maskawa kutciwan. /ulniMlnangwana2kawabamat kotagatan. Cigwa ugi kinaomagon a s a /u li kwa:"Mri-watiantayan, mlgu 4 8 i /u aniciplndigan," ugrrgon.1A set phrase which the Coot is made to say to all passing by,only on one leg.for he stood
2 8 7heard. He was surprised to see a Mouse that was chopping away. On going up to where he was, he clubbedhim till he was dead. "Pshaw!(what a)want to helpwretch that wouldher!" he said to him. And this was what hesaid: "It is impossible for me to lose you,no matter whereyou may go." Thereupon truly he soughtall around forthe signs of her footprints. Truly found he the trail alongwhich she had gone, whereupon he followed her, keepingon her trail. And this he said to her: "Where is theworld so large that you could escape me? for I am determined to marry he said to her.you,"But that woman now faraway was in full flight, forshe knew that she was being pursued. Accordinglythiswas what she thought:"There is a chance that really hemight kill me,"she thought. Out upon the ice of a lakewas she come. Looking across at a certain distance away,she saw where (the lake) narrowed, some one did shesee standing (there) ;on one leg was standing the personshe saw. Thereupon she rushed to where the (personwas) ;and while on the way, she kept crying aloud to him,and this she said to him: "Omy father! by a manitouam I hard pressed,"she said to (the person). But noreply at all she got from him. Again she spoke to him,"Osaying: my father! really by a manitou am I hardshe said to him. Then this she was told:pressed," "Yes,my she wasdaughter," told; "bythis way do you come,"she was told, the "through space between lmy legs."It is true that when she had gone on (through), shelooked;whenlooking back, she saw him carrying thefrozen body of a dead person upon his back. It happenedthat the one whom she saw was the Coot. 2 Then by himwas the woman instructed: "Atyonder placeis where I2 Kotagat, the story name of the Coot, whose real name is Atcigate.\
" 1A288Midac gagat anibabimiba tod c a s a /u ikwa, cigwa kaga towabandan kickabi kanig, anotc H ma ajabi kung wandamutonit !ni /u osan. Cigwa kra/nitagwicin, kaga/t owabandan skwantam. Acipa ka kunang, mmangwana asin pijicik5 wawlgiwaminit. O o dac ugri gon:"Ambasano, anigu kkiba ku a-n kiblndigayan,""Pamaugri gon. nm unagucigningatagwicin,"ugrrgon.Amc mada kut Nanabucu; inabit uglwabaman anicinabannlbawinit awaniban u l kat pajik;unisi tawlnawan Nanabucu.10 Ml cigwa kra nimadcra/nk, o*5 widac ki rna a n :"Kotugata !akikibobo kunontiya,Kaya kikimama kinontiya."Amc utanina n lkawan zi Nanabucu. Cigwa upacwabaman,cigwa kanonan : "Anti ka a nrijat nimindimo i-mic?" udinan.15 "Anlc,kin kuca ka i ninan, kotagat!" udinan."Km kuca ka ininan, kotagat. Anti ka a nrijatkitininAnlc kawlnuganonasm.kuca."uKawln kuca," udigon, "awiyao O ma klpimosaslla c a /u20 kimindimo rmic," udigon."Mlya ta o O ma ka pimusatindanis, kawlndac win awiyala c a /u kimindimo i mic tcigipimosat.Kawln ninglwabamasl," udinan."Antikuta ka a nri cat?" udinan l a c a /u Nanabucu."O O ma clbagata a n krpimri ja."25 Mldac ajiba pit Nanabucu : "Kitokatinag clbagatayankanlcayamban!""Anlc, mlsa win i i ma ka pimi ijatindanis. wU,kaya nln ima ningaija."Mlsa kaga t cigwa ri ma pimiayawan, ajipagitciwapa-
he289live; so straight in do you she was told.go," Thereupontruly, as she went running along, then did she really seea steep cliff, and she found her father s path leading amongyonder lofty rocks. While arriving there, truly she sawa door. On opening it, it was found that wholly of rockwas hiswigwam. And this she had been told: "Pray,tightly shut the door when you pass inside,"she was told."Not till in the evening shall I arrive,"she was told.Now, out upon the ice came Nanabushu ;as he lookedabout, he saw a person standing only upon one leg ;himNanabushu recognized. So then he began singing, andthis was his song:Coot! "Oyou are broken at the back of the pelvis,And you are maimed in a bad way at the buttocks."So up to where he was went Nanabushu. When hewas near to him, then he spoke to him, saying: "Whitherdid my old woman he said to him. it isgo?" "Why,really you whom I am asking, Coot !" said to him.But he did not answer (Nanabushu)."You are the one I am really addressing, Coot. Whitherhas she gone?I am speaking to youin earnest."he was"Really," told,"there was no one like your oldwoman who passed this way,"he was told. "Theonlyone who passed here was my daughter, but there was noone like your old woman to pass this way.I did notsee her,"he said to him."Pray,whither did she go?"to him said Nanabushu."Through here, between my legs,Thereupon did Nanabushu laugh.she went.""The idea of yourhaving legs in between which I am to pass through!""Well, by that very place did my daughter pass.""Very well, then will I too pass by that way."And so truly, when (Nanabushu) was passing under, then19 PUBL. AMER. ETHN. SOC. VOL. VII.
"KagaMlsaumadwaigut.2QOkamat !ni /u maskawa kutcra/nicinaban, mlsa klnisat Nanabucowan.Mlsa 7 wanagucininik ka/a nrrjiklwat, cigwatagwicin5 udigon:i rwiti antat.Mlsa 7 owabaman osan tagwicininit a 8 a /u i kwa. Misa 7tiguna klgapapagwatanimin magwagu nani-7udigon ini /u osan: t "Kagauba ta-i nu-sanisiyan!"tonan ano katcigan.1Awawa11, indanis, pisanigu uda pinanwagunan utinowa wa/a yayan. Waji ton kitaiya rmankagigickaman," ugl i gon Ini/u osan.10 Anic misa kaga t ka i cictcigat wa 8 a /u i kwa. Wo O widacugri gon: "Ambasano, kagu 7wi ka ciaya kwisito kan o o-wisaskwantam. Kawln kagat ninisasl l a s a /u Nanabucu. Kagu 7pa ka kunamawa kan. Ta ka kunan, kiga i k. Kaga t maskawikipa ku-a n. Kawln mnwl ka nindabisi, panima unan-15 gucig nintagwicin," udigon mi yosan ; "rnigu ri witi klbiwabamiyan,pana iwiti ayayan, notci a gwa adi kwamagwag.Mldac Misa iciaiyangwamiminan." kaga t a pana madcanitIni /uosan.Ningutingiku, a rnantinit mi/u osan, cayigwa kaga t ama-20 nisu. "Pa ka kunan !" i gon awiya. Onisitu tawanNanabucowan. Anic, kl na kawln dac i wlpa ka kun^zln,misa 7 "Paandacimigut. ka kunan !"Anic, kawln uwlpaka kuna^zm. Kaga pl madwatagickamini skwantam;kaga pri gu anigu k, gaga pi ninguting ajikacki tonit, acipa-25 ka kwisanik l i/u i skwantam. Misa 7 ajiplndiganit. Mlgutawlnfiwa kwantasing agotanig upapigwaniniIni /u osan, mlgu iwitipami a* pagisunit. Ajinonda ku tonit, mldugigu antipri cikl-1Ano -katcigan, "objectsof barter;"sometimes "goods"fits the meaning. Theword is used for things bought at the trader s store, and also for things that aregiven or received as presents, such as wearing-apparel and food and ornaments.
(the Coot) dropped the frozen human body upon him,whereupon he killed Nanabushu. And then in the eveningon hisway back he went, soon was he come there wherehe lived.And so the woman saw her father when he came home.And this she was told: "HowItruly happy shall be tohave you dwelling with me at just the time when I amso lonely!"And this she was told by her father: "Trulynumerous are the objects of barter. 1 Yea, my daughter,at your pleasure take whatsoever thing you wish. Makewhatever garments you are to wear," she was told byherfather.Now that, in truth, was what the woman did. And thisshe was told: "Please never leave this door open.I didnot really kill Nanabushu. Do not open the door for him.Open it! he will tell you. Without fail tightly do youclose it. Never am I here at home, not till in the eveningdoIreturn,"she was told by her father; "for at yonderplace, where you came and saw me, is where I continuallystay, hunting for whitefish. That is why I am urgingyou to keep alert." Thereupon truly off went her father.Now once, while her father was absent, she becamegreatly alarmed. the door!" she heard some one"Opensaying to her. She recognized the voice of Nanabushu.Now, she had been told that she should not open thedoor, but she was continually besought. "Openthe door!"she was told. Now, she had no desire to open the door.Finally she heard him kicking against the door; and atlast (it was) with so much force, that all at once he forcedhis way in, and open flew the door. Thereupon he wentin. Now, truly at the rear of the lodge was hanging herfather s flute, and straightfor it he flung himself. As heblew upon it,then it was that in vain did her father try
Cigwa292waba tonit Ini /u osan.Anlc mlclac Nanabucu nonda kutcigatcaylgwa pltcipa*rtiwa s s /u kiwa 8i i .piji Minangwanaswandcikanawantaminit ii /u upipigwanini. Cigvva klpasingutcisaI a 8 a /u ikwa, cigwa owabaman li us /u kiwa 8i ipiji ajipln-5 digasanit. Ajinawatcigwanigut Ini/u pajik, ajimadclba i gut.Anitababandank kotagat antat, aca udanisan pimadciwitcigasowan.Mlsa x ka i-jipmdigat misa pana udanisan kimakamint.O O dac kri nandam : "Ambasano a pl ninga-arntawabama,"kri i inandam, ugi^kaniman ma. Mldac10 ka i nandank :"Pamagu nagatc magica nintaki ; kanimigo ; ;wlbakuninganantawabama," kri nantam. Mldac kagatka i cikacki tot, mldacigu krrnantank unagucininig kuckwawatabit:"Kaga tsa, ningi tcigwlnuma aVwisa indanis. Mlsacigwa tcra ntawabamak a e a /u nindanis." Mlsa ka i cimadcat15 kra*ntawabamat !ni /u <uutanisan. Cigwa utababandan i ilodana, pici kiw Ta 8 udotanawini. Anlc mlwanini 11 , wagimawinitkama kamigut Iniyodanisan. Caylgwa anionangucininik,uda kawa ton tcitibi katinik. tCigwasa kagakltibi katini.Ajina^zi kank 4 9 /u iodana, wo O dac kl i nandam :"Wfkagasa20 taanona tcinibinatit !"kaga/t onondawan madwanoniminttcinibinatinit. Aji a- kamawat ima agamlng, cigwauowabaman kagat.lct,"udinan;"indanis!"Ajiplpaginit, ajinawatinat ; ajimadclba tot. A panagukabitigwanik no pinanigut. Anlc anigu k pimiba to. Kaga t
to hasten home. So it was that as Nanabushu playedupon the flute, 1 then in came rushing the buffaloes. Itwas for that very use that (her father) kept his flute.Just as the woman sprang to her feet, then she saw thebuffalo come dashing inside. When she was caught uponthe horn of one, then away was she carried.By the time that the Coot was coming in sight of hishome, already then was his daughter being carried away.And when he went inside, then (he knew that) gone washisdaughter who had been carried away. Now,this hethought:"Now will Igo seek for her,"he thought, forhe knew where she was. And this was what he thought:"Not for a while yet (willIgo to her); perhaps I mightbe found out; but soon will Igo to seek her,"he thought.And so truly,when he was able (to go), this was histhought (one) evening while he was sitting silently (alone):"Truly, very lonesome am I for that daughterof mine.So now the time has come for me to go seek my daughter."Thereupon off he started to seek his daughter. Soon hecame insight of the town, the town of the Buffaloes.Now, it was the chief of that place who had kidnappedhis daughter. As the evening was now coming on, hewaited for it to grow dark. Soon was it really dark.When he started to go to the town, this he thought:"Would that she might be sent to get water!" Presentlyhe truly heard some one bidding her go after somewater. As he lay waiting for her there by the bank ofthe stream, soon he saw her in reality."Hist!" he saidto her, "my daughter!"As she screamed, he seized her then he started;running.And there was a continuous roar when he was pursued.So with all his speed he ran. Truly, he was hard pressed1The use of a musical instrument or song as a miraculous agent in havinganimate objects appear, is a prominent literary element.
>uandat."294oga kri go paminica irgut. "Mimawln tcinontayanigoyan,"inantam. Kaga/t anigu k Ipimiba to, mawinatang8 /u i iandat. Mindcimigu tababandank ri u andat, mrr u cigwatababamat Ini /upaminicirtrgut."Mlmawm kaga tcitaplndi-5 gaba inantam 4 8 /u i andat.rwayan," Cigwa ubacwabandan4 s i /u andat, mi cigwa a l pidci pacwabamigut Ini/u paminicaugut.Aca kitibanantamasut, amc ugicaya kwisiton ml i /-uantat. Amc ajiplndigat,kacka kuwabinang mri 7 11antat.Kagaku onondanigun 4 8 i /u paminica U gut.Amc cigwa10 uglplndigaba a n;kawln dac takaski*u siwa s tciplndiganitmi*iutanisan."Ambasano, ayangwamisin," ugri nan Ini/u"Kagu7minawa awiya ugawikacki tosln tciwlpakakunang 4 8 i /u andayang," ugri nan mi/u udanisan. "Kagatkigi kwanumin, idac ka-u*ndcina n za l kawinan. Ambadac,15 ayangwamisin, ugri nan ini/u udanisan. Anlc mlsa kayabiayinanu klnit Ini /u osan. Kaga tidacigu anawi kabaya rugiwitcayawan, cigwa minawa, "Kanabatc minawa kagatci a manisuyan,"udinan Ini /u udanisan. Anlc ad^kamagwanubabltciwananini Ini /u osan; anlc mlguna i u amwawat,20 "Kawln kuca kagatninginisasl a c a /u Nanabucu."Ningutingiku, kaga t awiya onontawan rrma agwatclngO<r imadwaklgitonit. kitowan : "Pa ka kunan !"udigon.Unisita tawan Ini /u awinit Nanabucowan, mlsa 7 kawlnuwlpa ka kunasln. Mldac kaga pl madwa-i-citangickaminit25 4 8 /u iskwantam, anlc kawln anawi iugackitoslniniskwantam. Ningutingiku kaga pl pa ka kwisanik u skwani itam, miku rrwiti pama a^pagisunit agotanik osan papigwanini.Acinondagwatonit, caylgwa onontan a c a /u wada-ci /u
295by them that pursued him. I"Possibly shall be overtakenbefore Iget home,"he thought. Truly, with all his speedhe ran, when making for his home. Just as he camein sight of his home, then he caught sight of them whowere pursuing him. "It isbarely possible that I shall beable to fleeinside,"he thought concerning his home.Then he was nearing his dwelling, when very close uponhim were those that pursued him. As now he lookedback, then was the door of his home already open. Now,as he entered, he slammed the door of his home shut.Almost was he overtaken by those that pursued him.Thus he then got her inside ;and unable would theothers be to getinto where he lived. "Please be onyour guard,"he said to his daughter."Neveragain letany one succeed in opening the door of the place wherewe live,"he said to his daughter. "Trulymindful was Iof you, and on that account I went to get you. Now,please be careful,"he said to his daughter. And so stillon with his work her father continued. Truly, in spite ofthe long while that she was spending with him, yet again,"Perhaps the time is near at hand for you to be alarmedhe said to his again," daughter. Now, whitefish was herfather continually fetching home in his pack ; and whilethey were (once) eating it, "Why,Nanabushu."I did not really slayNow, once she truly heard the voice of some one speakingthere out of doors. This (the person) was saying: "Openthe door!" she was told. She knew by the voice that itwas Nanabushu;but she was not anxious to open thedoor. And then finally she heard him kicking againstthe entry-way ; but, in spite of his efforts, he could notsucceed. Suddenly at last open flew the entry-way, and(Nanabushu) rushed straightto where her father s flutewas hanging. As he blew upon it, presently the owner
296iTmit. Anublciklwaba l tot;anlcina pasi ka 4 8 /u i anubiklwabatot.lCigwa otababantannlngagwanisaganimas /ui i andat."KagatsaIa 8 a /u Nanabucu kacki togwanskwantam,"i kito. Caylgwa anlnabit, aca pimisagitcipai -5 mint Ini /u udanisan. Mlsa pana mlnawa klma kamint Ini /uudanisan. Mldac ka totawat Ini /u Nanabucowan kisagitcipasigakwanawat. Kaga/tsa manantam Ini /u udanisan minawakiplma kamint Ini /u . Misa / mlnawa klnicikawisit. Amc,mlsa x mlnawa ka i ci a-yayat pisan, u Kagatsa ningi tcigwlnal10 wanima a s a /u indanis. Ambasano pl mlnawa ninga a ntawabama,"kl i nantam. Mlsa x kaga t cigwa mlnawaklmadcat.Mlsa 7 mlnawa acictcigat, anipi tot tcitibikatinig."Wl kagasatawimini kwa,"udinaniman Ini /u uningwanan. Cigwakaga t madwaklgitowan:"Taga, nibinatin,"madwa i niman15 ini /u /<uudanisan. Amc, mri cigwa mlnawa kru na kamawat,kao^a o tipfu o kawlnidac uo^anonasi. o Mldac ka^a/t o owabamanpini tcigusanit ini /u udanisan. Mlsa 7 ajinawatinat lni /uudanisan, kawlnidac mamwatc uganonasln. Mlgui u pisanajinawatinat.l ci iu20 Wibagu cigwa madasinima, cigwa mmawa madcinicawa.Anic anigu k pimibato.Kaga/t uga kri gon 4 8 i /u paminicau gut. Amc ml kayabi ka ijitcigat, klcaya kwisitot 4 8 i /uantat. Caylgwa ubacwawabantan. "Mlmawln tcinontayanigoyan,"kri-nantam. Caylgwa o O wa plni kwaniwan25 wrpiwapa-u-gut, anlc mlsa x ka/rciplndigaba a/t. Mlgukacka kuwabinang,i i ma pimadwacininit. Inabit, mlnan-
297heard it. He tried running home, but to no purpose; why,it was slow progress as he tried in vain to hurry home.Finally he came in sight of his home."Trulydo Ithoroughly loathe that Nanabushu, for that he should beable to force the entry-way,"he said.By the time hewas there to look, he saw that already had his daughterbeen carried out. And so gone again was his daughterwho had been taken from him. And what he did toNanabushu was to kick him out of doors (and send himto the lake). Truly ugly did he feel to be deprived ofhis daughter. And so once more he was alone. Well,when again he had remained inactive, "Trulyam I exceedingly lonely for my daughter. Therefore I willgoseek for her again,"he thought. Thereupon truly soonwas he off again. And so he did the same as before,he waited for darkness to come. "Would that he mightthirst!" was the thought he had of his son-in-law. Presentlyhe truly heard him saying: "Come, gofetch water!" heheard him say to his daughter. Well, accordingly, thenagain did he lie in wait for her, and really he did noteven speak to her. Thereupon truly he saw the dim figureof his daughter walking hitherward (through the darkness).And so, when he seized his daughter, it was necessaryfor him to speak to her. So he quietly took her away.Now, in a little while her presence was missed, thenagain she was pursued. Naturally hard ran (the Coot).Truly hard was he pressed by those who were pursuinghim. Now, what he did was the same as before : he hadleftopen the door of the place where he lived. Finallyhe was in close view of it. "There is a chance that Ishall be overtaken before Iget there," he thought. Nowby the horned creature was he about to be hooked, butit was then that he carried her inside. Just the momentthat he slammed the door to, then he heard some one
298gwana uctigwanini klgackalkamawat;gra* 4 tani rrma plndig,kakiwa o danik uskiciguni, ka/rciklckigwasanit!ni /u unlngwanan.Mlwanini 11 wagimawinit,mlsa ka/rcinisat.Amc, misa pinawitclt kra gota.34. NANABUSHU is FED MEAT FROM THE BACK OF A WOMAN.5 Amc, aTntawag ima anicinabag,Nanabucu unldcanisa6niciwa 8 wlwan kaya. Misa 7 ima papiponiciwat, anlcina,nawatciku kawin kago una a nimusm. Amc, misa7 tcigwatcipiponini, misa 7 kawin w! l ka na ubltosm kago. Anlcmisa 7 pa kadawad. Ningutinbiku, pabamusat, anicinaba 810 ajiudisat ;niciwa 8 abinotclya 8 abiwan Ini /u ininiwan.Amc, misa ,a kitunit : "Amn dac na, kiga a siwang a 8 a /ukipiwitaminan,"udinan wlwan. Anlc, skwantang nasamapiwanlni /u i kwawan. Aci o nagota ki kwanit. Amc, acigmibotonitumo kumanini, mackimuta kawan Ini /u wlwini. Misa15 ka klcibotonit *i s i /u umo kumanini, ubiminana tabi tawaninimi /u wlwini. Ajigitaska kunamawat Ini /u wlwan udanikamanini,3 ajimi tawaganabinat ; ajipajicwat nawawigan ; misa 7acipa kwaninwacwat;kawin kanaga madapisiwanIni /ui kwawan. Misa 7 kaujipicagawiganacwat Ini/u wlwini, aci-20 poda kwawanit rrma a ki kung. A ka kanja ajio da pinaminit,acisinigunamawanit ma u i i pi kwananing. Acisagakuwatmlnawa. Misa 7 kawin /uInikanaga gimadapisiwan1The Buffalo that had taken his daughter.over theU danikamanini,"her shoulder-straps," a sort of suspender goingshoulder, and thus holding up the skirt. This piece of garment is no longer wornby the women of to-day.
299come up againstit. He looked, and it was the head (ofhis son-in-law, 1 )from whom he had severed it; it lay thereindoors, out bulged his eyes,off had broken the neck ofhis son-in-law. Now, the one that had been chief was theone (the Coot) slew.Well, so then the buttocks of the ruffed grouse nowhangs aloft.34. NANABUSHU is FED MEAT FROM THE BACK OF A WOMAN.Now, abiding at the place were some people, the twochildren of Nanabushu and his wife. And so there, wherethey passed the winter, why, hardly any food had theyin store. Well, it was now far into the winter, and nevera single thing did he fetch home. Naturally, therefore,they grew hungry. And once, when walking about, towhere some people were he came there were two;children,at home was the man.(and)So, therefore, said (the man): "Why,let us feed ourvisitor," (thus) he said to his wife. Now, with her facetowards the door was the woman seated. Then she placedher kettle hanging from a hook. Now, while (the man)was sharpening his knife, his wife was weaving a bag.And when he had finished sharpening his knife, he movedover to sit next to his wife. Then, unfastening his wife sshoulder-straps, 3 he exposed her at the back; he thensliced her down the middle of the back with a knife; andhe then sliced away a piece of fat from her;not a whitdid his wife budge. And so, when he had sliced a piecefrom the back of his wife, she then putit into the kettleto boil. Picking up some charcoal, he then rubbed it onher back. 3 Then he fastened her garment on again.And3 In order to render the place whole again,a common formula for miraculousrestoration.
"udina"300i kwawan. Tcigwa klcisa/kwawan, "Amc, rnlsa u i aciwlsiniyamban,"ina Nanabucu.Midac kaga/t ajiwisinit, panagu kamskininu tanig misa /ajiwisinit.Kuma mini k skwantciga Nanabucu.5aMri/>uijiklwawita 11 kimtcanisagna mini k ackwantcigayan."Misa / cigwa wrklwa.Awagwanigic?"kri-nantam.Mmangwana umackoson kawudisat. Amc mlsa cigwakrki kanimat ayawinit. Cigwa wl klwa, aci a bawat I 8 /ui i10 uglcotabisonas4 8 i /u wabosowayana 8 ; acicangwantaginat l iugico tawuna 8 , ajisaga a nk. Kuma pl ani a yat, usagitcinicairgo/u i icabinotclya 8 . Midac aciplpagit"Al!" i kito;j:i /u"klwanlka kiglco ta u nag!""Nindocimag ugapmawa," udina.15 Mlsa 7 tkaga wabamimawat abinit."Wasagu udciwabinamawi k. Kawln kigapasamigusiwaV.Midackagatwasagu wa/irndciwabinamagu i fii /u abinotciga8 . "Ic!" udina 8 ; "kawunagunawabinawag,"udina 8 .kiku8!" . Amc misa x "Pimlciyu kaga t awiciminigut,20 mldac anicimadclba i tinit. Amc, ugri na8 a u awati wanltcanisit:Wasagu undciwabinamawi^k, kawin klgabasamiguslwa."kagaMidac t anawi totaminit, amc ugl irndcra*-nidic. Midac ka/rnat a p! kamlnigut:kosiwa tablca," ugi na 8 i . Mlsa x /uka i ciklwaba i tiwat Igi"Ambasino, wabang
3 oinot a whit had his wife moved. So when she had finishedwith the cooking, "Well, you may now as well eat,"wastoldNanabushu.Thereupon truly did Nanabushu eat, forthwith after thefat was boiled was when he ate. A certain part of itNanabushu refrained from eating."That much which you saved do you take to yourchildren."Therefore now was he on the point of going backhome. "Who in the world (is it)?"he thought.Now, it happened to be the elk whom he had visited.So then at last he found out who it was. As he wasabout setting out for home, he untied his mittens of rabbitfur; then, putting his mittens in the balsam boughs (underthe mat), he went out of doors. When some distanceaway he was come, out of doors rushed the childrenafterhim. And then one called aloud (to him): "Hey!"hesaid, "you forgot your mittens!""My nephews will fetch them,"he said to them.And then they saw where they were."And from afar do you throw them to him. He willnot refrain from saying something to you."Thereupon truly from afar were the children intendingto throw them to him, when, "Stop!"he said to them;"do not throw them into the snow, (lest they be lost,)"he said to them. "Come, hand them to me!" he said tothem. So accordingly he truly had them handed to him,whereupon back (the children) started racing as they went.Now, yonder parent of the children had said to them :"From afar do you hand them to him,for he will notrefrain from saying something to you."Therefore theytruly tried to do so, but (Nanabushu) prevented them.And this was what he said to them when he was given(the mittens): "Now, to-morrow let your father come,"he
"Wagunana""!"udigon""A302kwlwisansag, ajiwlndamawawat unlgiigowa 8 a kitunit Nanabucowan:Kaba katamwasa kmawa!,udina 4 8 i /u unlgiigowa 8 !gi /u kwlwisansag.Mlsa a kitut ainini :"Anlcina, ninga rca,"ikito.5 Cigwasa anitagwicin andawat. Anlc ubltawa8 unldcanisa8 4 8 i /u ka*a caminit. Cigwa x uganonan Ini/u wlwan :"Kawlnsana wfka tci U mackimuta kayan?"udinan mi /uwlwan."Indacka10 udigonIni /u wlwan.mlnawa awiya klwabamagwanI8 /u i iajictciganit,""Awawa rijictcigan udinan.Mlsa x kaga t ajimackimuta kat wayabaninik a8 a /u i kwa.Anlc abr l a s a /u Nanabucu, obl a-n.Cigwasa 7 piklgitowa 8unldcanisa 8 :"Nackaginm, cigwa plwita!" udigo 8 . Anlc15 mlsa / aciplndigagowat Ini /u plwitan. Misa 7 namadabinit.7kaglga a-nk l a s a /u udinan plwita?" !ni /u wlwan.Wagunandac 4 8 /u i ?"ayayan Ini/u wlwan.Anlc madciboton omo kuman.Cocammgwaniwan upiwitaman.20 Ml cigwa kro nagotaki kwat. Anlc cigwa uglgidis kakunamawanudani kamanini ini /uwlwan, acini tawaganabinatlni /u wlwan-, ajipacicwat ima pi kwananing. Anlcina, "IgoM"udigon.Cocammgwaniwan Ini /u ublwitaman. "Tagackuma, Nana-25 bucu," udigon. Anlc, m!sa / aci-a 8ntutamagiit ( /u i i mo kuman,mldac agut:Nanabucu !"udigon."Taga,Nanabucu!" udigon. "Agackuma,Acimlnat 4 8 i /u mo kuman, acipacawaganacumint mi /uwlwan, mlsa 7 kawln kanaga madapislwan. Pa kwadicumint30 lni /u wlninon. Cigwa uglpa kwadicwanini,u , Nanabucu,
he"he303said to them. When the boys had raced back home,they told their uparents what Nanabushu had said. Youmust be hungry the !boys said to their parents.he said.Thereupon said the man: "Of course, I will go,"In the mean while (Nanabushu) was arriving home. Now,he fetched home to his children what had been given himto eat. Then he spoke to his wife, saying: "Whydo younever weave bags?"he said to his wife."Nodoubt but that again he must have seen somebodydoing that,"he was told byhis wife."Go ahead and do it!" he said to her.Thereupon truly did the woman set to work weavinga bag on the morrow. So at home was Nanabushu, hewas waiting for (his guest). At last came his children,saying: "Oh,see! here is a visitor!" he was told. Sothereupon in where they were came the visitor. Andthen he sat down."What shall we feed the visitor?" he said to his wife.his wife."Now, what do youhave?" he was told bySo he began filing his knife.Then a smile was on the face of their visitor.Then finally (Nanabushu) hung up the kettle. So whenhe had unfastened his wife s shoulder-straps, he uncoveredhis wife at the back;then he sliced her down the backwith a knife. Naturally,"Ouch!" he was told.There was a smile on the face of his visitor."Pray,let me, Nanabushu !" was told (by the visitor). Now,therefore, when (Nanabushu) was asked for the knife, thishe was told: "Do,Nanabushu!" he was told. "Please letme, Nanabushu !" was told.When (Nanabushu) gave him the knife, then was his wifesliced down the back, and so not a whit did she wince.What was cut from her was her fat. When the fat wascut from her, "Now, Nanabushu, therefore now do you
"304mli /u ajitclba/kwan," udigon. Ajro da pinaminit 48 i /u a kalkanja ajisinagwanaminit ri ma pi kwananing Ini/u wlwan.Cigwa pasigwlwan, "Mrr u , Nanabucu, ta i ciwlsiniwag kinltcanisag,"udigowan. Mlsa gaga t a pana misa 7 ka/a-ni-5 madcanit !ni x piwitamiwan.Mlsa 7 cigwa wlsiniwat.35. NANABUSHU AND THE WOODPECKER^Cigwa pa kadawag a pidci,mlsa 7 acimadcat Nanabucu.Cigwa, mlnawa udiciwa. Mlsa 7 mlnawa acinawat anicinaba 8 ,nlciwa 8 unldcanisini. Kawln kago wabandamawasm wa-;10 kwaganinandam.I8 /ui iandanit.Wagutugwanigic madciwagwan!wamndacna u"Cigwa, i klga*a-siwank I a 8 a /u kiplwitaminan?"Mlsa 7 kaga t cigwa ujl tawan Ini /u ininiwan;wawaci 5 wanuka tigwaning, udicicimani Ini /u miskosanamanan;mlnawa15 udontcibitonini plwabi k a pidci kacibotani.Amc, unisitawinan ayawaninig, mlnangwana 4 8 i /u ijictcigawatlni /u o kunasanwm 3 cagunanit i i ma ucangwananinganlc magwagu klnamadabinit. A lpl ka kici u nit, panimaguwandcinawatinanit Ini /u mi^tigon pata l kisunit i i ma andanit ;20 nondagusiwan."Ku ku 7 k, ku 7t kuk!" inwawan.Anic inabit Nanabucu, rnaman owabaman; cigwa utanikwa kwanibabamani !ni /u mi tigon. Cigu ku 7 udanikutcisagawani;ml ku aclgu^waninit i i ma tclga tig. Anlc, plnicigurrwiti cpiming ani a yawan, apl tcinag Ini /u caylgwa madci-25 kwa igawan. Mldac ningutingiku, ini kwanininit, asibanan1For other versions see Nos. 42 (p. 357) and 53 (p. 423).
305cook,"he was told.Taking up some charcoal, he rubbed(Nanabushu s)wife with it on the back. Then rising tohis feet, "Now, Nanabushu, your children will eat," theywere told. Thereupon truly forthwith went the visitorupon his way.Thereupon now did they eat.35. NANABUSHU AND THE WOODPECKER. lSoon were they much in need of food, whereupon offwent Nanabushu. Now, again was he a-visiting.And soagain they whom he saw seemed like people, (and) theyhad two children. He saw nothing of what they had;along lodge they occupiedin the world theyeat!" he thought.for a home. "Wonder what"Now,what had we better feed our visitor ?"Thereupontruly the man began getting ready he painted himself;on the forehead, the kind of paint he used was the red;furthermore, he took up a piece of metal, with a verykeen edge due to filing.Now, (Nanabushu) recognized what it was, for the thingthat they did was to put the bone-pointed spear 2 intothe nostrils while he was seated there. When he hadfinished painting himself, he suddenly made for a postthat was standing there where they lived the sound ofhis cry could be heard: "Ku /l kuk, ku kuk! w was his cry.Now, when Nanabushu looked, he saw the red-head(woodpecker) ;and (the bird) kept busily noddinghis headto see where to find something on the post. At last hebegan to try pecking the post; and occasionally, ceasingfrom his work, he held his head close to the post. Now,by degrees he began making his way upward, every nowand then he would begin pecking away. And so by and2 Okunasanwln, "bone-pointed spear 5"literally,"bone missile."20 PUBL. AMER. ETHN. SOC. VOL. VII.
O306pimiba towan, misa minawa pajik pimibisowan. Misa nl n j8kmisat/u i i asibana 8 , pa/i jinlsakwacimonumt. Misa acimamonitrrma ka/a^tonit 8i iucangwananing /u plwabi k.Misa 7 acigaba tawint ft/u asibana s ; cigwa agwa a-mawa5 tciwisinit. Mlsa/ cigwa x klwlsinit, cigwa x kanona : "Anlcmlsa" ka ijiklwawitawatwa kimtcanisag mini k ackwantcigayan,"kri na.Misa 7 minawa, wanimo k,slgirrma ka u ndcicagontaginatl sminawa/u i iuglco ta*u-na s . Misa x minawa animadcat.10 Panimagu madwaplpagi,"AM" madwa-i^kitowan. "Kiwanicigagoma!"madwai kitowan. "Amc, wagutugwanigic?"i kituwan ininiwan. Mlnangwana guca kaga t kabunit 4 8 i /uuglcota/irna 8 .rrwiti pacoca^kagun,"udina 8 4 8 /u i unldcanisa 8 ."Wasaguundciwabinamawi k.Kagu x win"Kaya15 tabiwabinamawag mri*ma a pl undciwabinamawi k,"udinas /ui i unldcanisa 8 . Anica 7 kaga/t cigwa x o o^wldac udina8 /u i i unldcanisa 8 : "Kawlnningutino klgabwa i guslvva."ku7<widac udina8Cigwasa 7kaga/t udanawra^pagitawawan, cro7Nanabucu :"Kagu kawanagunawabinawag." Mldac kagat20 ka/rcimlnawat. Anawi pimadci ba i tiwag Igi /u kwlwicancagka i ciinat : "Akawa, ma i i ayayu k c 8 !" o 7 dac udina 8 :"Kaga tisa 7 kiba kadamwasa," udina 8 . "Mlguca wini i upabatacrkawat Igi /u kltcikiwan>rwag ;migui u pimita papao-pagamaganiwatpapatacfkawat Igi /u kltcikiwa n i-wag, l ifii /u
"307by, as he pecked, (Nanabushu saw) a raccoon come running(out), and then another came falling down. And so, afterkilling the raccoons, he came down from the post. Thereupon he removed the metal which he had placed therein his nose. And then the raccoons were cooked for(Nanabushu) ;then they were dipped out for him to eat.And so then was he eating when he was addressed :therefore, do you carry back to your"Now,children as much asyou do not he was told.eat,"Thereupon again, without being seen, he slipped hismittens (inthe balsam boughs under the mat). So then againhe set out on his way. After a while he heard somebodycalling aloud: "Hey!"he heard some one saying."Youhave forgotten something!"he heard him say. "Why,what in the world is it?"1said the man. It was reallytrue that where (Nanabushu) had been were his mittens."From afar do you flingthem to him. Do not go nearto him,"he said to (his boys)."And from as far as youcan throw is the distance you fling them to him,"he saidto his children. Now, really, for fun only did he say thisto his children :In no way will he refrain from sayingsomething to you."When they were reallyin earnest about throwing themto him, then this Nanabushu said to them: "Do not flingthem, lest they become lost in the snow." Whereuponthey truly went and handed them to him. In the act ofstarting to run away were the boys when (this)he saidto them: "Hold, wait there!" And this he said to them:"Really, you must be pretty hungry,"he said to them."That isexactly the way of your brothers wherever theyare;it isgrease that your brothers give so bountifullywherever they are, the hard frozen grease. Pray, when1The sense of the sentence isperhaps best conveyed by turningit into this :"(Idon tknow) what it can be (that he has forgotten)."
3 o8maskawatcipimita. Ambasino, a pl wabang kosiwa tapirca,"udina 9 . Misa anicimadcat. Tagucing andawat, ujl tami tigon ;ubada kinan andawat, wa/kwagan ugru ji tonkaya. Mldac agutlni /u wiwan: "Indacka mlnawa ka-i ci-5 nawagwan awiya," udigon Ini /u wlwan.7"Amandcigisaacimiwanan , kago anawi ?"cictcigayaninudinan Ini /u wlwan. Anlc, ugru ninan kaya ini /u usanamanankaya ini/u ukanasanwln. Mlsa 7 krklcl tatcaylgwaklgitowa 8 unldcanisa 8 : "Plwita!" i kitowa 8 .10 Anlc mlsa 7 aciplndigaguwat lni/u plwitan.Mlngwana dac Ini /u maman, anlc, mlwanini 11 tinowanka u disat.Cigwasa 7 oganonan lni /u wlwan: "Anln dacinai u amba, kiga a siwang l a s a /u plwita?"udinan lni /u wlwan.Cigwa uganonigon: "Wagunaci i u ayayang kaglga-i wayang?"15 Anic unickimigonlni /u wiwan."Caylgwusa pl stca unagoc4a 8 a /u akik,"udinan mi /u wiwan. Misa 7 gaga t a 8 a /u i kwaanagonat ini/u udaki kon. Anlc, mlsa 7 caylgwa wawacru t/uNanabucu, acimiskunank8 i iucangwan. Anic, cigwa,minawa ucagwunansi ipiwabi k ma i i acingwanang.20 Magwasagu namadabit wadcipasingwitcisat/unawatinat Inimi tigon kapatalkinat;ania kwantawat. Cayigwa nondagusi:"Kirku k, ku ku k, ku ku k, ku ku k,"inwa. Cayigwasaanic ka i cinawatigu ijictciga, cigwasa 7 uwipa kwawanini /u mi tigon. Pitcinag abiting ani kwanit, acipata kiskagut,25 pana mi i-gu kipimibisu ; pangicing panagu kabi ti ku kamigicing.Anic, miskwi ucangwanang. a Misa7 kitonit ini /uupiwitamiwan:ini /u i kwawan.aAnina i u mayawibinasiwat?"ini /umawan
39the morrow comes, let your father come over,"he said tothem. And then on his wayhe went. When he arrivedat where they lived, he made ready for a post ;he placeditstanding in (the place) where they lived, for he too hadmade a long lodge. And this he was told by his wife :"No doubt but that he must have seen somebody elsedoing he was told by his wife.that,""Now, why should you want to dissuade me from something I wish to do?" he said to his wife. Now, he put inorder for use his paint and his bone spear. And so bythe time he was ready, then said his children? "A visitor!"they said.So thereuponin where they were came the visitor.Ithappened to be the red-head, why, the very sameone whom he had visited. Then he spoke to his wife,is it, pray, we don t feed the heguest?"saying: "Whysaid to his wife. Then he was answered : "What on earthhave we to feed him?"Naturally he was angered by his wife (for speaking so)."Now, you hang up the kettle,"he said to his wife.her kettle. So itThereupon truly the woman hung upwas then that Nanabushu began painting himself, paintinghis nose red. Now, then,next he stuck the metal in hisnose. And while seated, up from there he leaped, seizingthe post that he had put up on; up the post he went.Presently he was heard uttering: "Ku ku k, ku ku k, ku ku k,ki^ku k!"(such) was the cry he uttered. Now, what he hadpreviously seen them do he was doing now, he was nowpecking the post.At the firstpeck he made, he waspierced by the metal, whereupon down he fell; when hefell, he struck the ground with a thud. Well, his nosewas bleeding. Thereuponsaid their visitor: do"Whyyou not lift and set him up?"was what he said to thewoman.
" 1Ainwawan.3 ioMlsa gaga t ajimayawibinat a s a /a i kwa. Oo*widacudigon Ini /u plwitamiwan: "Udickunan mawln Ini /u usanamanan.Ambasino, pic," udigon. Mldac gaga t, acimmat,acimiskunamit isi/uu s ka l tiguni.Mlnawa utibabandamo-5 wanini kaglcagunank ima cingwanang. Kaga t, ajiwl kubitawat,aciminat Ini /u plwitamiwan.Magwagu namadabinit, panimagu undcinondagusinitmaman acinawatinanit Ini /u mi; tigon, mlsa / utanikwa kwanibabamani,andigwa ku anigakwatikwa i gawan. Cigwasa10 madi kwa i-garwan, asibanan klpimibisowan, aca mlnawapacig misa n! n i; j klnisanit, pa cinlsa kucimonanit.Amc, mi u icigwa kimi kawit Nanabucu, udigon: u"Mi ita iciwlsiniyu k kinldcanisag," udigon. Mlsa x gaga t anicimadcanit,misana kiwisiniwat.36. NANABUSHU is MIRACULOUSLY FED BEAR-GREASE. ]15 Ningutingiku mlnawa a pidci pa kudawat; paba a yat,mlnawa plwita8 2udodisa 8 ,ml gayabinl n ciwa e abinotclya 8 .Mlsa x mlnawa cigwa wfkiga/rnt. Misa x a kidunit : "Wagunackaglga a kitowa s U nk?" i ., igickana kislnan l s /ui iunagan,mi tigunagan."20 Misa 7 gaga t acigismamowint. Magwagu kinamadapinitlni /u ininiwan, panimagu wandcinawatinaminit 4 8 /u i utabacini;ftmldac anwanit : Sa sa sa sa !" Mldac rrmaupimita kupitcikaniwang aji a-gosinit, aciwacananit Ini /uuniciwani. Migosidac uda kunamini, nondagusiwan:"Sank,1See Nos. 40 (p. 341) and 52 (p. 421).
(such)Thereupon truly the woman lifted and set him up.And this she was told by their visitor: "Doubtless he mayhave left unused some of his paint. Pray, giveit to me,"she was told. And so truly, when she gave it to him, hepainted the forehead (of her husband) red. Furthermore,she examined what he had stuck into his nose. Truly,when she pulleditout, she then itgave to their visitor.And while seated, of a sudden the red-head beganhe seized the post, he examined place aftercalling ;whenplace as if,as he went along, he was testing where topeck. Presently, when beginning to peck, a raccoon cametumbling out, then later another; whereupon, on killingtwo of them, he then came down from the post.Well, so when back to consciousness came Nanabushu,he was told : "Therefore do you and your children eat,"he was told. Thereupon truly when the other set forthon his way, then did they eat.36. NANABUSHU is MIRACULOUSLY FED BEAR-GREASE. lAnd another time they were very much in want of food;while wandering about, to some other strangers 2 did hecome, and they also had two children. And now againwas he to be fed. So this they said: "What have we tofeed him?"they said. then "Well, you had better cleansethe vessel, the wooden vessel."Thereupon truly she cleansed it for him. Now, whilethe man was seated, suddenly from where he was hegrabbed his lodge-pole ; and then he uttered the cry:"Sa sa sa sa !"was the cryhe made. And soupon the cross-pole (over the fire) he went (and) perched,holding his testes in such way that they bulged out solid.And with an awl in his hand, he could be heard saying:2 Plwlta e , "strangers."The usual meaning of this word is "visitor" or "guest;"i.e.,one to whom one renders hospitality.
"3 I2sank, sank!" inwawan. Mlsa mlgucro dac andasanondagusitnimawat Ini/u uniciciwan. Ningutingiku acipacipawat,panagu pimita kaslgisanik, ma kupimita. Mlsa cigwamockinabmi 4 8 i /u mi tigunagan. Acinlsandawanit, acra ca-5 mint l 4 8 i /u pimita."Ka/rckwan-Anlc, misa klwlsinit.Cigwa mlnawa ina :taman, kim tcanisag anikikiwawi ta 11 krrna.,"Mlsa x mlnawa, animo k,i i ma ka/ijicagwantaginat 4 c i /uuglco ta U na 8 .Cigwaw10 "A*, kiwanicigagima !7 anijimadcat, oglnondawan tablbaginit:"Taga,inabiwi k rrwiti kagi tanabit."Inagwanadac kaga t ka a binit ugico ta/cxna 8 .7"Wasaguundciwabinamawi k. Kawln ingutino kibwai-guslwa.Wasaguundciwabinamawi k."15 Cigwasa 7 gaga t udanuwra^ pagitawawan."Ca, ca, ca, plni kigu!"Mlsa 7ltgaga aniwipimatclba tiwa 8 l s /u i i iabinotciya 8 , ajikanonat:Klpa ka tamwasa klnawa. Wabang kosiwataplca."20 Anlc, migu mlnawa tagwicinandawat. Anlc mlna minawakiwlsininit unidcanisa 8 . Misa7 cigwa 7 krirci tod mi tigunagans.Anlc, caylgwa piklgitowa 8 unidcanisa 8 : "Plwita!"i kitowa 8 . Anlc pindigawan piwitamiwan, cigwa uganonanlni /u wlwan :"Ambagickana, wagunacwina ayayang pa-25 kanag?""Mimawln a 1 tana 4 8 /u iayayang kaglgawang I 8 /ui ipimita."1Aci a camint,"hegave the grease" (to Nanabushu) to eat; literally, "they gaveit to him toeat," or, more literally, "he was givenit to eat."
313was what he uttered. And in"Sank, sank, sank!" (such)time with each of these words he aimed a blow at histestes.By and by he pricked them gently with the point,and straightway out flowed the grease, bear-grease. Andso in a while full was the wooden vessel. Then, climbingdown, he gave the grease (to Nanabushu)to eat.1Well, and so he ate. Then again he was told: "Whatyou fail to eat up, then back home to yourchildren doyou take,"he was told.Thereupon again, when no one was looking, (in amongthe balsam boughs did he2) put his mittens. When onhis way, he could hear the sound of some one calling tohim in the distance: "Hey! you have forgotten something."his"Doyou look there where he sat."And so it was true that there where he had sat weremittens."From afar do you throw them to him. He will notrefrain from saying something to you. From afar do youthrow them tohim."By and by they tried throwingthem to him.fetch them to me!""Wait, wait, wait, wait, just youback did the childrenThereupon truly on their waystart to run, when he spoke to them, saying: "You peoplesurely must be in want of food. To-morrow let your fathercome over."Well, accordingly againwas he come at home. Sochildren eat. And then in time heagain did his poormade a wooden vessel. Now, presently hither came hischildren, saying: "A visitor!" they said. So when in cametheir guest, he then spoke to his wife, saying:what else have we that is different?""Well, now,"Theonly thing we have to feed him is the grease."2Under the mat, as a bedding.
"A" 1A,"utigon." lAIni /u3Hu, ambagickana, kislnan i u mi tiguna^gans,"udinanwlwan."Kagatsa kitaiyawina ku i u a/r kitoyan. Anti ka irntinamangls /ui ipimita kagiga/a wayang?"udinan. Anlc,5unickiman.1A U !magwasagu kmamadabit Nanabucu, pamagu wandcinawatinang4 8 i /u udabanc;kawln kijinja7kaski irslani a*-lkwantawat. Wi ka mina 7 kaski o* i i ma ubimida kupitciganiwang.Cigwasa 7 klwanagosi. a /u !, mindimoya10 Naska a ton scibaiyaT l /u i i mi tigunagan." AcigitcipinatIni /u uniciciwan, aciwacanat. Misa / acinanlmawat nondagusit."Sank, sank, sank, sank!" inwat. Ningutingiku acipacipawat,klbimibiso.Klgitowan Ini/u upiwitamiwan:"Agwawabini k!Awana-15 nlwinan dac win a 8 a /u a rndit wrkagickaku Nanabucu!"Misa 7 acagwawabinigut mi/u uplwitaman. Cigwa kigitowan:"Tagakislnan i u mi tigunagan,"Kaga t la c a /u i kwa uglkisman."Aton ima clbaiyaiPanimagu wantcra l kwan-20 dawasanit mi /u piwitamiwan, adcitarnon nondagusiwan:"Sank, sank, sank, sank!" Misa x antotaminit;wacananitIni /u uniciciwani, acipacibawanit; panagu 7 ma kupimita kasl-/ugitciwaninik. Kawin kanaga waya acimockinablnik l s /ui imi*tigunagan.U , udigon kanisandawanit. "Nanabucu,/<u25 mri taciwisiniyu k kinltcanisag," udigon. Misa 7 anicimadcanit.Misana mmawa kiwlsininitl s /u i i unldcanisa 8 .
Thereupon315"Very well, come on, cleanse the little bowl!" he saidto his wife."Trulydo I dislike you for what you are always saying.Where shall we get the grease with which to feed him ?"she said to him. Well, she angered him.How now ! for while Nanabushu was seated, he suddenlyseized the lodge-pole from where he was;but he was notable to go nimbly up the pole. After a long while wasthe poor thing able to reach his place on the cross-pole.At last he was perched aloft. "Allright now, old woman!See that you place the wooden bowl directly underneathOn(me)." taking out his testes, he squeezed them till heheld them bulging tight.And so every time he aimedas if to hit them, he was heard to say: "Sank, sank, sank,sank!"(such)was the sound he made. And when hesuddenly pricked them, down he came falling.Then said their guest:"Jerkhim out (of the fire)!What a fool Nanabushu must be to be ever trying to dowhat (he sees) others do !"he was pulled out(of the fire) by his guest.Then he said: "Do cleansethe wooden vessel."The woman truly cleansed it."Put it there beneath (me),"she was told. Suddenlyfrom where he was the guest went skipping up, the Squirrelcould be heard saying: "Sank, sank, sank,sank!" Thereupon he did as before :holding his testes so as to bulgeout solid, he pierced them; forthwith some bear-greasecame flowing out. It was but a moment when full wasthe wooden vessel. "Now,then!"(Nanabushu) was toldwhen the guest was come down from the pole."Nanabushu, therefore will you and your children now heeat,"was told. And then away went (the visitor).So again his poor children had food to eat.
"!"3 i637. NANABUSIIU AND THE MALLARD. 1Anic, caylgwa mlnawa pa kada Nanabucu. Ningutingikumlnawa udotisan anicinaba 9 ml, kayabi nPciwa 8 unitcanisinini.Mlsa x aniTnabit, "Wagutugwan madclwagwan?"inandam.5 Cigwa klgitowan Ini /u ininiwan :"Ambasino, unagota kilkwan,"inimawan Ini /u i kwawan.Misa x gaga t anagota ki kwawan lni/u i kwawan. Cigwawawaci o wan mrwininiwan ucawasko o sanamanan, uwlngaustigwanining udicicimanini. Cigwasa x kl kiciowan. Mag-10 :wagu kinamadabinit, panimagu, wandcinondagusinit "Kwlc,kwlc, kwlc, kwic!" inwawan. Undcipasigwaowan ininiciban 3acipomnit i i ma ubimita kupitciganiwang, nondagusiwan:"Kwlc, kwlc, kwlc,kwlc!" inwawan. Owawabaman misinitpa kic klgitowan: a O, o, o, rnindimoya! ana/a n,"udinan.15 Anic ml a pana misinit,"O, l o, o,!mindimoya1ana/a^n."Misa x gagat onondan Nanabucu manomin madwaatiwantanik.Cigwasa 7 pangutani, acinlsipomnt. "Awisa^ mri /<uka iciwisiniyamban, Nanabucu," ina ."Skwantcigayan, kinltcanisagkitakiwawitawag."20 Mlsa x gaga t, cigwa wrklwat, mlnawa acicangwantaginatmri/>uO uugico ta o na c .Panimagu mlnawa madwablbagit.madwaplpagi."Nanabucukagowi kitotug,"udinan."Kaga t,kiwanici-!gaguma Taga,inabiwi k i i witi gagltanabit."1For another version see No. 41 (p. 351).
(such)37- NANABUSHU AND THE MALLARD. *Well, already was Nanabushu again becoming hungry.And one other time he came to some people, and theyalso had two children. And now, as he looked about,"What in the world must they have to eat?" he thought.Presently said the man: "Please do you go and hangup the kettle,"he said to the woman.tThereupon truly the woman went and hung up the kettle.Presently the man painted himself with a green color, allaround over his head did he putit. In time he was donewith painting himself. And while yet seated, and of asudden, he started forth from the place, uttering: "Kwlsh,kwlsh, kwlsh, kwlsh !" was the sound of his voice.Up flew a Mallard 2 that alighted yonder on the cross-pole,he was heard saying: "Kwlsh, kwlsh, kwlsh, kwlsh!" J^such)was the sound of his voice. (Nanabushu) observed himmuting, while at the same time (he heard him) saying:"Ho, ho, ho, old woman! keepit stirring,"he said to her.And all the while (the Mallard) muted, (he was saying):"Ho, ho, ho, old woman! keep it stirring."Thereupon Nanabushu truly heard the sound of his riceboiling. When it was boiled, then down from aloft came(the Mallard). "Now, therefore shall you eat, Nanabushu,"he was told. "Whatyou do not eat, then to your childrenmay you take."Thereupon truly, while about to return, he again put hismittens (in among the balsam boughs). And later on hewas again heard calling with a loud voice: "Oh!" he washeard calling out."Nanabushumay want to say something (to you)," (theMallard) said to (his children). he has"Truly, forgotten!something Now look yonder where he sat !"2 Ininiciban, "mallard;" literally, "man-duck."
""udigonAnlcMlsa gaga t kra biwa 8 s /ui iugico ta irna8 .Ugapinawa 8 nindocimag, ta r kito. Wasagu undciwabinamawik. Kawln ningutino kibwa/rguslwa."Mlsa gaga t, wasagu udanawi u ndciwabinamawawan,5 mlsa anat: "Ic, pimiciciyu kiku!" udina 8 . Mlsa 7 gaga t Igi /ukwlwisansag awlcimmawat.Kipa10 mri""Ic,"udina 8 ,"ambasino a pi wabang kosiwa tapica!katamwasa klnawa."Anlc mlsa 7 , gaga t, wayabaninig ijanit !ni /u ininiwan. Anlcpaprirt Nanabucu. Cigwa madwaklgitowa 8 : "A e e 7 ,piwita!"madwa i kitowat. Cigwasa 7 plndigawan.Cigwa uganonan Ini /u uwlwan :Amba, kackana, anagomlsana cigwa tciglgaanguban a 8 a /u plwita."taki kwan !Mltaclzan agut!ni /u wlwan: "Wagunan tana i u kiglga-i -!"15 wayanguban Ini/u wlwan.Amantcisa 7 8win /u i kri- ikitoyan kago aninanin !unagoc o a ki k !" udinan.PisaniguKaga t anago taki kwani a-i- kwa. Odontcimatacimanucawaskosanamanan;aciwawaci irt, aci O cawaskwanangs20 /u i iustigwan. Cigwa klklci u* ; magwasaguklnamadabit,panimagu, undcipasiguntcisat. "Kwlc, kwic, kwic, kwlc!"pinwat. Kawln ml nayanj. kaski*o sl mri ma anawri catupimi ta kupitciganiwang- wl kasa kaski o*.Cigwasa 7 krcvnagos!i*i*ma agotcininit uda :kikowan, nondagusi "Kwlc,25 kwic, kwlc, kwlc !"uganawabamawan agosinit, kaga-
"And there truly were his mittens.My nephews may fetch them, he will say. And fromthem to him. He will not avoida distance shall you flingsaying something to you."Thereupon truly,when from afar they intended throwingthem to him, he then said to them: "Oh,come give themto me!" he said to them. And so truly the boys wentand gave them tohim.he said tosay," them, "would that when to-morrow"Iis here, your father might come over ! You (people) mustbe in want of food."So thereupon, truly,on the morrow thither went the man.Naturally in waiting was Nanabushu. Presently he heardthem say:"Halloo! a visitor!"(Thus) he heard them say.Then presently in he came.Then (Nanabushu) said to his wife: for "Oh, goodnesssake, do hang up the kettle ! for it is our duty to feedthevisitor."Thereupon he was told by his wife: "For mercy s sake,what have we to feed him!" he was told byhis wife."Whatpossesses you to talk that way whenever I tellyou to do something Simply go on and hang up this!kettle!" he said to her.The woman truly hung upthe kettle. He had hisgreen paint spread out in ; painting himself he colored hishead green. Presently he was done painting himself; andwhile seated, and of a sudden, up he sprang. "Kwlsh,kwlsh, kwlsh, kwlsh!" was the sound he uttered. It wasa long while before he was able to get to yonder crosspolehe was a; long while getting there. Finally he wasperched over the place where hung their kettle, he couldbe heard (uttering): "Kwlsh, kwlsh, kwlsh,kwlsh!" Nowthey watched him perched aloft, with his anus openingand closing. He was not able, with all his efforts, to ease
320gwantciskanik utcltlni. Kawln ugaski toslni anawi mislt ;wi kasa pimipitani umowancic."Niya,eM"udigon Ini/u wiwan.Anic, a pana aninawagi kwaninit Ini /u uplwitamiwan, anicsi i5 gagicipawantciwantanig /u umowancic. Misa intawaacinisantawat Nanabucu."Taga, pic kiwawaci u-n," udigon Ini /u plwitamiwan."Taga, awigislblgin kita ki kowa," udinan.Anic mlsa / gaga t caylgwa ki kislbiginat. Aci*a nagotot10 pa kanatinik i si /u nibi.7klwawaci u nit !ni /u piwitamiwan, anic cigwa nondagusiwanininiciban, ajiponlnit upimita kupitciganiwang.Anic misa 7 cigwa mlslnit, panagu manomin kaslslgipitanig.Cigwasa / mockinawan uda ki kowan, acininlsiponmit. Mlsa 715 a kitunit : "Nanabucu, mri/>uina.,ta iciwlsiniyu k kimtcanisag,"Anic mlsa / cigwa x ka a nimadcanit, mlsana klwisininit 4 8 i /uunldcanisa 8 .38. NANABUSHU is GIVEN POWER BY THE SKUNK, BUTWASTES IT.Cigwa* mlnawa madca babamusat. Ningutingiku saga-20 *i gan umada kan, owabama ki kinantawana s l pata kisunit.Midac anantank: "Anicinabag inangwana inantam.ayawag,"Animadcat. Cigwa kaga owabandan t twa/i gan wanta i -plnit; mosotclt watwa ibaninit, kagatsa mi^ca kwatini.1Ki -kinantawan,"balsam." This is an old word seldom used in conversation;it means "the one that spots the place" (where water is).The more usual word iscingup, which, however, refers to any kind of fir-tree.
321himself; but after a long while there fell a miserabledropletof dung.his wife.oh!" he was told "Oh,byNow, down at once their visitor lowered his head, forround about in the boiling water whirled (Nanabushu s)sorry droplet of dung. So then accordingly down climbedNanabushu."Pray, give me your paint,"he was told by their guest."Now, go wash your he saidkettle," (to the old woman).So it was true that soon she had finished with washing(her kettle). Then she hung up the kettle with a differentkind of water.And when their visitor was done painting himself, thenbegan the sound of the Mallard, who then was alightingupon their cross-pole. So thereupon he began muting,and forthwith some rice came pouring out. When theirkettle began to fill, then down he alighted. Thereuponhe said: "Nanabushu, therefore now shall your childrenhave enough to eat," (such) was said (to Nanabushu).Well, so then upon his way he went, and accordinglydid (Nanabushu s) poor children eat.38. NANABUSHU is GIVEN POWER BY THE SKUNK, BUTWASTES IT.Soon again he was off travelling afoot. When onceout upon the ice of a lake he came, he saw a balsam lstanding. And this he thought:"Somepeople, no doubt,are living there,"he thought. On his way he continued.Presently he truly saw a hole (in the ice) from which theydrew water;with the anal gut of a moose had they madethe hole, exceedingly large was the vesicle. Great was hisdesire for it. When he laid hands on it,he heard the21 PUBL. AMER. ETHN. SOC. VOL. VII.
322Kagatsa umisawinan. Ajro da pinang, madwakanonigon:8a l,Nanabucu!"Ic, poni ton I /u i i .Klgasanagi udigon.Misa gaga t intawa "Omaajipagitinank.pljan !"udigon.Mlsa gagat kaniciku plt, cigwasa 7 uglga i gon, misa x wlsinit.5 Anawiwlskuntciga Nanabucu. "Miguaji a caminan,"udigon.7ga kina icimltcin miMlsa 7 gaga t ga kina acimldcit. Uwabaman gaga t minditowancigwa uganonigon. "Nanabucu, intigukuca kipakada."10"Kawln,"udinan."Kawln, Nanabucu, kipa kadasagu. Kigi kanimin pa kadayan.Panglns kiwlcawanimin, wandci i ninan," udigon."Ayefi, nistclmista, gaga t nimba kada,"udinan.laV u"Amc,mlsa 7 cigwa x tciki kino-a monan kadicictcigayan,"715 udigon. Ommigon bibigwans."Mlsa o kagabatci toyan,"udigon.7"Miguo tci a nikiwayantci o ci tot kimindimo i*-mic wa kwagan ; manogu taginonda. Mldac klklci tot,o o widac/ukiwlmmin ka u ndcinanatwa lgi kapmdigawat7ima kiwa kwaganing. Mlgu i aciki kino a monan, o^Mac20 kiga i-cictciga," udigon. Mlnangwana mi/u micicigagwankaganonigut. "Nlcing tciabatci toyan kiwlmmin4 8 /u i i ka/u*ndcinanatwa,"udigon. "TcigwasaNanabucu.7taga tcangitiyacinan,"inaMisa 7 , kaga t, cigwa 7 kitcangitiya kisut. Cigwasa 7 ima25 ijitiyaniwan aji a cawipogititamagut. Mlsa 7 kato tagut.ugri gon:"Ambasino, iyangwamisin, Nanabucu,"1Klgasanagi a , "you will put us in want for another;" literally, "youwill renderit difficult" (to replace).
323voice of some one speaking to him: "Hold, Nanabushu!do you let that alone. You will putother,"he l was told.us in want for anThereupon truly he chose to leave it be. "Come hither!"he was told. It was true that when he went up from thelake, then was he given food, whereupon he ate. It wasthe purpose of Nanabushu to save (some of) the food."Just you eat all that I have set before you,"he was told.And so actually the whole of it he ate. He saw thatreally big was the one who now was speaking"Nanabushu, it really seems as if you were hungry.""No,"he said to him.to him."Nay, Nanabushu, but you are really hungry.I know thatyou are hungry. That a littlemercy I may bestow uponyou, is my reason for speaking thus to you,"he was told.to"Yes, my younger brother, truly hungry amI,"him.hesaid"Well,therefore then will I teach you what you shalldo,"he was told. He was given a small flute. "Now,this is what you shalluse,"he was told. "That whenold woman make ayou go back home, then shall yourlong lodgelet it; be, oh, a long one. And when shehas finished it, then this do I wish to give you, so thatwith ityou may kill them that come into your long lodge.So accordingly as I instruct you, thus shall you hedo,"Skunk that waswas told. Ithappened to be the Bigaddressing him. "I intend to give you the means of usingtwice what you are to use in killing them," he was told."Thengo you down upon your hands and knees,"Nanabushu was told.And so, truly,he then got down on his hands and knees.Presently from the other direction faced the rear (of theSkunk), who broke wind into (Nanabushu).Such was what(Nanabushu) had done to him. And this was he told :
"Minandam."ugri gon ;324"klgaTniga/a-g kinltcanisag,"krrna. "Naskagutaka/rcictcigayan kra/nitagwicinan antayan ; kajinondagwamotoyan o s o /u kibabigwan, mldacigu kaciplndigawatmosog 48 i u kiwa kwagan. Nlbawadacigu pindigawat, o^o 75 ta i cictcigawag, kiwi tacagamawag i i ma tciwa kwaganing.Mlsa 7 pisaga-a/nk au naganlt, mra lpl kapogitiyan ; tcipindcipogitiyans /u tciwa i ikwagan. Mldac ga kina ka i cinibuwatrrwiti pindik ayawat. Misa 7 tciwavvlsiniyan. Mlnawaklgitamatwa, inlnawa klganontagamatawag. Mlsa 7 tciwa-10 baniciyan, kawm kayabi kigapa kadasl. Misa x i u ajiki kinoa-monan,"udigon.Cigwasa 7 animadca Nanabucu, gagatsa 7 wawicantam.Ningutingiku, anipapimusat, gagatsa 7 ki s tcimi tigon owabaman."Kuniga indabimigutuk niclmisa 7 kagrrcit!" inandam.15 "Taga, ningapogitcina,"inantam a c a /u Nanabucu. Mlsa 7gaga t ajipogitcinat Ini /u ki 4 tcimi l tigon, migu u i ajipigiski-minangwana gaga/t tabimit a^a 711 nislmisa 7sanit.kagri cit,"11^inantam.acipogitcinat ;inabit awaniban Ini /u ki tcrarsinln.Anlc, udamanisu tagon mi /u kacawanimigut.Misa x papimusat ningutingiku, mmawa owabaman aga-20 matci /u ki tci a sinm abinit7"Taga , kuniganata gaga t!"indabimigut "Taga, mmawa, ningagutcra/a s a /u kitci a sin,"inantam. Misa 7 kaga t cigwa 7 minawaWaguna-25 nlwinan Nanabucu wani tanondasi k iniga a t unitcanisa c !"
325"Please be careful, Nanabushu," he was told; "(else) youwill do your children a hurt,"he was told. "Now, preciselythis shall you do when you have come at your home :you shall blow a tune upon this flute of yours, whereuponinto that long lodge of yours will come some moose.And after many have entered in, this they will do :theywill walk round about inside of your long lodge. Andwhen outside comes the leader, then shall you break wind ;(do it so) that you make it go into your long lodge.Thereupon shall die all that are there within. Then youwill have some food to eat. After youup, then again shall you blow upon yourhave eaten themflute for them.Consequently you will live through the winter, not againwillyou be hungry. That is all I have to teach you,"he was told.Then uponhisway started Nanabushu, truly very proudwas he. By and by, while walking along, he saw anexeedingly large tree. "Wonder if my younger brothercould be tellingme the truth in what he said to me!" he"Ithought. say, am I going to break wind at it," thoughtNanabushu. Thereupon truly he broke wind at the bigtree, accordingly he wrecked it completely. there"Why,really is no doubt but that my younger brother is tellingme the truth in what he said to me,"he thought.While walking about on another occasion, he saw alarge rock over beyond a hill. "Now,wonder if reallyhe told me the truth!" he thought."Isay, once more Iwill make a test on that great rock,"he thought. Thereupon truly did he break wind at when it he; looked, therewas nothingleft of the big rock.Now, the sound of (Nanabushu) doingthis was heardby him who had taken pity on him. "Howstupid ofNanabushu to bring disaster upon his children by notpayingheed !"
3 26Anlc, pasigwl Nanabucu, anri ca abini pan Ini u ki tcra/-sinin. Wi ka ku ingutci apiwanltug acipigiskisanit."Mlnangwana kaga t tabimit nislmisa,"krrnandam. Acitagwicinkantawat, "Mindimoya, ninglcawantagus,"udinan Ini/u5 umindimo rmican. Mlsa x cigwa x udinan: "Wabang uci tota4 8 /u li wa udinan Ini /u wiwan.kwagan,"Misa 7 gaga t cigwa x kruji towat wa kwagan. Cigwalka klci towat a s a /u mindimoya, udinan Ini /u"Unabin,"umindimo rmican. Misa 7 gaga t cigwa kru nabiwat, cigwasa 710 unondaguma ton lc /ui iubabigwan. Cigwa gaga t moso sugiwabamawa 8 pldciba i tinit. "Indackagu kago mlnawakiticibabmi ; ta n zimitug," udigon Ini /u wlwan. Misa x kaga tpmdigawa 8 moso 8 i i ma wa kwaganing. Cigwasa7saga a*-mon Ini /u nagamnit7cigvvasa anawipogiti, mlsa x kawm15 ugacki tosm 4 8 /u itcibogitit. Gagatsa uniski a*n umindimo-imican."Gagatsakawm kini tanondanzl kago anuglrnikin awiya kago," udigon lni/u umindimo rmican.Anicagu kagagwanguskanik 4 8 /u i utclt. Misa 7 ajibwanawitoti il stcibogitit,mldac wandcinicki a t ini /u wlwan;pmic ga kina saga a mo 8 mini kamc 20 kaga/t uglnicki*a*n ;I 8ka pindiganiti i moso 8 ,mldac wandciniskra/t !ni /u wiwan.Mldac igu cigwa ga kina pimisaga a-minit, ka rcipa kita/o -watiskwatc pimisaga a-minit a 11 mindimoya. Acipo kwugadawatIni /u mozo n san, "Awananlwinan dac win I a 8 a /u !25 Kuniga anugri natug 4 8 /ui i ka i citcigat!""Aye8, gaga t! Kawmina nicing indanugiminigosi moskinawat awaslyag tcinisagwa?"
327Now, up to his feet rose Nanabushu, thither he went towhere the big rock had been. It was (only) after longpersistent (search that he could find) where here and therelay a shattered (piece of rock)."It is reallymy younger brother told me the truth,"a fact thatthought (Nanabushu).On his return home, "Old woman, I have been blessed,"he said to his old woman. Thereupon he then said toher: "To-morrow let us build a long lodge!"he said tohiswife.Thereupon truly did they build the long lodge. Whenhe and the old woman had finished it,"Sit down!" hesaid to his beloved old woman. It was so that when theywere seated, he then blew a tune upon his flute. Thentruly did he see some moose running hitherward into theplace. "(I) suspect that in something else you have nodoubt been disobedient," he was told byhis wife. Thereupon truly into the lodge came the moose. When outstarted the one that was in the lead, then did (Nanabushu)try in vain to break wind, but he was not able to do it.Verily, did he angerhis old woman: "Trulyinattentiveare you in whatsoever is told you by any one,"he wastold byhis old woman.All he could do was to open and close his anus. Andsince he was unable to break wind, he therefore angeredhis wife; truly did he anger her; (he continued withoutsuccess), even when out went all the moose that hadentered, and that was why he had angeredhis wife.Thereupon, when all the moose were on their way out,the old woman then struck the one that was lastcomingout. When she broke the leg of the young moose,"What a simpleton he is!been told what to do !"(I)wonder if he could have"Yes,to be sure! Was I not given (the means of) twicekilling all the game-folk filling up the place?"
;328Mlsana klwlsiniwat agawa. Mldac ka rcra*boda a*nki /u mo n sotcitms, midac Wwiti wanta iplwat klyupimakwisitot.5Ugi kanima8 a pidci pa kadanit, a 8 a /u anugicawanimat."Ambasa 7 ninga i canan," upmanimigon. Mldac kagattcigwa klmadcat a s a /u micicigag. Misa^ cigwa udodisa 8 ,"Anin, Nanabucu, ka i-cisayan?" udinan.Miguta win ma i i udagamlmining wanda i bmit mozotcitms kipimita kwisinik, o^o^a wanda i binit.10 "Awanamwinan idac win kai ndit Nanabncu!" uba pi a-n.Amc, mlsa 7 : "Anincigwa udigon ka iciwabisiyan, Nanabucu?" udinan."Nislmisa 7 , kanamigu i^witi kl pimadcayamban, ayapitawrigu patagwicinan, ki tcimi tignimpipogitcinaban, gaya15 ki s tci*a sin. Mlsa 7 acictcigayan, amba idac ningra/nwandis."Mlsa x udigon: "Amc,mlnawa klga a-cawanimin," udigon.u "Mlipawaundci i cayan 4 c /u i wlcawaniminan."Cigwasa 7mlnawa ubogitcitamagon. "Kagudacmlnawa ijictcikakan."Anlc mlnawa nlcing umlnigon ayabatcitot. Mlsa x anici-20 klwanit.Mldac acikibotiyanigut Ini /u wiwan. Misa 7 kaga t. Cigwa 7gaga t mlnawa onondagwa ton 4 s i /u pabigwan. Mlsa x cigwamlnawa ubitasabama 8 mo n so 8 , kaga t cigwa plndigawa 87i i ma wa kwaganiwa. Cigwasa pisagamo 8 , nagamnit aci-25 pogitcinat. Misa 7 ajanisat, cayigwa inabiwat wandcita
"How329Thus the poor things had but little to eat. And sowhen she had turned the little anal gut of the mooseinside out, then across yonder place where theydrew watershe laid it.He knew that they were very much in want of food,he who vainly had taken pity upon (Nanabushu)."Therefore I willgo to where he is,"was the thought Nanabushureceived from him. Thereupon truly then off started theBig Skunk. And then in a while he was come at wherethey were. "What, Nanabushu, has befallen heyou?"said to him.Now, yonder at the lake where they drew water wasthe little anal gut of the moose lying across the place,thewatering-place.foolish of Nanabushu to have done so !"Helaughed at him. Well, and then this was Nanabushu told:"What has happened to you, Nanabushu?" (the Skunk)said to him."Mylittle brother, at the time when I came away from(your place), when about halfway I was come, at a greattree I broke wind, likewise at a great rock. That waswhat Idid, and I feel painfully sorry for it."Thereuponhe was told: "Well,once more will I take pity upon you,"he was told. "The reason of my coming hither is that Iwant to bless you."And so again (Nanabushu) had windbroken into him by the other. "Now,don tyou do itThus was heagain." again given what he should useback home went the other.twice. And then on his wayThereupon he was prevented by his wife from breakingwind. And it was true. Then truly again he played atune upon the flute. And so again he saw the moosecoming, truly now were they entering the long lodge.When they were coming out, then at the one in the leadhe broke wind. And so, after he had slain it,then they
" 1A/<u330mockinanit antawat mo n so 8 mini k nasawat. Anlc misanaklwawisiniwat.Caylgwa udigon Ini /u wlwan: "Ambasino, ayangwamisinkigaTniga-a/k ubinotcrarg 4 8 i /u kaickunaman."5 Anlc, mlsa gaga t mino a-yawat 4 s i /u mosu kawat. "Mlmawmii u igu 7 tatawabaniciyang," udinan Ini /u wlwan."MimawmI8 /u i i,"udigon."Gaga t kigi tcicawandagusi-udinan Ini /u unabaman a^^wi kwa.min,"Misa 7 mini k ka kanimak.,SERIES IV. No. 39.39. NANABUSHU AND SOARING-EAGLE.10 Mlsa 7 wipibonici magisiwac. Tcigwasa wlmadci ta kl n go n -yan wmotci a 8t,mldac /u i iajiwabamat kitagwicininit Ini/uNanabucuwan. "Nabwlnamamawitcigayang tcinotci a ngwaIgi /ukl n go n yag?"U,ml*iaciminwantaman omagu prrcigusin."15 Kaga t,Nanabucu pikabaci. Misa cigwa madci tawat,ki n go n yan nlbiwa unisawan. Kln go n ya 8 utatcitagonawa 8 .7A pitcisa nlbiwa unisawa. Cigwa kackadinini 8 u i isaga i -gan. Mlsa 7 acikusinit Nanabucuwan ka kina omadcina 8;ki n go n ya 8 .20 Misa pana kawm gago ogamidcism magisiwac."Anlckatiyang?" Anawigu pa tamnuwa iwa anicinaba iman saandanisit. Cigwa kipibonini, mlsa cigwa pa kadat. Ningu-
33looked, (and saw that) the place where they lived wascompletely filled with all the moose they had killed. Thusthe poor creatures had all the food they wanted to eat.Then he was told by his wife: "Please be careful, lesthave left."you starve the children (by wasting the means) youWell, it was so that they got along comfortably on themoose they had prepared for use. "There is no doubtbut that we shall now go through the winter," he said tohiswife.is "Itquite he was told.in likely," "Truly, high degreehave we been blessed," to her husband said the woman.That is as much as I know of (the story).SERIES IV. No. 39.39. NANABUSHU AND SOARING-EAGLE.And now Soaring-Eagle was planning to go into campfor the winter. And in a while he intended to set aboutto get some fish, whereupon he then saw Nanabushu, whonow arrived (at his place)."Would it not be well for usto go together to get the fish?" (said Nanabushu)."Very well, and in that case I should be pleasedifyouwould move your belongings over to this place."Sure enough, hither came Nanabushu to camp. Sothereupon they set to work ; many fish they killed. Theyhung the fish upon racks, with the heads down. Everso many they killed. In time frozen became the lake.Thereupon Nanabushu moved camp ;all the fish he tookaway with him.And so not a single thing was left for Soaring-Eagleto eat. "What will become of us?"Yet, for all that,many were the people at the place where he was. Intime the winter came, whereupon he then lacked food.
"332tinigu, unagucininig a pitci wlwlsini , kayas /u i i unitcanisa 8 nlciwa 2 . KuckwawatisiwaIni /u wiwan kaya8.Awiya pitwawacinonajipmdiganit. "Magisiwac,kiwi kumigo."Udonagan ka irda plnang, ajimadcat. Misiwa anuplndiga5 Tni /u wlgiwaman, kawln kuca umi ka^ln ml; ga kina anugigapackankIni /u wlgiwaman, intawa aciklwat. Aciplndigatiyandat, uganonigon Ini /u cwiwan : "Anln dac /u i i kiwl kumigowmr"Kawm ninkutci nimrka n zm tciwl kunding."10 Misa a l pi ajiki tcimawinit Ini /u wiwan kaya unldcanisa cintawa ajikawicimuwat ; weyabaninig mlsagu kawln kagoomltcislnawa. Cigwa mlnawa tibi kadini, midac kaga/twlwlsiniwat.Cigwa, anitibi katini, pamagu pata pabinit awiya.Magi-15 siwac kiwrkumigo."Ka u ti tinank udonagan, sagitcikwackuni,agawagu ugasa kawabaman animiba tonit. Ki tci a yapisikat umatcinlcawan. /uKunigimn, utanikabi kamini Iniwlgiwaman ; slpi klckabi ikanig anibintigasawan ; mlgu /ui sanitanisit.Anipmdigawat, muckinabiwa 8 wa kuntinit. Ki s tci-20 pa pi a .Namagusan wa kuntinit, kitcinibiwagu acama.Kayabigu ickusawan Ini /u tclba kwanan. Cigwa kanona:magisiwac"Mlmawini u ikaga t tcinondapaniciyan. Intawakigaki kino a mago ka/rcictcigayan. Wabank kimindimo i*-smic tablmina kwa. Klklci tot iblmina kwan, midac /ui i25 ka rciki tcitwa/rgayan ima n waplgamagi*i/>usagai gan.
"Where333Now, one evening he craved exceedingly for some food toeat;so too (did) his wife, and his children, two in number.They were living quietly (there). They heard the footsteps of somebody approaching, who then came inside."Soaring-Eagle, you are invited to a feast."Taking up his bowl, he then departed. In every wigwam he entered, but to no purpose, for he did not findthe place (of the feast) ; accordingly, when into all thewigwams he had entered in vain, he then went back home.On entering into the place where he dwelt, he was addressedby his wife :issaying the food you got wheninvited ?""Nowhere did I find the place of the feast."Thereupon then bitterly weptAccordingly then went they to bed in the; morning therewas nothing for them to eat. In time it was night again,his wife and his children.for food to eat.whereupon truly did they yearnNow, it was beginning to grow dark, when of a suddensome one came up (and) peepedin."Soaring-Eagle, youare invited to a feast."Seizing his bowl, out of doors heleaped, and scarcely did he catch sight of him who wentrunning away. As fast as he could go he pursued afterhim. Lo, the other sped past the wigwamsinto the fallsof a river the other ran, whereuponin he rushed. Asthey went on in, (he found) the place filled up with guests.He was made much fun of.(Itwas to eat) trout thatthe invitation was given, and with a great deal of it(Soaring-Eagle) was fed. There yet remained some moreof the food that had been cooked. Presently Soaring-Eagle was spoken to: "It is indeed quite possible that youmay starve before the winter is over. Therefore you willbe taught what youshall do. To-morrow your old womanshall make some twine. After she has finished the twine,then you shall make a large hole in the ice over at yonder
334Mldac /u li usi tank kigatana pina a e a /u kinldcanis. Kabotakwawamica kisatdac mli u ka/rciwl;kubinat, tcra/nigu ktcikitciwabinat. Midac ima n tciwabamat a s a /u namagus.Klnigu klgatibabamag mlmawln mini k katabisawat. Ka/a*-5 pi tcibibonk mrV u ka ijickwa taiyan. Misaguna u acica-iwanimigoyan. Mri * 11, magisiwac, iciglwan. Magica abidingklgawisinim, mri 11 icikiwan. Klwawic namagus."Mldac rr u ajipindigat iu andat, kaga t motcigisiwan miwlwan kaya unidcanisa e ; tci a*nigu k wisiniwa 8 .Misagui u10 cigwa x madci tat a u mindimoya pimina kwat kabatibi k ;wayabaninig okici ton i i u obimina kwan. Kigicap ajimadcatmagisiwac ; wlwan wldclwat saga i ganing icat. Ka tagwicinkwapigamank iu saga i gan ajitwa-i gat. Ka klcitodudwa igan, uda kubinan lni /u unldcanisan, usidaning tana-s15 pinat.Mldac /u i iacipoda kwa irwat. Cigwa 7 mica klsawan,anigu k aciwfkubinat. Ka kidickubinat, namagusan pigitciskusawan.tMagisiwac kaga minwandam. "Kavvin nindayanacrtan zlMlnawakabaglcig." acipoda kwawat Iniunldcanisan. Cigwa x mica klsawan tci a-nigu k uwl kubinan.20 Acikl tciwabinat, namagusan owabaman. Mldac kagatminwandank a umaerisiwac.Cigwa x unagucinini. "Ambasano, midac a ta u i kanisankIa 8 a /u Kaga t nlbiwa. "Mlmawln s i i mini knamagus."kadapisawat kaya pltcipibong.1A U ,midac a ta u ipajik25 tcinisank." Opoda kwawan iniyonitcanisan. Cigwa x mica kl-
335narrows of the lake. Accordingly, then byits feet shallyou tie your child with the cord. You shall putinto the hole; and when it has reached the bottom thenit downyou shall draw it out, with all your power shall you pullon it. And then there shall you see the trout. And youyourself shall see when you think that (the fishes) areenough. At the end of the winter then shall you cease.And this is the way that you shall be blessed. Therefore,Soaring-Eagle, do you return home. Perhaps for once you(and your family) will have food (enough) to eat, thereforedo you go on back home. Take back some trout."And so when he entered his home, truly pleased werehis wife and his children;with great eagerness did they eat.Thereupon then did the old woman set to work weavingtwine allnight long when it was; morning, she finishedthe twine. In the morning then departed Soaring-Eagle-,along with his wife, he went on his way to the lake.When he got to the narrows of the lake, then he madea hole in the ice. After finishing the hole in the ice, hethen bound one of his children; byits feet was where hebound it. itThereupon they put down into the hole.When itgot to the bottom, then with all his might hedrew it out. After he had pulledit out, then the troutcame out of the ice. Soaring-Eagle was really happy."I will not stop throughout the whole day."Then anotherof his children he put down through the hole. When itgot to the bottom, with all his power he pulled upon it.When he gaveit a great throw, a trout he saw. Andthen truly pleased was Soaring-Eagle.In a while the evening was drawing in. "Behold, justone more trout I will kill." To be sure, (there were) manyto last"It(trout). may be that they are now enoughthrough the winter. Therefore only one more will I kill."Down into the hole he put one of his children. As soon
ka;336sawan, uwfkubidon. Acibwawipitod ayangwatcic, tcra/niguk udanawikubidon. Kaka pl acipa kibidot, misa panaunldcanisan. Tcianigu k mawi 7 magisiwac, kayayu wlwan.Indawa, ka i ckwamawit, uglgo miwa 8 uglwawinawa ka kinai5 andawat. Ka ciwmawat s /ui i iklgo n ya s madca, awigagwatwatmldac icat iniwa nigigwan. Cigwax: "Mlsauganonani u kmisangit l a s a /u ninldcanisinan."Aciganonint magisiwac:"Ambasa ,nawatc mbiwa ugawaci ton kimindimowimic8bimina kwan. Kl klci tot, mldac /u i i ka i-cimadcayan,kl-10 ga i ca ima 11 klpa kibinat a 11 kinidcanis. Magisiwac, klgikandaninawandcima kamigoyan a u kinidcanis? Usam15/unlbiwa kiglnisag Igi gi n go n yag. Klnicki a a 8 a /u micina-u da pinat kimtcanisan. Klga gackra"-.>umagwa. MraNandawabamat, ml nasab ka/rcictcigayan, tcita kubisoyanima kisidank."Magisiwac mi cigwamadcat. Twa i bi. Ka i ckwatwaibit ajipa kublt. Maca klsat owabandan ml kana pimamunik.Ajimadcat, mada irdot mi kana. Kumagu a pl20tagwucink, unontawa awiya piba pinit.Owabama 8 i kwawa 8 ;ajiganona c : "Anin anano kiyag wabigamagr"Nindawinicipa pinotawanan wisanta.
"With337as itgot to the bottom, he drew it back. As he waslosing his pull on it the longer (he held on), then withall his power he tried itdrawing back. At last he brokethe line, and then gone was his child. 1 Very bitterly weptSoaring-Eagle, and also his wife. Accordingly, when hehad ceased crying, they carried all their fish back to wherethey lived. After they had dressed the fish, he departedthence to make inquiry ;and so he went to where theOtter was. In time he spoke to him, saying: "Thereforenow have we slain our child." Then was Soaring-Eagleaddressed by him saying: "Behold, let yourmake some more cord. When she has finished it, thenold womanshallyou depart, you shall go to the place where youbroke the line (that held) yourchild. Soaring-Eagle, doyou know why your child was taken from you? Toomany of the fishes have you slain. You have angeredthe Great Sturgeon. He is the one that has seized yourchild. You can obtain (your child).When you seek forit,you should follow the same method that (you did) before,by having yourself bound by your feet."Soaring-Eagle then departed thence. He made a holein the ice. After he had finished the hole in the ice, hethen went down into the water. When he got to thebottom, he saw a path that led off (in a certain direction).Then he started forth, following along the path. Whenat a certain distance he arrived, he heard some oneHe beheld some women; to themcoming along laughing.he spoke, saying:what are younarrows?"busied at the"We intend to meddle with the deadened pine."21Because he had not obeyed what had been told him when he was blessed.It is a common belief of the Ojibwa that he will come to some kind of grief whokills more game than needed. Therefore wanton destruction of gameis a taboo.2Where a net is.22 FUEL. AMER. ET1IN. SOC. VOL. VII.
"A"NindawipaAsabln miwanini 11 sacawat. Midac /u i ipitaanind. Owabama 8 . "Anm anano klyag?"a/mwat minawapinotawanan pabamitagotag u kanab." 1Anijimadcat, pacu owabandan odana. Pajig owabaman ;5 oganonan:"Nldcanis pa*irndcrrcayan.""Mru-ma ayat a e a /u kinldcanis. Kawln kidamlnigusl. Mla u nindogimaminan ayawat Iniyu kinldcanisan. Intawaa kama 11 tcisaga a nk ; unagwucig mi a p! tcisaga a nk."Cigwa unagucinini. Madwaglgito pacig inini : "A e,10 mlsa minawa mimisiwag cigwa tciamwangwa." Cigwapimisaga a mon ; kaga t minditowan micinamagvvan. Wasa xunl-cigwa anitagwicinon plndigasa andanit ; uglwabamandcanisan. Aci u di tinat, tci a nigu k udo to kablgiba to siplmina kwan. Ki^ci a nigu k uwl kubiton l a a /u mindimoya.15 Pa kic anigu k madca Magisiwac. Cigwa udababandanudwa igan. Abanabit pltawaniwan wlnawadamigutini /ui /u20miclnamagwan. Midac ka e ga t anigu k ajimadcat, acigitcipisutrrma n udwa ibaning. Ka kitcibisut, inabit, udwa r-ganing pisagi kwasawan miclnamagwan, acigi tcipisunit.a /u , mindimoya, kiwaga kwat mamon ! Niwana /s !"Mindimoya 11 udoda pinan owaga kwat;uniwanawan Ini /umiclnamagwan. A ta, kaga t minditowan !"Mindimoya, kiwawinata." Kawasa ugackiasiwawan anawiudodabanawan. Anicinaba c unadamaguwa s ,mi pitclnag
339It was to a net that they were going. Accordinglythen came some others singing. He saw them. "Whatare youbusied with?""We are going to meddle with the cord that hangsacross."lAs he started on, not far away he saw a town;a certainone he saw; to him he spoke, saying:"It is on accountof my child that I have come.""In this place is your child. It will not be given toyou.It is our chief that has yourchild. Therefore youwould better wait till he comes out;in the evening iswhen he comes forth."In time it was evening. There came the voice of aman saying: "Well,so then we shall have some moremayflies to eat." Then (he beheld the chief) come forth ;truly big was the Great Sturgeon. When a long wayoff(he saw that the chief) was come, he flew into where (thechief) lived; he saw his child. Then grabbingitup, withall his might he ran, jerking uponthe cord. As hard asshe could the old woman pulled uponit. At the sametime with speed went Soaring-Eagle. In time he came insight of the hole. On looking back, (he saw) the GreatSturgeon coming with mouth open to devour him where;upon truly at full speed he went, out through the holehe flew. After he had flown through, he looked, (and saw)the Great Sturgeon with his head out of the hole in theice, then out upon the ice he leaped. "Now,old woman,get your axe ! Pound him to death !"The old woman picked up her axe; she clubbed theGreat Sturgeon. Ah, truly big he was !"Oldwoman, let us carryhim home!" Not even werethey able to drag him. By the people were they helpedto drag him, and that was when they were able to handleiWith the cord at the edges of the net.
kawin340kackra/wat. Misa u icigwa ki tagwicimawat. "Kaga t,kiga-a-camanan wa 8 a /u nigig kacawaniminang."Kaga t minwantamog acamitwa lgi /u nigigwag. "Magi/>usiwac, mri wfka klgapa kadasi. Keyabi wawi i -5 goyan ki s tci unicicin ka i-cictcigayan.A 8 a /u Nanabucukini tam kigapa kada a*. Awikimodim lni /u uglgo n rman."Kaga t ajimadcat Magisiwac. Ajikacki tot ugrrcigimotimanmi /u Nanabucuwan. Kaga t, ugikackiton ka kina kl kimotimat.Misa win ni tam Nanabucu kipa ka tat.Kaga t10 minwandam Magisiwac pa kadanit Ini /u Nanabucuwan.Misa pinawitclt agatag.SERIES V. Nos. 40-42.40. NANABUSHU is MIRACULOUSLY FED BEAR-GREASE. lNanabucu aTnda wlwan kaya mlnawa kayals /u i iunltcanisa8 nlciwa 8 . Misa 7 mri u wi pibonicit Nanabucu, kawinugigri gon Ini/u awaslyan, kawin ogiwanisasln. Ningutinguganonigon wlwan: "Anm ka l icipimatisiyank? Wl ka kagotcini tosiwan."kago udayasm kamldcit. mi Mlsax cigwa piboninig madci-15 tat antawantcigat. E, kawasa kago uni tosm ! Mo n cag320 "Nintawamocag ningakiyota," kitu Nanabucu. Wayabankliajimadcat. Ningutingidac, pimusat, anicinabanutolkawi a*n mada a nat; saga i ganingtawan. Amnabit uton-1For other versions see Nos. 36 (p. 311) and 52 (p. 421).
341him. Thereupon they then got him home. "Intruth, wewill feed the Otter that has blessed us."Truly pleased were the Otters to be fed."Soaring-Eagle,therefore never shall you be in want of food. Somethingvery much better isyet to be told you to do. It is nowyour turn to make Nanabushu hungry. Go rob him ofhisfishes."Truly thence departed Soaring-Eagle. As much as hecould did he rob Nanabushu. In truth, he was able tosteal them all from him. itAccordingly was Nanabushu sturn to be hungry. Truly pleased was Soaring-Eagle tohave Nanabushu in need of food.And so now the buttocks of the ruffed grouse hang aloft.SERIES V. Nos. 40-42.40. NANABUSHU is MIRACULOUSLY FED BEAR-GREASE. lNanabushu was living with his wife and two children.It was there that Nanabushu intended passing the winter,but he had nothing to eat. It was now becoming winterwhen he undertook to seek for game. Alas ! not a thingcould he kill. Often was he given the slip by the gamekind,none did he kill. Once he was addressed by hiswife saying:"How are we going to live? Never a thingdo youkill.""Thereforealways will I go a- 3 said Nanabushu.visiting,"On the morrow then he departed. Now once, while walkingalong, he chanced upon the footprints of some people, inwhose path he now followed; by a lake they lived. As2 Visiting among friends, generally with the sense that the visitor goes to "sponge"off his guests.
!"inwawan,"A342ta-rbanining, mldac iman wabandank ma kutiska k;lH -wisatwa-rbaganit rrman wanta i blnit. Anlci kuplt, wlgiwamklpata kitanig. Ajipmdigat ininiwan namadapiwan, kayaikwawan, kaya 4 8 /u i unltcanisini n!ciwa s . Inabit Nanabucu5 ma kowminon papa kwanit. 2 tKaga umisawlnawan ini/uma kuwlninon.Midac 4 8 /u ikigitowan ininiwan "Wagunacina kagigaa-nk3 a u blwita?":Mldac u iajikigitunit Ini /u i kwawan : "Amcina antotaman/<u10 wawisiniyangiban, mri katotamambantciglga/i wayan."Ajiklgitut a 8 a /u inini :"Taga, pidon 4 8 /u i utcictcini k."IKaga t acimmint I a 8 a /u Inini. Kaijimlnint,kaslyapi c kinan."a /u , unagan4Kaga t a i tl kwa ajikasiyapi kinank, wawmga ka pmi tot8i1 5 iu unagan mlnawa /u i utcictcini k; ajikaslyapi kinang.Ka klci tot, magwagu namadapinit lni /u ininiwan, panimagupasingutcisawan nawatinaminit l s /ui i aba n n "Sa sa n sa n j, , ,sa nMidac ima n pimita kupitciganing kuniginmuniciciwani owacanani, pa kic nondagusiwan, "Sank, sank!"20 inwanit. Midacs xi iwani kagicim pacipawanitutcictcini k ammawanitls /ui iunicicis /u i i uniciciwani. Ningutingiku,acipacipa wanit 4 8 /u i iuniciciwani, panagu ma kupimita untcitciwanini.Ajiklgitut I a 8 a /u atcitamu : "Mmotcagonan u iwanagan."1The anal gut was used to start the hole in the ice by one end of it being helddown on the ice, and some one sucking from the other.2 The true idea conveyed here is that the strangers had so much food that theycould even use it for making a dwelling.
!"343he looked about the place from which they drew water, helsaw there the anal gut of a bear; now, that was what theyused in making a hole from which to obtain water. Ongoing up from the shore, (he saw) a wigwam standing.On entering, (he saw) a man who was seated, also a woman,and their children, numbering two. While looking about,Nanabushu saw (chunks of) bear-tallow, which they usedfor a lodge-covering.2Trulydid he covet the bear-tallow.And then up spoke the man: "What shall we give the3?"guest (to eat)Whereat up spoke the woman: "Why,the same as yougenerally do when we want to eat, is what you should dowhen providing your gift."Then up spoke the man: "Well,fetch hither the 4awl."Truly was it then givento the man. After it had beengiven to him, "Now, then, a vessel do you wipe."clean didTruly, when the woman wiped it, thoroughlyshe make the vessel;next the awl was what she wiped.After she was done with her work, and while the manwas yet seated, of a sudden up he sprang, seizing holdof the n lodge-pole."Sa sa n sa n sa n, , , (such) was the soundof his voice. Thereupon yonder upon the cross-pole (hewas surprised to see him) exposing his testes, while at thesame time he could be heard making the sound, "Sank,was the sound he made. And it was withsank!"(such)the awl that he aimed at his testes and almost piercinghis testes with it. And then of a sudden, when he piercedhis testes, immediately some bear-grease came flowing out.Then up spoke the Squirrel:"Hold the vessel close upagainstit!"3Kagiga-a-nk?"What shall we give (to eat)?"This expression occurs in suchconnections as here, where food is the thing given;and so it has come to be asynonyme for but its real sense is in the "to feed," giving of a present.4 uUtcictcini k,that is, the awl made from the ulna, usually of a moose,deer, or caribou.awl;"
5"the"344Kaga t a a r kwa ajiada tot iman ka/rcipangiganik i i /upimita ;mistci wlba mockinablnik. Ka/i jimockinabmi k iwunagan, pinlsantawawan.wawlsiniyanin."aMlsaguna i* ua/rclyan kayanln5 Anlc, Nanabucu a pidci pa kada."Ambagic wawlp klgagowan,"inandam Nanabucu. Mlnawa wlyas kagat wanicicininik,ma -- kowiyas, abi iutagu pimitawaninig ; kayadacl fipimita Nanabucu pagidinamawa /u i i kamldcit. Kaga tminowlsini, kaya nlbiwa wisini. Ka i 11ckwawlsinit, migu i-ma10 wanimo k, ka u ndcina kibinat uglcota u na 81 nawatcigu unlngwantagina."Mlsacigwa wl klwayan."Nanabucu kanona:"Mlgiri11iciklwawita u kimtcanisag 4 s i /u kitickwantcigan."3Kaga t minwantam. Midac iu acisaga*ank.Kanisaga a minit,inabitla c a winini, uglwabamas lc /ui i15 klcota/u na 8 .Anlc, wabosawayani Nanabucu ugljo ta-u na 8 .Midac u iajikanonat a a* inini madci l tawi l lk:"Taga,c /ui iuugicota-irna c l a s a /u Nanabuca, wasagu undciwabinamawi kl s i iuglcota na 8 !"Kaga t, ajisagitcisawat lgi /u kwlwisansag no pinanawat20 mi /u .Cigwa udatimawin. Klwam kanag kiglco ta/u nag."Kaga t, wasagu nawatc anu*u*ndci a i paginawat, uganoniguwanNanabucowan u:lcta, kipa kadamawasa kmawa !Wabank kosiwa tabi i ca. Nlwawlsinimin nmawint."UgIcotJi U nac "mittens,usual word for mittens ismintcikawanag. The1word used here is for protectors against cold, and it may refer to mittens or earprotectors,it also refers to the string of rabbit-fur that isput through the hole ofthe ear in order, so it issaid,to keep the ear warm. The sense of this wordwould often seem to imply that it meant ear-warmers or ear-protectors ;but it isgiven as mittens, because the Ojibwa themselves regard that as the sense of the word.
he345Truly, the woman then placed (the vessel) there, wherethe grease might drip into it and very soon it was full.When the vessel was full,;then down came climbing (theSquirrel)."This is just a Iway have whenever I too wishtoeat."Naturally, Nanabushu was very hungry."Would thatImight presently be given something to eat!" thoughtNanabushu. Furthermore, there was some meat that wastruly nice, bear-meat, and half of it was in grease; andsome grease, too, did Nanabushu have placed before himto eat.Truly he ate good food, and much did he eat.After he had finished eating, he thereupon, without beingseen, pulled out his mittens, 1 and he hid them under thebalsam boughs (beneath the mat)."It is now time forme to go back home." Nanabushu was addressed (with!words) saying: "Therefore do you take back home to yourchildren the food which you did not eat up."Truly he was pleased. Thereupon out of doors he went.3When Nanabushu had gone out, (and) while the manwas looking about saw the mittens. Now, of rabbit->fur were the mittens of Nanabushu. Thereupon then (tohis children) spoke the man, saying: "Come, take themittens to Nanabushu, and from afar do you throw himthe mittens!"Truly, then out of doors sprang the boys, who ran inpursuit of him. Soon they overtook him. "You haveforgotten your mittens." Truly, when from a rather longdistance they tried to fling them, they were addressed byNanabushu saying: "Oh, but you people must be hungry!To-morrow let your father come over. We ourselves alwayshave plenty to eat."2Kitickwantcigan, "the food which you did not eat up;" literally, "yourleftoverfood."3That is, the Squirrel.
"Anlc kiwawag Igi /u346kwlwisansag."Anlcanri-nag a 8 a /u Nanabucu?""Ka,kosiwa taplca,i kito Nanabucu. A pidci nangwanaklpa kadam nangwana.5 Nanabucu aniijimadcat klwat; tcibwatagwicin andawat,upltamawa unldcanisa 8 kaya Ini /u wlwan utickwantcigan.A pidci minuwlsiniwa 8 , mlsagu pitclnag wlsininit.Kaga minwantam t awi kwa. Mlsagu cigwa ajimadci tatNanabucu utcictcini^k uci tot, kaya win wipacipa wat Ini/u10 uniciciwan. Ka kici tod, una i nan l e /ui i utcictcini k.Mfsa wayabanininig kabaglcik, ayabit prat Ini /u piwitan.Anlc udina unldcanisa 8 :"Acawabiyu k."Ningutingigupmdigasawa 8 4 8 i /u unldcanisa 8 :"Cigwapiwita!"Taya, kaga t pi irndcipindigawan Ini /u ininiwan.15 Nanabucu kawln kanaga kago otayasm. Misa ajiklgitutNanabucu: "Wagunacina ka*a-camak I a 8 a /u piwita? Mlnotc,kislnan iwanagan."Ka ickwagismaminit, "Mlnotc aiciyangkaya nmawint wawlsiniyangiban."lI8i /u wri cictcigat Nanabucu. Ni tam udoda pinan rr u20 utcictcini^k. A 8 ,Nanabucu ajinawatinank utaba n c, kawlnnangim kacki irsl anawra* l kwantawat. Wrka pitclnagajikacki-u t i i*man pimida kupitciganing icat. Mlsa7 iicinl-8cominaginat /u i i uniciciwa 8 , kawaninang utcictcini k, "Sank!sank! sank!" inwat. Kakicimigu ku l fii iwlcaganamat/u25 uniciciwa8 , ningutingigu acipacipa wat 4 c i /Ll uniciciwa 8 , panagukapi ti kukamigicink rrman nawackuta. Anlc mlgui s i /u a pitaganantisut.
"What347So back home went theboys."What did Nanabushu say to you?""Oh,Let your father come over, said Nanabushu.1So you really must be very hungry."Nanabushu was then on his homeward way before he;was come at where they lived, he was fetching to hischildren and his wife the food he had left uneaten. Verywell did they eat, and that was a time when they ate.Truly pleased was the woman. So thereupon beganNanabushu on the work of making an awl, for he alsodesired to pierce his testes. After he had finished makingit,he put away the awl.And so on the morrow allday long he remained athome, he was waiting for the visitor. So he said to hischildren: "Doyou keep Then watch." by and by inrushed his children: "Here is a stranger!"Ah, truly from without came the man enteringin.Nanabushu had not a single thing. Thereupon saidNanabushu :shall we feed the guest? However,do you wipe the vessel." When she had wiped it, "Why,this is the way we generally do whenever we want someto eat."thingThis was what Nanabushu intended doing. He firsttook up the awl. But when Nanabushu seized hold ofthe lodge-pole, he was not soon successful in his effortsat climbing up and;after a longwhile he was able toget upon the cross-pole (over the And whenfire). takinghold of both his testes in his hand, after that he hadseized a firm grip uponhis awl, then "Sank, sank, sank!"was the sound he uttered. Being almost ready to strike,he was aiming at his testes, when of a sudden he piercedhis testes, and forthwith down he dropped with a thudinto the centre of the fire. Now, the fall was so severeas to kill him.
1That is,"tried to fling."<l348IAnicagu nantaganimusig a 8 a /u i kwa agwawabinat,kawmigu ugacki a/sln anawiagwacimat.4A 8 a i kwa ajikanonatnupiwitaman:wltcri cin !",tcra-gwawabinag"NyaAjipasiguntcisat a s a /u ininiagwawabinawat. A tawa,5 kawlyablsut Nanabucu !Kaga t tcagisu wi ka l mi kawi.Mlsana papa kawisit Nanabucu.E 8 ,aba pic klnanamadapit a 8 a /u inini.Kaga pi, kigitowan:Kaga t"Taga kislblginint iyonagan!";acikisiblginit a i* kwa u iunagan, minawa 4 8 /u i10 utcictcini k.u "Mri . Plton iyotcictcini Acimmint I a 8 a /u inini.k."Panimagu, namadapinit, nawatinaminit apa n n "Sa sa n sa n !"j,,Mldac 4 U , "Sank, sank, wacanat sank!" uniciciwani Kagl-!cimigu ku micaganamanit 4 U uniciciwani, ningutingiguul15 acipacipa wanit, panagu pimita. A a /u mlnotc ininamu k,4 8 i /u unagan!"Kaga t mockinani unagan. Kamockinani k, pinisantawawan.Ajikigitot Nanabucu: at cA a /u , migu 4U ka n gl n ka-i wayank."20 "Kawasa 7 , kmawaguminit, anijikiwanit.intawa wlsiniyu k," a pan saga a--Nanabucu kagat minwantam wlsinint tmltcanisa 8 .2This sentence has to be recast with a free rendering, in order to give the sense.Its real meaning may b-e variously rendered: we did not see what he was"Well,
while!" and349Then, working with all her energy, the woman flung 1 himout of the fire; but she was not able, with all her efforts,to pull him out of the fire. The woman then spoke toher visitor, saying: "Oh,do help me take him out!"Then up sprang the man to take him out (of the fire).Oh, but Nanabushu got a hard fall !Trulywas he thoroughly burned. A long while was he reviving. And thencame the time when Nanabushu was conscious.Well, for a 2long time was the man seated there. Finallyhe said: "Come, wipe the vessel!"Truly then did the woman wipe the vessel clean, alsothe awl."That isenough. Bring hither his awl." Then was itgiven to the man. Of a sudden, while yet seated, he seizedthe lodge-pole. n "Sa sa n sa n, , then, "Sank, sank,sank !" he held his testes exposed. Almost did hestrike his testes when he aimed at them;and when byand by he pierced them, then forthwith was there grease."Come on, don t mind (anything else), but hold up thevessel !"Truly full was the vessel. And when it was full, thendown" from the pole he came.Then said Nanabushu: "Now, then, with that will wemake entertainment.""It is no use, only you yourselves had better eat."Then straightway out went (the guest), on hisway backhome he went.Nanabushu truly was pleased (to see) that his childrenhad food to eat.invited for, but yet the man simply kept on sitting there,"or ... without cheerhe continued sittingthere."
"A""ina""35041. NANABUSHU AND THE MALLARD^uni tosln.Wayabaninig ajimadcat klyusat, kawasa kagoMo n cag anukru sa, mlsontcita kawln /kago uni tosl. Mlsaa pidci pa kadat. Cigwa wayabaninig ajimadcat Nanabucu,mldacl s /ui ipabaantakiyotat. Ninguting uto kawra-n anicinaba2 omata a-nat., Kumagu a pl tagwicink, owabandanandanit. Anijiplndigat ininiwan namadapiwan, kaya wini kwawan kayai i /u unidcanisini. Ajikanonint:namadapin!"Nanabucu.l lA a /u ,Kigitowan !ni /u ininiwan: "Wagunacina kagiga/a nk a 1110 piwita? Taga, mmotc nibianagoton,"inimawan Ini /ui kwawan.Kaga t, agi kwan aciwanagonat a i a kwa. Magwagu namadapinit!ni /u ininiwan, undcipasigu o wan, nondagusiwan:"Kwank, kwank, kwank,"inwawan. Mldac ima 11 mida-:15 kupitciganing aciponlnint, nondagusint "Kwank, kwank,inwanit. A tawa, kunio-inm O acimlsinint Ima 11 a kikimk,ltowan : A a /u mmotc ana a n!"20Kaga t Ca 8 a /u udana-a n.Magwagu ana a nk, kuniginln,manomin a pidci mockina i i ma n a^ki kunk; kaya pankuta.u mri /pU ici-a, gwacim."Mldac 4 8 /u iacinlsiponlnint.Mlsaguna iu kaya mn a iciyan wawisiniyanin."MlnangwanaIninciban watisat. Kawunabinit, "Ambasa 7 , unaganinka ton,"Inimawan mi /u ikwawan, pidcigu mocki-"ana ton."1For another version see No. 37 (p. 317).
!"(such)4i. NANABUSHU AND THE MALLARD. 1When the morrow was come, then off he went on ahunt for game, but not a thing did he kill. Continuallywithout result did he hunt-, and, in spite of all he coulddo, nothing did he kill. Thereupon very hungry did hebecome. Then on the morrow away went Nanabushu, itwas to wander from place to place visiting (old friends).Once he came upon the footprints of some people, inwhose trail he then followed. When some distance fartheron he was come, he saw where they lived. On enteringin,(he saw) a man that was seated there, likewise a womanand their children. He was addressed: "Welcome! beseated!" was told Nanabushu."Then up spoke the man : Whathave we to offer theguest (to eat)? Well, anyhow, hang up (a kettle of) water!"he said to the woman.Truly, then a kettle did the woman hang up. Andwhile the man was seated, up he flew, and was heard tosay, "Kwank, kwank, kwank!" (such)was what he uttered.And then yonder upon the cross-pole (above the fire) healighted, being heard to say, "Kwank, kwank was!"the sound he uttered. Oh, how strange that when hemuted into the kettle, he was saying,"Come on, pay noheed, but keep it stirringTruly she stirred And it. while she was stirring it, lo,very full of rice was the kettle there and it was cooked;"Alldry. right!now take it off the fire." And thendown he flew, alighting. "Now, this is only a way I havewhenever I want to eat." Ithappenedto be a Mallardwhom he had come to visit. After the Mallard was seated,"Come, into a vessel do you put he said to the woman,it!""andvery full do youfill it."
"Aa"!"352Kaga t i kwa omockina ton i si /u unagan./u, Nanabucu, wlsinin!"Nanabucu ajimatantcigat.A pidci tawlsinit, ajanici tank./"Mlnamini k wasimyan?""Amn 5dac ka/rcikagantackineyan?""Nanabucu, m!gu*r u iciklwawic wa c a /u tclba kwan. Magicakinltcanisag pitama u ."Nanabucu ajiklgitut: "Mlcigwa wi^Iwayan." Mlgiri ma n ,wanimo k,10 pacuxani a yat.wantcicagunat(c /u i iuglco ta irna 8 .Ajisagaa nk,i i7 - 11a l kitutla c a /u inini :"Ambasino, kagu iciwitawakag l s /ui iuglco ta u na a c a /u Nanabucu.Mlsa kaga t kawln iciwltawasl. CigwaNanabucu kwlnawlpiu- tciblciwltawint. Aciplpagit:"Nlwunitcigagima15 Kawln anubisiskitawasi. Ackam anigu k ajiplpagit. Gaga pl,"Manu, iciwitawi k;wasa undcra pagitawi k 4 8 i /u uglcota-u-na."Cigwa owabama kwlwisansa 8 ."Icta, pacu x picayu k !iMlnangwana u acipa kadaya k. Kawln nlmpa kudasl.20 Wabank kosiwa tablca mamwatcigu nawa kwanig."Mldac4 8 i /u amcimadcat Nanabucu. Ka tagwicink antat, kaga tmotcigisiwa 8 umdcanisa 8 wlsininit, kaya Ini /u wlwan;a pidcitawlsiniwag. Wayabaninig mlsa cigwa ajiprirt Ini/u plwitaman,pra t nawa kwanig. Cigwa tagwicinon. Kawuna-25 binit, "Wagunacina ka a camank C a 8 a /u plwita?unagoc."mlnotc a ki ksKaga t,Nanabucu wlwan utonagoton /u i inipi."Anigu k pagitinisan, wawip tax wanso a 11 a kik."Taya,
"W"353Truly, the woman filled upthe bowl."Allright, Nanabushu, do youeat!"Nanabushu then began eating. When his desire for foodwas quite appeased, then he ceased (eating)."Is that allyou are goingto eat?""And how am I to force (myself) to eat (more)?""Nanabushu, therefore then do you take back to themat home the rest of the cooked food. Perhaps to yourchildren do you take it home."Nanabushu then spoke, saying:"It is now time for meto go back home." And so, when no one was looking,in under the mat he pushed his mittens. When he wentoutside, then near by did he tarry.And this was what the man said :Please do not carryto Nanabushu his mittens."And so, truly,he did not have them fetched to him.Already was Nanabushu becoming tired of waiting to havethem brought to him. Then with a loud voice he called :o"I have forgottenmittens!"my He was not harkened to.Then with a louder voice he called. At last, "Well, gotake them to him; from afar do you throw him his mittens."Presently he saw the boys.7 hy, come you up close !And so it is a fact that you are without food. I am nothungry. To-morrow let your father come over exactly atnoon."Thereupon away then went Nanabushu. Whenhe was come at where he lived, truly pleased were hischildren to have food to eat, so the same with his wife;thoroughly were they satisfied with food. On the morrowhe then waited for his guest, he waited for him at noon.Soon he was come. When he was seated, "What havewe to feed the guest? Anyway, hang up the kettle."To be sure, the wife of Nanabushu hung up the (kettleof)water."With much wood do you build up the fire, soon let23 PUBL. AMER. ETHN. SOC. VOL. VII.
354magwagu namadapit Nanabucu undcipasingutcisa nondagusit: "Kwank, kwank, kwank!" inwat Nanabucu. Kistciwlka ajikackru t iman mita kupitciganing Nanabucu.Kawanagosit iman mi ta kupitciganing, anigu k kintcitanamu5 anuwl kwatcimlslt,ubwanawi ton. Ningutingigu umisa kutcanajipangisinini t i i ma a ki kunk, ugandnan wlwan :"Mlnotc!ana-a-n."Ajiklgitut awi kwa :"Acamadci, madci anim !kigagwanisagia- la s a /u kita ki kunan ! Intawa ajipimipasigwlt awi-10 l kwa, pimipina wat !ni /u a ki kwan; pana agwatcing icatawislgwapinankl s /u i i nibi. Kaijikisiyabi kinat Ini /u uta kikowa,piplndiga a kwa. Nanabucu i- tayoc agos pimita kupitciganing; kawln kacki o sl anawlnlsantawat. Ajikanonatwlwan: "Kawasa ningacki O si anawinlsantawayan."15 Kaga t a pidci nickatisi a s a /u ikwa, nanantawlpagamaganat;a i^kwa cigwa umi kan mi tig.Nanabucowan ajiagosinit,klgito kwa i :dcinat lni /u a ki kwan.""Nackakuca, ningamwanawa klml-Cigwa wipa kita/u-nt Nanabucu, migu iwiti wantcipisut ;-20 pi*a nigwackwanit, mlsana kinogabamint Nanabucu.A tawa ! abapic kinanamadapi plwita. A pidci wiwisini,midac ajikigitut:"Taga, mlnotc anagoc au kita ki kowa."Kaga t, a i^ kwa udagonan Iniyoda ki towan; cigwasao n sowan.25 Kunigimn, undcipasigwa-o wan, kayagu nontagusinit :
the kettle boil." Aha !now,seated,kwank!"(such)355while Nanabushu was yetup he sprang, being heard to say: "Kwank, kwank,was the sound Nanabushu uttered. It wasa great while before Nanabushu was able to mount thecross-pole (over the fire).After he was perched up thereon the cross-pole, then with much effort did he gruntinvainly trying to ease himself; he could not do it. Butwhen by and by a lump of solid dung dropped into thekettle, he addressed his wife, saying:"Never mind! butkeep it stirring."Then said the woman: "Mercy sake, vile dog! you willsimply ruin our kettle." Accordingly,to her feet thewoman quickly rose; immediately down she took the kettle ;straightway out of doors she went on her way to emptyout the water. After she had cleansed their kettle, thenback inside came the woman. Nanabushu was stillperchedupon the cross-pole (over the fire).He was not able byhis own efforts to climb down. Then he spoke to hiswife, saying: "Not at all am I able, in spite of my ownefforts, to climb down."Truly very angry was the woman, she was in searchof something to use for a club ,the woman presently founda stick. While Nanabushu was perched up there, thewoman said: "Look and see! for I am going to club himto death who eased himself in the kettle."When Nanabushu was about to be struck, then fromyonder place he fell ;he leaped down when she made asif to hit him.Alas! without cheer there sat the guest. Very anxiouswas he to eat. Whereupon he said: "Now, forget everything and hang up your kettle."Truly, the woman hung up their kettle ;presently it beganboiling.At that moment up flew (the guest) from his place, and
""Kwank, kwank, kwank,356inwanit:. Mlsa aciponlnintiima n pimita kupitciganing pa kic nondagusinit:kwank," inwanit. Mlslwan :ajikanonigowatana/a mu k.""Kwank,"Mlnotc!5 Mlsa kaga t ana/a mowat, a/tawa kuniginm manomina pidci mockinatanig, kaya pangwaninig!aA u mri -* , iciagwasitok."Kaga/t udagwasiton a i- kwa.Mlsa^tawa saga a mon Ini /u uplwitamiwan. Mlsa 7 cigwa10 wlsiniwat Nanabucu.42. NANABUSHU AND THE WOODPECKER^Wayabaninig mlnawa anukiyusa, mlsa irndcita kawlnkago uni tosln. Mlnawagu animadca mrirntcita kawln;kago ani tosln.Kaga pi ajikigitut wlwan: "Kaga t klgo patis. Awacima15 intawa kistcikro tayan ; miya ta ka i ciwlsiniyangiban, mlya tatciwabaniciyank."Kigicap ajimadcat Nanabucu. Kumagu a pi tagwicink,saga i gan owabandan. A Inabit, awlya owabaman pabamatagakunit. Ani i cat, owabaman Ininiwan. kani-"Taga,20 wldclwin wrkiwayan." Cigwa owabandan wlgiwam ani-;pindigawan kaya win ka U nabit owabaman i kwawan tacimackimutakanit.Nanagagu cigwa kanonimawan x:agoc 4 a e a /u a ki k."1For other versions see Nos. 35 (p. 305) and 53 (p. 423)."Tagana,
Presently"357was heard saying: "Kwank, kwank, kwank," (such) wasthe sound he uttered. Thereupon he alighted yonder onthe cross-pole (over the fire) at the same time that he washeard saying: "Kwank, kwank," (such) was the sound heuttered. By him while muting were they addressed : Neveryou mind !only do you keep it stirring."Thereupon, truly, as they kept it stirring, how wondrouslyfull the rice filled (the kettle),and how dryit cooked !"Now it is time to take it off (the fire)."off the fire the woman took it.TrulyAnd so with disappointment forth from the place wenttheir guest. Whereupon then did Nanabushu (and hisfamily) eat.42. NANABUSHU AND THE WOODPECKER. lOn the morrow he went on another fruitless hunt forgame, and it was just his luck not to kill a thing.Another time he set out; but, as ill luck would have it,hedid not kill a thing.At last then up spoke the woman: "Really, you are ofno use. It would therefore be much better for you to goon a visit among (your friends); for only by such meansshall we obtain food to eat, only in that wayshall wethe winter."live throughIn the morning then departed Nanabushu. When somedistance away he was come, a lake he saw. While lookingabout on the ice. Whenaround, he saw somebody walkinghe started hitherward, he saw a man. let me"Pray, gowith you when you depart for home !" he sawa wigwam when in the other;went, so then (did) he.When he was seated, he saw a woman busily making abag. After a while she was then spokenhang up the kettle."to: "Please
<uusi?"."inwawan.358Kaga/t a kwa a i- ki kwan otonagonan. Ka klcrtat, panimagunamadapinit undcipasigwa 5 wan, abaclng apagisowan:nondagusiwan "Kwu, kwu, kwu, kwu !" Mman-maman watisat. Cigrwa. o ka tao-wicininit o iwiti sowaga-oogwana5 nink, ma^tigwa/rga wan. Nagatciku mantamina s pislgisawa 2mri ma 11 a ki kunk, mldac u i acimockinanit Ini /u uda ki kowan.Pa i cinisikwaskwaninit, misa / nasap anicinaba.Anlc, mlgu mmawa i u kiwawanabinit ini /u i kwawanmackimuta kanit, kigitunit Ini /u :10 wayank? mlnacigwuna i u"Wagunacinakaya pabo-Kunigimn, uga^a kasiyabi kinan i*i u mo kuman. Kunigimn,acimatagwacabinat mi/u wiwini, kuniguca pi kwananingacimaticwat, kumagu mini k uba kwacwan. Ka pal<ukwacwat, mldac H kon acisinagwunamawat Ima n15 klpa l kwacwat. Mld.ac ima n uda kikowang acipoda^kwa a/-mowat iwiyas. Aci*o n sunit oda kikowan. Cigvva kaklcitanig,aci a-gwablga-a nk; Nanabucu pagitinamawatcivvlsinitkaya -i* mandamina G .A tawa, mldac kaga t Nanabucu minuwisinit! A piclci/<u20 ka tawlsinit, mri aci a nacl tank. Mlsa / mlnawa ajikanatugico^a u na 8 . "Mri -/u madcayan Nanabucukiwayan."ina :"Migiri tciglwawita uMlnawa, kumagu a p! anitagwicink, pipagi Nanabucu :"Kiwanitcigagima!"Kawm anutabwa tawasl. Ackam ani-25 gu k pipagi, kaga pl, "Manu, icivvltawi k Nanabucu uglcotauna8 ."Kaga t kwlwisansag uticlwinawa. Anlc, wasagu utacapagitawawaajikanonat "Nictcimictca, pacugu plcayu: k,
359Truly, the woman arranged (the kettle) so as to hang.When she had finished, then of a sudden he that wasseated flew up, a-lighting yonder on the lodge-pole, (and)could be heard saying: "Kwu, kwu, kwu, kwu!" such washisItcry. happened to be the Red- Head that he wasvisiting. Now, when (the Red-Head) was come at themeeting of the lodge-poles, he then began pecking. Andafter a while some corn came pouring into the kettle there,whereuponfull of it became their kettle. Down he camehopping ; and when (he was come), then back again (washe in)human (form).Well, and so another time was the woman seated, makingher sack, when she said: "What shall we put (into thecorn) for seasoning, or shall it be just so?"Lo, he now wiped the blade of his knife. Behold, whenhe uncovered his wife, plump on her very back he thenbegan slicing her, rather large pieces he sliced off. Whenhe had done with carving her, he then rubbed his spittleover (the place) where he had carved her. And then intotheir kettle they putthe meat to boil. Then their kettlebegan boiling. Now, after the food was done cooking,then out she dipped it ;and in front of Nanabushu, thathe might eat, she placed (the meat) and the corn.Oh, but Nanabushu truly had a pleasant time eating!After he was quite satisfied with food, he accordingly ceasedeating.And then again he hid his mittens. "Now I shouldstart back home." Nanabushu was told: "Therefore doyou take them home (some food)."Again, after some distance he was come, out calledhave forgotten something!"But in vainNanabushu: "Iwas he not listened to. Louder still he shouted, till finally,"Well,then do you take to Nanabushu his mittens."To be sure, the boys took them to him. Now, fromafar were they throwing them to him, when he said to
udinan3<5"!"Klpa katamawasa klnawa. Wabank kosiwa tablca, nawakwagugapinatin Misakamitciyag." ajiklwat Nanabucuka tagwicink antawat, mlsana minawa wlsiniwat. Mlwlnrr ukrkanonat wlwan : "Nackana! mackimuta kan."Ajikanoni-5 gut Nanabucu wlwan: "Intaska minawa iu awlya kagoklcinawawatan. Atatagwacaku kimanici ickwa kamik kltotan ziwan !"Nanabucu ajiklgitut: "Manu! mackimuta kan.""Wagunacina ka a batci toyan i i* u tcimackimuta kayan?"10 Anic, wlgublc udayan a i^kwa, mlsana i u wanabiginank.Anlc pabi u t Nanabucu. Cigwa nawa kwanig tagwicinonIni /u ininiwan. Pa plndiganit,Wagunacina ka-i cangayang?"Nanabucu piwabi^kuc uglkaciboton. Ka plndiganit, Nanaubucu pasiguntcisa. Kwu, kwu, kwu,kwu!" inwat. Acicisitot15 ublwabi kuni ima 11 ucingwanank, cigwa a kwantawa. Cigwaiwiti kacki o- tisawaganing. Cigwa uba kra/n utaba ll jlwa 8 .A tawa! wantagu kaga t wasa ina kwitcit pangicink, a tcu aninwawacin Nanabucu.A tawa ! unawatinan abiwita. Manu, intawa uwrkubita-20 wan u iplwabi k. PangI win gu kanaga miskwri wan,kaslyabanawat miskwiwinit.Nanabucu cigwa anipagakatisimackimuta kan !" Tni /u wlwan.ajiklgitut:"ManuAnlc, kaga t madci ta a 8 a /u i kwa mackimuta kat. Mri u25 cigwa kl U ta pinank u mo i kuman, cigwa umanibitawan s /u i igu,
"them: "Mylittle brothers, up close do youcome. Youmust be hungry. To-morrow let your father come over,at noon let him come to get some food for you to eat."And so it is said that when Nanabushu was come atwhere they lived, then the poor things ate again. Thereupon he spoke to his :wife, saying Now, come and makea bag!"Then was Nanabushu answered byhis wife saying:"Nodoubt but that you have again seen somebody doingsomething. Oh, how you make me ashamed inyourtrying always to do everything!"Nanabushu then spoke up: "Never you mind! just youmake the bag.""Pray,what shall I use to make the bag?"Now, some bast did the woman have, and so with thatshe began weaving (a bag).In the mean while waited Nanabushu. When it was noon,then came the man. When he entered within, "Pray,what shall we offer (him) to eat?" Nanabushu sharpenedan old piece of metal. After the other had come in,Nanabushu then sprang up. "Kwu, kwu, kwu, kwu !" wasthe sound he uttered. When he placed the metal intohis nose, then up he climbed. Presentlyhe was able to-reach the meeting of the lodge-poles. Then he peckedat their lodge-poles. Alas !right straight in for a long"ten!" was theway it truly entered. When he dropped,sound Nanabushu made.Poor thing! him the visitor grabbed. However, he thenpulled out the metal. And (he saw that Nanabushu) hadnevertheless bled a little, (whereupon) he then washed himwhere he was bloody.Nanabushu was now becoming conscious when he said :"Neveryou mind, but make the sack!" he said to his wife.Now, truly the woman started upon the work of makingthe sack. Then, when he took up the knife, he began
362ubablnsikawaganicini. Acimaticwat pi kwananing, panagunondagusinit a pitci uwlsagicwan."Pisan! ml guca ku i uantotaman wa klga-rwayan."Medac acikanonigut plwitan: "Pa ka! kanabatc klganisa5 kimindimd rmic. Intawa pltoni u mo kuman."Acipa kwacumintIni /u wlvvan, acipota kwa a minit ima n uda ki^kowang.Mlnawa, pasigwa u nit iman tiso a ganing, midac ima n matikwaiganit. Nagatcigu mandamina8 pisigibisowa 8 ,uta kikowangi i ma acislbigisunit. Kamockinanit ini /u uda ki-10 kowan, mlsa i 11 Nanabucu iciwisinit. "Mri^ 11 ninglwa."Mlsa ipinawitcit (agatag). 1SERIES VI. No. 43.43. NANABUSHU HUNTS BUFFALO WITH HIS YOUNGER BROTHER.Anipapimusa kiwan Nanabucu; magwagukiwa papimusatoglwabandan slbawasaya kwanig. Awagwagi, kiwan papakirank, awagwagi kiwa 4 8 /u i a ki kagwanisagiunicicinini.lkitu kiwa n . Ucadinani k!wa n ima15 "Misa o imackuta,"kwaya k ajat. Wadi tank kl n wa n ima ucadinanik nanlbawitima. Mlgu klwa n u iajinagwatinik ucadinanik mini k tayababandank.Amc, mlsa papimusat, anisasagatciwat, anicinabanklwa n kipimusawan ; ayagwa kiba togwanltug agwa-20 skawat. Sagatciwat klvvan ,a pidci klwa n umagwaskawan.1The last word issupplied by the editor. See pp. 340, 341,
emoving her old jacket. When he began carving her atthe back, straightway she began to be heard (crying aloud).Very painfully did he hurt her with the knife. "Hush!for this is what Ialways do whenever I wish to entertain."Then was he addressed by the guest saying: "Stop!perhaps you will kill yourold woman. Therefore fetchhither the knife." When (the visitor) sliced off a piecefrom the wife of (Nanabushu), he putit into their kettleto boil. Next, flying up to the meeting of lodge-poles,(the visitor) then began to peck. After a while somecorn came pouring out, into their kettle itpoured. Aftertheir kettle was full, then did Nanabushu eat. "Now Iam goinghome."Whereupon the buttocks of the ruffed grouse (hang aloft). 1SERIES VI. No. 43.43. NANABUSHU HUNTS BUFFALO WITH HIS YOUNGER BROTHER.On his way, they say, was Nanabushu walking ,anditis said that while walking about he beheld a vista openingout through the trees beyond. Really, so the story goes,when he broke through into the open, why, they say(what he saw) was a country marvellously beautiful."Thisis a plain,"he said, so goes the story. A ridge of highland, they say, lay exactly in the direction he was bound.W^hen he got there,it is said that yonder on the ridgehe stood for a long while. Indeed, according to the story,there could be seen ridge (after ridge) as far as he couldsee. Well, it was while walking along, as he went up thehills and down again, (that he saw) a man, so it is said,walking hitherward ;he then must have run round to headhim off, when he intercepted him. When he came out
" 1A364Anlc weyabamigut nogigabawiwan.Anlc, mrrma krirdisat.Caylgwa ajikanonat:"Paba/aTnatisiyan,niclm."c"A, Nanabucu, crcrma pacu mina kwa aya, mrrmaacayan,ninda-u pijiki ka."5"Ta tiya, niclm, misa kaya nin 7Mro ma ! pacu mina kwaaya, mri ina awudacipiji^akayan. Anlc, niclm, klgataniwltclwin.Panima iwiti nagatc klgapa^kawinin." Ajikano-U, ambasa, Nanabucu, madcata!"nigut:Misa cigwa madcawat. Kagwanisa mi s tcani kiwa n wiskwa 110 cayagwansonit; mlgu kin wa n ima pasanagitiyanitti tibisanik.Sagatciwawat kiwan ima ucadinanik ajijagasklnit."Nanabucu, cayigwa ima nisa ki piji kiwag pimawanitiwag."pijiAjrajakiwawat, "Ningwis, pajiksanalkiwan, kidanawatclmin sana." luda U bimwan Ini/u15 Panimagu, ki n wa n , wantcisagitcikwaskwaninitininiwan imawlskwang, a pana iwiti ani ijipasatinanig ani a-pa tonit.Panimagu, klwan , iwiti acadinanig wantcisagatciwakwaskwaninitpiji kiwan, ucimunit."Ambasa, Nanabucu, madcata!"
"upon the summit, they say right there he met him.Naturally,when (Nanabushu) was observed, then the otherhalted, standing in his place. Well,(Nanabushu) gotit was there thatto where he was. In a while he thenspoke to him: "(So) you are journeying about, my littlebrother."of trees"Yes, Nanabushu, over here, near by,is a clump(on the plains), and it is thither am I bound I am; huntingforbuffalo.""Why, my little brother, so am I! Over here, not faraway, is a clumpof trees, and it is there where I amgoing for buffalo. Well, my little brother, I will go alongwith you. Not till at yonder place after a while will Ipart company from Then he was addressed you." by theother saying: All right, come along, Nanabushu ! let usbegoing!"Thereupon then were they off. Amazingly big, theysay, was the bladder (pouch) which the other had danglingfrom his belt; indeed, they say it tossed, whirling aboutover the top of his crotch at the back (as he walked along).When they came out upon the summit of the ridge, theysay the other suddenly crouched down (to the ground)."Nanabushu, already yonder at the foot of the hill are thebuffaloes trailing along."WThen they turned about on their way back, "My son,now, one of you should shoot a buffalo, for then we canlhave something to eat."Then suddenly, they say, out leaped a man from hisplace in the bladder (pouch), and away he went runningdown the slope into yonder valley.And all at once, theysay, from over the top of yonder ridge came a buffaloalong; it was in flight."Comealong, Nanabushu! let us be going!"1The stranger speaking to his sons in the "bladder."
"AAjikanonigut3 66Sagatciwawat kl n wa n klnlbawiwan Ini /a ininiwan-, klcingicinonkl n wa a !ni /u piji kiwan. Anlc, mlsa krtrdisawat ima.11,ambaningwis, pindigan<y<rma." Mlsa klplndigakwaskunitima wlskwang, "Anlc, Nanabuc, mlsa cigwa5 tciwlninutcigayang." Migu iu ki n wa n wa-rcimadandciganitklgaski."Ta,niclm !kidagabacimanansa!":"Wa-?"gunac, Nanabuc, kayabatci toyang tcigabacimang"Niclm, mnganana a kik." A pana, klwan ,a-irsadciwat10 ima ucadinanik. A kikon uglpita kunan Nanabucu."Anln dac l s /ui iickuta, Nanabuc?""Ninga irji ton, niclm."Kl u-ndcipa kwanani ki n wa n ,i u ickuta ima. Anlc, mlsamlnawa nipinatit Nanabucu, mlsa klpltot nipi.Mlsa pota-15 kwawat piji kiwan; kawln ka kina upota kwaslnawan. Anlc,mlgu kin wa n ani a^koglzisunit ani a gwacimawat, kayaguanipoda kwawat. Mlsa klglziswawatka kina.u lA u , ningwis, amba, saga a m^k tciwisiniyak."Caylgwa kin wa n ininiwan l, sagatcikwaskwaniwan. A20 klwa n wawlnga nlmi tanawawan Nanabucu agimat.pidci"Nanabuc, panima klnawint iskwatc klgawlsinimin.""Kamavvinogo u uda/rskwamasiwawan," inan dam Nanabucu."Kawin, Nanabuc, klgatickwandamagominUdasina kan, kl n wa n ,ackwantamawintwanin.sa win."
"367When they came out upon the summit, they say, therestood the man there; lay, they say, the buffalo. Well,accordingly (he and Nanabushu) came to them over there."Allright, come along, my son! do you enter into this."And so when (his son) leaped into the bladder pouch,"Well, Nanabushu,therefore now will we dress the meat."Accordingly then, they say, did he wish to begin eatingthe meat raw."Why, my little brother! we should cook it by boiling!"Then he was addressed by the other :saying What,Nanabushu, shall we use to boil it in?"little"My brother,I willgo fetch a kettle." Away,they say, then went he over yonder ridge. With a kettlein his hand, back Nanabushu came."Now, where is the fire, Nanabushu?""I will make it,littlemybrother."There was a sudden lift of smoke, they say ;the firewas there.Well, so then next for water Nanabushu went,whereupon he fetched water. And then they cooked thebuffalo in a kettle;not all of it (at one time) they cookedin the kettle. So thereupon, they say, just as fast as itwas done, then forth from the kettle they took it, andthen some more they put in to boil. And so they finishedcooking itall."Now, my sons, hither come you forth, that you may eat."Presently, they say, the men came leaping out. Exactlyforty in all, they say, was what Nanabushu counted them(tobe)."Nanabushu, not till after (they have) finished will youand I then eat.""Perhaps there will not be any left," thought Nanabushu."Nay, Nanabushu, we shall really have some savedfor us."The chest, they say, was saved for them.
" CA3 68"Ambasa, Nanabuc, wlsinita."Anlc misa klkitanawawat kaya wmawa."Ambasano, niclm, awrrcin nindocimagnlctana." l"Anlndac, Nanabuc, kidayanina wlskwa 1 ?"5 "Minanga, niclm, nindaiyan."Migu i u kl n wa n ima iji tat kagwanisa mangimigatinikPwa11wlskwa 1 ta kunaminit. U A U , ningwis! nlctana saga-a/mu k."Misa nlctanakisaga a/minit.U, amba, plndigak, ningwis!"10 Ga kina kigimi tigwabiwan.!"Ambasano, Nanabuc, ayangwamisin Kinitababini tam.Taga, kagu x katciba kwayanin, tagandankan kmi tam.""Taya,niclm! kawm nindaijictcigasl.Panima sagu^kuiskwatc ningawlsin.""15"Anlc, mlsagu kaya km a pana kago kigaki tcipisun.Nanabuc, kita i man ka kina klzi kan."Anlc mlsa ka kina klglsikank Nanabucu uda i-man.atA u , ambasa, Nanabuc! madcata !"Ajimadcawat. Taya! wandagu kiwa anra yabanabandank20 kati tibisanik ima pasanagitiyat. Anlc, ml kl n wa n , anipakawinitiwat.Caylgwa Nanabucu sagatciwat ima kiwan piji klpimawanitiwan,pimitanantciganit. Aji a-caklwat. uA u ,pajiksana,nindojimitug uta/u pimwan piji kiwag ima !pimawa-25 nitiwag."Sagitcikvvaskwaniwan kln wa n pajik udociman ; panaiwitiajipasatinanik ani a-pa tonit. Wibagu kl n wa n sagatciwa-
3^9"Come, Nanabushu,let us eat!"So thereupon they ate up all (their share) too."Ibegof you, my little brother, do you lend me twentyof my nephews."1"Andso, Nanabushu, have you a bladder (pouch)?""Certainly, my little brother,I have one."Accordingly, they say, on his reaching to feel for it,atremendously large rounded bladder, they say, was (Nanabushu) holding in his hand. "All right, my sons! twentyof you come out."Thereupon twenty came out."Now, come, do you go inside,2All"I beseechmy sons!"of them had bows and arrows.you, Nanabushu, do you be careful! Youare not good at giving heed. Now, do not, when youhave finished cooking,taste of the food first.""Why, my little brother! I would not do (such a thing).Not till the very last will I ever eat.""Now, therefore, shall you always have something for agirdle. Nanabushu, all your clothes do you now take off."So accordinglyall of his clothes Nanabushu removed."Now, then, come along, Nanabushu! let us be going!"Then they departed. Ah! it was a sight, they say, ashe went along looking behind at the bladder (pouch) thatrolled about over the upper partof his crotch at the back.So then,it is said, they separated, each going his way.When Nanabushu came out upon yonder summit, (hesaw) the buffaloes go trailing by, feeding as they went.Then he retraced hisway. "Now,O my nephews!letone of you go shoot the buffaloes that are trailing alongoverthere."It is said that out leaped one of his nephews ; away hewent running down the slope into yonder valley. Then,1Indicating thus that they were human beings.2 Into Nanabushu spouch.24 PUBL. AMER. ETHN. SOC. VOL. VII.
" lA"A"A370kwaskwaniwan pijikiwan iwiti ucatinanik. MayatcagwanltugNanabucu; sagatciwat, uglnlbawi tawanini pijikiwan udociman.Misa klwudisat.!11, amba, nindojim plndiganima andayag."5*Anicina, misa cigwa madciwminu tcigat Nanabuc. Kakicikawat ajipotawat; ajinanata kikon. Amc, misa ka tagwicing-,caylgwa ajipota kwat pijikiwan. Misa anra- kokisisunit,ani-a-gwacimat, kaya anipoda kwat. Anlc misa kakinau klkljiswat.!, nindojimitug amba wisini k."10 Pangi Itug pa kwapitogwan ima wininowaninik tcica kamut.Udojiman matandciganit, misa ajra*mabinit caylgwa. Misakaya win caylgwa Nanabucu madantcigat. Anlcna, misaukltabisimt Nanabucu. A u , amba, nindojimitug! plndigakandayag."15 Misa ka pindiganit, ajimadcat Nanabucu. Wandaguklwa n katanwawanik utiyang Nanabuju udojiman mamlgatinigwan.Misa papimusat Nanabucu, ningutingigu pangitowan udojiman. Sagatciwat kl n wa n kiwan piji klpimawanitiwan.Aja tagwanltug.u , nindojimitug! pajiksana20 uda u bimwan pij^kiwan."Awaniban kakanonigut awiya.Ajiyabiskwlt iu ugitcipisun, misa kawln awiya udociman.Madclba togwan Nanabucu, nantuba a tuclmayan. Sagatciwabatot kl n wa n kl pimusawan uclmayan. Anlcna misaima klna kwackawat. "Amn, Nanabuc?" udigdn.
in a little while, it is said that upon the summit of yonderridge came loping a buffalo. Nanabushu must have departedthither; (for)when he came out upon the summit, therewas his nephew standing beside the buffalo. Thereuponhe went up to where he was. "Allright, come, my nephew!enter in where you (and the rest) stay."Well, of course it was then that Nanabushu began dressingthe meat. After finishing his work on (the buffalo), hethen built a fire;then he went to fetch a kettle. Well,and then he came back; presently he had the buffalocooking in the kettle. Accordingly, as fast as it was done,he took itout, and put in some more to boil. So thereupon he finished cooking it all. "Now,O my nephews!come, do youeat."It was perhaps but a small piece that he pulled off toput into his mouth. His nephews then began eating, butthey ceased eating in a little while. Thereupon Nanabushu then began eating too. Well, and then Nanabushuhad all he wanted to eat. "Allright, come along, O my!nephews do you enter in where youlive."Whereupon, when they went in, then departed Nanabushu.There was somewhat of a noise at Nanabushu s buttocks,(made by) his nephews, who evidently were engaged inzealous play. And so, as Nanabushu went along, by andby his nephews ceased their noise. As he came out uponthe summit, it is said the buffaloes went trailing by. Thenhe must have withdrawn. "Now,O my nephews!let oneof you shoot a buffalo." But from none was he givenanswer. When he took off his belt, there was no oneof his nephews (left). Away started Nanabushu, evidentlyon the run, to find his little brother. As he ran out uponthe hill-top, they say hither came walkinghis little brother.And so of course it was there that he met him. "What(isit),Nanabushu?" he was tolcl.
"Ya,"372uNiwanra gsa"Kiglninawatclnanindocimag!"mlnawa ?"""Kawmina tcigltangataman i u kanawatclyag ?5 "Kawln, niclm, nintatangandasin."Kawln, kigitarigandansagu tcibwamitciwat.""Kitagwicinogsawln oma ka kina. Niclm, taga,mlnawa !"awi i dn"Kawin kita a-wi-i sinon mlnawa."10 Nanabucu Itug kwayaskwanutamugwan i wlskvva 1 wlmakamat;a ta !wandagu,ya, ya!"1kawanitclsamigut.kl n wa n amon,Wandagu kiwan kapabacacagawikanapagisut.Udacipaji kukagon 3 nimitana amon, misa klponrrgut.Ki tci-a-mowasiswan ki n wa n ima kl a- tani. Nanabucu, itug,15 ningutci ajimadcagwan. Ajikigitut: "Acimadcl win wawiyacningitotagokamowicag!"Misa 1a kosit.SERIES VII. Nos. 44-56.44. NANABUSHU AND THE WOLVES. SNinguting a intaawag wlgiwaming Nanaboju osani,Kwasind, wlwan gayanl n j uskinawag gaya, Nanaboju mlna-20 wadac Paninl. Mo n jag nandawandcigawag, awaslyan nisawat;mi tigvvabln odabatci a-wan pimwawat awaslan -- pinawan,clciban, nfkan, anotcigago oni tonawa. Kinwan jki ta-1The cry made by Niinabushu.-The father of the other forty bees.
373"Why,"DidyouI have lostmy nephews!"have another bite to eat?""Yes.""Didyou not first taste of what you (and the others)had toeat?""No, my little brother, I would not taste of it (first)."but "Nay, you really did taste it before they ate."have "They really all got here now. My little brother,come, do let me have the use of them again!"would not letyou have them again.""INanabushu doubtless made a grab for the bladder totake it from him;but oh ! at that instant, they say, by the1bees was he stungall over."Ya, ya, Howya!"theysay he did wriggle at the back when down he fell. Hewas harassed by one 2 and forty bees, and then he waslet alone. A large beehive they say was there. AsNanabushu, without doubt, was starting off somewhere else,he then said: "Well, by jingo ! I have been played a trickby the wretched bees."And that is as far as (the story) goes.SERIES VII. Nos. 44-56.44. NANABUSHU AND THE WOLVES. SOnce on a time in a wigwam dwelt Nanabushu s father,Kwasind, with his wife and two youths, Nanabushu andalso Panini. Often they went hunting, (and) game theykilled; bow and arrows they used when they shot at thegame-kind, at ruffed grouse, ducks, geese, and variouskinds of them they killed. A long while they tarried there.3For other versions see Nos. 8 (p. 73), 9 (p. 85), 30 (p. 235).
wag iman .Kaga"Nose,ningamadca."374pi Nanabojo:odinan osan"Andiwa-rjayan?""Niwibabamadis.""Pocga gin madcan."5 Nanaboju ka/rjimadcat miziwe grrca, omi tigwabm;udayawan. Onodcigago wani ton madcit. Ningodingidacwlgiwam owambandan, medac udoda pinan obigwa k umadwaa-n ickwandam.Madwa gigitoi kwa :"Pmdigan!"ikido.10 Ka/rjipindigat Nanabojo, owabaman kwawan m n i j kayiiabinotciya 8 . Pkwa ogioda pinan mi tig;i kwa upaki tawanmamackut.o kading,"Kagu7, kagu x !" i kido Nanaboju. "Ningantawandciga,"i kito Nanaboju. Medac ka ijinisat unltcanisan bajak,15 mri dac ka o i ji ci tod ku ka a wan, kl n go n ku ka a wan,mbiwa gaya wlgup plmana kwan, migiskanan gaya. Midacgru ci tod ubimiwanan. "Ki tcigitcigamlng ningabagitabi.Nisagwa kln go n yag mngabinag, tciwisiniwad abinontci a-g.Nanagonaga k ningatagwicin."20 Medac kimadcad. Nltamidac tapi kadinig kigabaci ;kiniba. Wayabamnigidac kl a nimadca ; kwayak klwadinungija. Kikijab, tclbwanawe kwag, klmadabi saga i gan.Uglwabaman niswi ma Tngana 8 pimi pa tonit oganawabaman.0, plpagi Nanaboju: "A, pa/ka, mtci ! Plciyu k!"25 Ma i nganag kanonitiwag :"A,mlawe Nanaboju!" Pajika kiwa l n zi ma ingan, nljwi ugwisa 8 ma-i-nganag. "Kagi/,kagu rlkanona kagun. Madcag,!"madcag
One"375At last Nanabushu said to his father: O tt father! I amgoingaway.""Where do you expect to go?""I wantto go upon a journey.""If it be your pleasure, then go on."Nanabushu then started away everywhere he went,his bow and arrows he took along. Of the various kinds(of game) he killed he ate. So once on a time a wigwamhe saw, whereupon he took his arrow (and) with it washeard knocking on the door.The voice of a woman called: "Come in!" she said.After Nanabushu went in, he saw a woman and twochildren. The woman picked up a stick; the woman struckthem on the leg, first one, then the other."Don t, don t!" said Nanabushu. "I am going off ona hunt for game,"said Nanabushu. And so after she hadslain one of her children, he then fixed up some bait,some fish-bait, and also a large amount of linden-barktwine, and some hooks. Thereupon he made up his pack."In the sea I am going to lay a line of bone hooks.The fish I kill I will fetch home, that the children may eat.In five daysI will return."Thereupon he started away. The first time that nightcame on, there he stopped to camp; he slept.And thenin the morning he started on ; straight towards the regionof the north wind he went. In the morning, before itwas noon, he came out upon a lake. He saw threeWolves running along he ; gazed at them. Oh, thenout cried Nanabushu :Hey, hold on, my friends Wait!for me!"The Wolves spoke one to another, saying: "Why, thatis Nanabushu !" was an old Wolf, and two (other)Wolves (were)his sons. "Don t,don tyou speak to him!Keep on going, keep on going!"
""A376A, ki tcipimipa to Nanaboju! Mlnawa bibagi:"Pa ka,pa ka, nltci ! Prrclna kawe, klwi kanonin !"Kaga pi krkibitcigapawi.A Nanaboju gltagwicin ima. bo n "A, jo, bo n jo, nltci!"5 Kaya odojima 8 Nanaboju ogagwadciman:"Andiajayag?""O,wasa wabanung.""Anmajini kadag?""Kici kidigwanicing.""Wa!"Nanaboju i keto, "mri wide gaya nm ijayan."kabi-10 :Ma-rngan ogagwadciman Nanabojonmondaman ?""WagonanNlmblndcigosankabimondaman."A, Nanabojui kido :"Klgawldclwininim.Wagunannandawabandamag ? Kaya nln mri widi ajayan."15 "Nibinungkrki o sawag kidocimag ; nlbiwa awaslyanoginisawan ;mldac nlbiwa wiyas pa tag pimita gaya mldacklasandcigowad ; mlwanjiicayang. Mlnawadac, wikiwusawagkidocimag."Mi i a kidot l a s a u a kiwa^simaTngan./>u"Wa," Nanaboju i kido, "Klgawldciwlninim."20 "A,kawin !" i kido a kiw^sima rngan."Kawin kldatibia sigkitocimag."8a, mano n !Ningabimibato gaya nln.""Amc, bocka kin."Ajimadcawad rnaTnganag pimipa towad. Ani ku piwat"Pi kwan-25 ododa pinan obimiwanan ogra- pagiton mi tigong.dagag ta i cini kada tci-a na i kiwang."Mldac glmadcawad.Mo n jag plmipa towag ma rnganag,
377Oh, with what great speed then ran Nanabushu! Oncemore he cried aloud: "Holdon, hold on, my friends!Wait for me awhile,I wish to speak with you!"Finally (the old Wolf) stopped and stood.So Nanabushu arrived over there."Well, halloo, halloomy friends!" And of his nephews Nanabushu inquired:"Where are you going?""Oh,farawaytowards the dawn.""What is the name of the place?""Placeof Cedar-Knots.""Oh!" Nanabushu said,"that is the very place whereI too am going."The Wolf asked Nanabushu: "What are you carryingonyourback?""My bag (with personal belongings)is what I have onmy back."Why, Nanabushu said: "I will go along with you. Whatare you looking for? I too am bound for that place.""Last summer on a hunt were your nephews; muchgame they killed, and a good deal of dry meat and greasewas what they cached;that is what we are going therefor. Furthermore, on another hunt your nephews wish togo."Thus spoke the old Wolf."Oh,"Nanabushu said,"I am going along with you."with"Oh, no!" said the old Wolf. "You cannot keep paceyour nephews.""Ha, ha! never mind! Imyselfwill run too.""Very well, just as you please."Then off started the Wolves running. As they wenttheir way up from the shore, he picked up his pack (and)flung it"Pinus resinosa^] shall it be calledupon a log.till the end of the world."Thereupon they started off. Always running were theWolves, and Nanabushu himself ran with great speed.
"378Nanaboju gaya win gi tcipimipa to. Mlnawa bejik saga r-gan omadablnawa ; kwaya k nawa kwam krijawag.Anlcinabeg Ima tawag, owabamawan maTngana 8 .Hehe,naska maTnganag pamipa towad !Nlwiwag,nlwin !"5 Nanaboju gaya owa dodam oni kan owa bapimipa tot.Mlnawa blpagi anicinaba "Anm :ejinagusicl bajikosowasi !"gan? kawingaguA, pa piwag anicinabeg!ma l n-"Skamldog Nanaboju!"10 Kwaya k klmadcawag. A, aja aya kusi Nanaboju! A pidacw r anagucig kfkabeciwag. A pitci ajikisinag tcigiblgsaga i ganing mri ma kl kabaciwad. Kawmgago skude.Pang! klmuni kawag koni kang, mri ma klkawlcimowad.Gaya win Nanaboju pangl klmoni ka koni kang, mima glka-1 5 wicimud. A pitci aya kusi, a l pitci kaya kiabwasu,klki tcipimipa tot. Kawln okaskitosin tcinipat ; caylgwa klgatci,ki tcigl katci.A kiw^zima rngan oganonan ogwisisan. "T^ga,awipacigki konas."20 Ma inganans Inanowa pagiso Nanabucon nibamt. A !Nanaboju a pitci kicozi. Midac kmibat. Mldac koskusita pitcabwaso. Midac a kidot, ningutci odapagiton ma i n-ganozo: "Tiwa! kaga t ki tcabwaskagunanimwanu." Mi nawaglniba Nanabucu. Mlnawa kuskuzi, apitci mlnawa gfkatci.25lA 8 a u ma rnganans Ima nlba. Midac minawa Nanabujuuwi ktibidon ma inganuzu wra lgwajat, A 8 a u ma inganans
"Good379Out upon another lake they came, straight across the icethey made their way.Some people were abiding at the place:theysaw theWolves. "Halloo, see the Wolves that are running by!They are four, four (is their number)!"And Nanabushu was using his hand as he went running by.Again yelled the "Likepeople: what is the look ofone of the Wolves? He is entirely with a tail!"Oh, how the people laughed!"It must be Nanabushu!"but how tired nowStraight on they kept going. Oh,was Nanabushu becoming! When it was evening, theymade camp. Where it was exceedingly cold by the shoreof a lake was the place where they camped. There wasno fire. A shallow place in the snow they dug, and thatwas where they lay down to sleep. Likewise Nanabushudug a shallow place in the snow, and there he lay downto sleep. Very tired he was, and very much was hesweating, for hard had he been running. He was notable to sleep ;now was he becoming chilled, ever so coldwas he.The old Wolf spoke to his little "Ison, saying: say, lendhim one of your blankets."The little Wolf threw his tail over where Nanabushulay asleep. Ah! but Nanabushu then became exceedinglywarm. Upon that he went to sleep. And when he awoke,he was in a very heavy sweat. Whereupon he said, ashe flung aside the wolf-tail :gracious!certainlyagreat producer of sweat is the dog-tail."Once more tosleep went Nanabushu. Again he awoke, so very coldwas he again.The little Wolf over there was asleep. Thereupon oncemore Nanabushu pulled on the wolf-tail to cover (himself).
3 8oidac ning-utci krrnanowa pagizu. "Nongumku ca animwanukititan."A !midac mlnawa klgl katcit Nanabuju.Pidclnagigu padabung, madwabasigwiwag madwababa-;5 wlwag. Medac glmadwamadcawad, a kiwa n zimaTnganglgito : "Amba, Nanabuju, uniskan! Aja glmadcawagkidocimag."O, mlnawa gimadca Nanabuju mamawi. Mlnawa giketcibimipato Nanabuju kabaglcik. Minawadac wanagucig10 krr kido a kiw^zima i : "Wlnitamklmicoma i wa oga O nabandan anindingan, oganonan ogwisantcigabaciyang."Midac uskinawama rngan:"Unabandan anindi tcigabaciyang."Midac Nanabuju kru nabandang apitci tibinawanig, apitci15 cingobikang."Mlsa oma tcigabaciyang."Mri ma klnibawad. Ayabi tatibiga k kimadwa irnickawaguskinawag ma rnganag, krkatciwag. Klmadwamadcawag.Kigicabidac glgito a kiw^zima :rngan "Amba, Nanabuju!aja klnaganigomin. Aja wasa ayadoganag kitocimag."20 Midac gimadcawad a t kiwa n ziag. Ogimi kawawan tcigibigsaga i ganing ajlkisinag tlnung. Mlidac mlnawa kra-nimadcawadma x mawi. A! gi tcipimipa to Nanabuju. Naningutinungwasa nagana, ubabri gundaci ku witcikiwan yan."Gicfkan, gicfkan Nanabuju!"25 Midac mmawa wanagucigki kabaciwad. Midac a kidotaa/<u:kiwa^zimaTngan. Oganonan Nanabujon Mri wabangtciodi tamang ajayang."
"Now,The little Wolf then drew awayhis tail. "It was but amoment ago that you called it a dog-tail."Ah! then once more Nanabushu became cold.And as soon as the dawn was appearing, then beganthe sound of them getting up ; they could be heard shakingthemselves. And while they could be heard starting away,the old Wolf said: "Come, Nanabushu, get up (from bed)!Already have your nephews startedWell, once more startedaway."Nanabushu, together with them.Again with great speed ran Nanabushu all the day long.And on the next evening said the old Wolf, he spoke tohis sons, saying:"It isyourplace where we shall camp."uncle s turn to look for aThereupon the young Wolf (said): "Go look for a placewhere we are to camp."And so Nanabushu went to find a place where it wasvery calm, where there was a very dense growth of balsamtrees."Therefore here is a place where we will camp."Then there was where they slept. In the middle ofthe night there arose a sound of the young Wolves gettingup, for they were cold. They could be heard startingaway. And in the morning up spoke the old Wolf: "Come,Nanabushu ! we have now been left behind. Now far awaymust be your nephews."Whereupon then off started the elders. They found theothers at the shore of a lake in a cold part of the place.And then once more they started on their way all together.Ah ! with great speed went running Nanabushu. Sometimesafar he was left behind, and so continually was he waitedfor by his companions. "Walk fast, walk fast, Nanabushu!"Thereupon on the next evening they went into camp.And then spoke the old W olf. He addressed Nanabushu,saying:placeto-morrow is when we shall arrive at thewhither we are bound."
382Gigijap kimadcawag mamawi. A ! minawa pimipa toNanabucu. Naya ir kwag, kimadablwag pacig saga-rgan.Owabamawan namadabinit micawa kwam. Klgito a kiwa l n zimaTnganO "Nacka, Nanabuju! kanabatc mlca/a:J tcigawa^ O c>5 kidocimag."Mldac kl a*niodisawad Ima namadabinit.A kiw^zima rngan anidada dagi kwani, ominaman mozon.Gaya win Nanaboju ml andodang.dac wldcikiwayan:"Klminamana mo n z?"Ogandnigonn8"Aye,"ilkido.10 "Anm andaciwad?" i kido a kiw^zima-rngan."Nisiwag"i kido Nanaboju, "pacig nojas nijidac manican sag.""Kawin,"ikido a kiw^zirna rngan, "pacigwaya ta mo n z."Mldac klmadciba towad uskinawiig, kaya winawa a ki-15 wa n zimaTngan Nanabuju gaya, nlgan winawa uskinawag.Mri dac aca klmadcat mo n s, mlidac no % pinanawat mo n zonuskinawapf. Udinan dac Nanabucon ma*rnoran :oo"Aniinabinwawani."Ningutingi gu owabandanawa ma*rngan wlpitpata ka kwisinig mi tigung. Mldac a kidot a 4 kiwa n zimai n-20 gan:"Tagauta pinan kidojimudasawan."Nanabujo:dac i kido"Aningadodaman animwabit?"A kiwa n zima rngan dac uwrkupidon midac kaijipa pawinankasawan, apitcunicicin asawan. Wayabandan idacNanabujo i lkido :"Taga nln, ningadanita kunan mndojim25 odasawan !"A kiwa n zi idac i kido :Animadcani^u !"o"Nongumkuca animwabit kiditan.Mldac animadcawat. Mlnawadac wabandanawa maTn-
"How>said"383In the morning they set out together. Ah! once moreon the run started Nanabushu. When it was noon, theycame out upon a lake. They beheld some one seatedfar out on the ice.Up spoke the old Wolf: "Look, Nanabushu! maybe your nephews have shot and hit something."Thereupon they kept on till they reached the place wherethe being was sitting.The old Wolf had his head up,looking about, for he scented a moose. And Nanabushuhimself did the same. So he was addressed by his companion saying: "Do youhe said."Yes,"many are they?"smell a moose?"the old Wolf.are"They three,"said Nanabushu,two calves.""No,"said the old Wolf,-"onecow and"there is but one moose."likewise theThereupon off running started the youths,old Wolf and Nanabushu too, ahead (went) the youths.In the mean time away had gone the moose, and so afterthe moose ran the youths. To Nanabushu then said theWolf: "Asyou go, keep a careful look." Once as (theywere going along) they saw a wolf-tooth sticking from atree. Whereupon said the old Wolf: "Isay, take up yournephew s pointed arrow !"And Nanabushu said: "What am I to do with a dogtooth ?"The old Wolf then pulledit out. And so, after he hadshaken the pointed arrow, very nice was the arrow. W7henhe saw it, then Nanabushu said: "Isay, let me carry mynephew s arrow as we !"go alongThe old man then said :Only a moment ago youcalled it a do^-tooth. Do O-Q on !"oWhereupon they started on their way. And then onanother occasion they saw where a wolf had eased himselfas he went along. Thereupon said the old Wolf: "Come,
"Nongum?"gan kra nimlzid. Mldac a kidot a kiwa l n :zimaTnganNanabucu ! anita kunan kidojimumatatasan."Midac a kidot Nanabuju: kadodaman animomo "Anln 1"Taga,Mldac a l kiwa n ziugi trda pinan. Mldac kipa pawinang,5 midac madatasan ka/u ndinat. A pldac Nanabucu wayabamatmadatasan,li kido : "Nlntaga, ningadanita^^unannindojim umadatasan !"Mldac a l kidot a l kiwa n zi :kiditan. Animadcanio"u."o10 Ningutingi x gu klgito a kiwa n 4 zi :guca animomo 1"A,mo n zon oglnisawankidocimag."A pitci pa kada Nanaboju, aya kuzi gaya.8Midac wabamad ma rngana cingicininit, a pitcidabisinlnit.Kawln kago owabandazin, kawin gaya mo n zon owabamasin.Mlya ta miskwi koni kang15 wa n zima rngan:"Uji toda kabaciwin !"A, Nanabuju ki timi! Agawadac uwldci a n ma rngananowabandan. Mldac a kidot a ki-kabacinit ka kicidowad dac kabaciwin, mri mU pebasigvviwad/>uuskinawag maTnganag. Mri ajibicigagowawad uskinawag; tibiskogu nongum kipigickijigatag wlyas, ml ajina-20 gwa k mo n zowiyas. Mldac Nanabqjo kistciminwandanktciwlsinit. A! midac tclba kwawad. A! Nanaboju kagattciwlsini.Mldac ima nkatawat, mojagidac ki krcrsawag uskinawag;nlbiwa mo n zon unisawan; kaya wawackaciwa 6 anode, gaya25 awa n slyan onisawan. Kawl ka pa kadasi Nanaboju; mo n jagwanicicininig wlyas umltcim. Niguding idac kru siganauskinawa maTngan, midac pimida nlbiwa ki O*ci 4 tod.pacigMldac kagatNanaboju kiminwandank nlbiwa pimida wa-
Nanabushu! as you go along-, pick up what your nephewhaskilled."And then said Nanabushu: "What have I to do withclog-dung?"Thereupon the old (Wolf) picked it up. And then heshook it, whereupon the flesh of slain game he obtainedfrom it. And when Nanabushu saw the flesh of slaingame, he said: "I say, do let me carry along the gamekilledby my nephew!"Whereupon said the old man: "Onlya moment agoyou called it dog-dung. Keep on going."Now, by and by, (as they went along,) said the old (Wolf):"Ah! a moose have your nephewskilled."Very hungrywas Nanabushu, and he was tired. And when he sawthe Wolves as they were lying down, very full were theyfrom eating. Nothing he saw, and no moose he saw,said theonly the blood on the snow he saw. Thereuponold Wolf: "Let us make a camp!"Oh, but Nanabushu was lazy Much ! against his willhe helped the Wolves make the camp. After they hadfinished the camp, then up rose all the young Wolves.Thereupon then vomited the youths ; exactly like meatthat has newly been cut up, such was the appearance ofthe moose-meat. Whereupon Nanabushu was greatlydelighted with the thought of eating. Ha ! and then theystarted cooking. Ha, but Nanabushu truly ate a great deal!Now, there in that place they made their home, andoften on a hunt went the youths ; many moose they killed ;and deer and various kinds of game they slew. Neverwas Nanabushu hungry often meat that was nice he had;for his food. Now, once a young Wolf was breaking upsome bones (to boil them for the marrow), and so greasein great quantity he made. Thereupon truly Nanabushuwas pleased at seeing so much grease. Now, another time25 PUBL. AMER. ETIIN. SOC. VOL. VII.
""Abandank. Mlnawa dec ninguding pajig uskinawa wi irsigana.Mldac a kidot : "Kawlnawiya ningakanawabamigusi,kawicimuyu k."Panimagu, ka tibi katinik mldac a kidot a kiwa n zimaTn-5 gan:"Kagu, Nanabuju, kanawabama kyan wa u siganat."Medac ki kawicimowad, medac a ta a r we uskinawe ma l n-gan namadabit usiganat. Mlidac Nanabuju klmotc ajikanawabamad,miidac wabamad andodaminit cacagwandan^o * ou kanan, miidac pimida wantcitciwaninig udoning unaganing10 idac udanra- ton. Magwadac kanawabamad Nanabujuandodaminit, mli ajiko tigwandang ubi kwa kukanan medacNanabuju uskpjigung may a glbangsininig. Medac Nanabuju kra/ lpisigagwat iwe u kan. A kiwa n zidac ma rnganuglpapodanan Nanabojon, mldac klbimadisit. Mri daci 5 anat :Magica kigi kanawabama."Medac a kidot : "KawinNanabojo ningi kanawabamasi,undcidagu nimba kinda-u k."Me i dac mlnawa ningudingnl biwa ayawad u kanan,mli a kidot a kiwa^ima :rngan Nana-20 bujo, usiganan."Medac kagatNanabogo a kidot"Tagana,klni tam,7wi x sa ninga O sigana."Nanabuju dac uglmi kwandan ka todakud, kagaklnisigut. Medac a kidot u:Nanabujo Kawicimoyuk. Kaguawiya ningakanawabamigusi. Padagwingwacinuk."25 Medac gagat ka totamowad.Medac Nanabojo mamadowandang u kanan, a kiwanzidacma-rngan udu O ndci kanawabaman Nanabucon andodaminit; miidac Nanaboju aji o da pinang kitci o- kan, medacajipa ki tawad uskinawe maTnganan, mi ajinisat.Medac
"Donone of the youths wanted to break up some bones (toboil for the marrow). And so he said: "Byno one doto bed."I wish to be seen, go youAfter a while, when night came on, then said the oldWolf:t, Nanabushu, (don t)watch him who is tocrack bones (and boil them for the marrow)!"Thereupon they went to bed, except only the youngWolf that was seated breaking the bones (to boil them forthe marrow). Now, when Nanabushu secretly took a lookat him, he then saw that what he did was to gnaw uponthe bones, and that the grease which came from his mouthhe kept putting into a vessel. Now,watching what he was doing, (the Wolf) then let slip fromwhile Nanabushu washis mouth a joint-bone with a knob, itwhereuponfellsquare on Nanabushu s eye. And then Nanabushu wasknocked out of his wits by the falling bone. Now, theold Wolf breathed upon Nanabushu, whereupon he revived.And then he said to him :"Perhaps you were watching him."Thereupon said Nanabushu: "I was not watching him,on purpose he hit me."And now another time, when they had many bones, thensaid the old Wolf: "Come, now, (it is) your turn, Nanabushu, to crack the bones (for the marrow)."Upon which truly Nanabushu said: "Allright, I willcrack the bones (for the marrow)." Now, Nanabushuremembered what had been done to him, that he hadbeen nearly killed. Therefore said Nanabushu: "Goyouto bed. By nobody let me be watched. Cover up yourfaces."And so truly that was what they did.Now, while Nanabushu was making a noise cracking thebones, the old Wolf then slyly took a peep at Nanabushu(to see him) at his work ;and now Nanabushu took upa large bone, and then hit a youngW7olf, whereupon he
388aji crniskawat ka/l kina. A kiwa n zi dac i kido :paki tawat?""Kawln run pa kitawasl," i kido Nanabujo."Kaga t kipagi tawa, kiglganawabamin kuca."5 "Kawin,""Amc wini kido Nanabuju."Kanabatc klmotc 1 ninglkanawabamigoban,meidac ki kutigwandaman i we pigwakugan.""Kaga t kiglpa ki tawa kuca." Miidac a kiwa^zima rngankibabodanat ugwisan, mlidac kfpimadci at, ki pimadi-10 sinit ogwisan.Ninguding idax c a kiwanzi : "Mlsajigwatciguslyang. Pecig kigamlnin kidocim, ml a uoganonan Nanabojonkayagin kawldclwad dcinandawandcigat. Pajig kaya ningawidclwa.Kigamlnin iskuda." Medac ajipogidid a kiwanzi.15 "Mi awa a pis."Mlnawa klpogidi a kiwanzi. "Ml awesaga tagan."Mlnawa glpogidi."Mri we krrman." Mlnawa1"Mlglpogidi. awe wigwas. Panimagu, krkapaciyan kra--toyan misan, ml u ikadicipajidcigwaskuniyan iman misana tag, ml u kadici ipiskanasag ickoda. Kagu win anicagu20 kudcito kyan."45. THE DEATH OF NANABUSHU S NEPHEW. 3Mri dac ajimadcawad ; papa kan ijawad a klng. Nlganiwanidacodojiman, wlnidac Nanabojo udanang pimosa.Tcibwa O di tang idac wrkabaciwad, Nanabuju kri nandam :"Taga ningagudci l ton iskuda," mlidac, ka/i ciujitdd misan25 a ki kang, me rdac ajipacidcikwaskunit, meidac ka ijipiskanagiskuda. A !gaga t kistciminwandam Nanabujo.1Used for starting a rapid blaze.
whereupon,389killed him. At that up they all rose from where they lay.And the old (Wolf) said: "Why did you"I did not hit him,"said Nanabushu.hit him?""Indeed, you did hit him, for I was watching you."said Nanabushu."Nay," "Perhaps secretly was I observed by him, and that was why from my mouth I slippedmyhold on the knobbed ankle-bone.""Truly, indeed, you did hit Now, when the him." oldWolf breathed upon his son, he then revived him alive,became his son.Now, once the old (Wolf) spoke to Nanabushu, saying:"It is now about time that we should be moving. Oneof your nephews will I give to you, and he will be theone for you to accompany when he goes to hunt. One,too, will I accompany.I will give you fire." Thereuponthe old (Wolf) broke wind. "Now, that is a flint."Againthe old (Wolf) broke wind. "Now, that is the punk."Again he broke wind. "That is kindling." Again hebroke wind. "That is birch-bark. 1 After a while, whenyou go into camp (and) have gathered the fire-wood, thenshall you leap over the place where the wood is,whereupon up will start the blaze. Do not try to do it merelyfor the sake of doing it."45. THE DEATH OF NANABUSHU S NEPHEW. 3Thereupon they started awayinto different lands; theywent. Now, ahead went his nephew, and Nanabushu himself travelled behind. And before they arrived where theywere to camp, Nanabushu thought: "Now, I shall try tomake a fire after he had ;" gathered the woodtogether at a place, he then leaped over it, upon whichup blazed the fire. Ah !verily, much pleased was Nanabushu.2 For other versions see Nos. 10 (p. 89) and 31 (p. 251).
390Medac ka/rjimadcad. A prrdac wadi tang ima 11 kra todubimiwanan a we uskinawe, mrrma n kmji tod gabaciwinwlnidac uskinawa bapanandawandciga. A^Didac Nanabujuwa^odawad, ka/u^tod misan, ml i /<uajibagitcigwaskonit.1glbajitcigwaskon nawa-,glpacidcigwaskuni,5 Kaga anawi kipiskanan 1 . Mmawadcidac pangi iskoda ki a yan 1 . Mmawakawm ganaga ickuda oglwabandazln. Pinic kftibi^kadin 1 .A pii dac padagwicing uskinawa, onondan tcitcing wagamingisaning; mmangwana a 11 Nanaboju pacidci kwaskwas-10 konit. Mldac a^kidot uskinawa."Anln, Nanabuju, acitcigayan?M^gica kiglbabotawa."kido i"Kawin," Nanaboju.Mldac win uskinawa ka/rcibacidcigwaskonit, medacskuda klbiskanag.15A pitci gaya krkatclban Nanabuju.Mldac anat : mlnawa wi"Kaguka u itodangan, panimaml kadodaman."ogu kfkabaciyanMedac kagat ka todang Nanaboju. Panima ogu ka*a -todin misan mri u ajibajitcigwaskonit, medac skuda piska-20 nanig. Mo n jagidac klbabamadisiwag, mo n jag kaya awasiyan onisan awa uskinawa ;a pitci mo n jagbuju.A pitci osagra/n udojiman.minowlsini NanaNingudingidac Nanabuju krrnabandam odojiman ki pakobisanidslbing. Mlidac anat odojiman: "Taga, ayam-25 gwamisin klcpin no pinanat a wasi. Klcpin dac si r bi wabandaman,manu mi tig ani-a^pagiton, mldac ima n tc^anita ku klyan ; misav^agu a pitci aga n sing slblns, manu mi tiganra^pagi^ton, medac Iman tci a nita ku klyan, misawagua/nica pasagamiga k. Kagu wanandagan i u aninan."
Thereupon theyset out. And when he arrived at thethen thereplace where the youth had put down his pack,he made the camp for the; youth himself was away on ahunt for game. Now, when Nanabushu desired to makethe fire, he put on the wood and so; again he leapedover it. For all that, it barely caught fire. Once againhe leaped over it,and even less was the fire there. Againhe leaped over, and no fire at all did he see. At lastnight came on. Now, when back came the youth, he heardthe sound of somebody thumping on the itground turned;out to be Nanabushu leaping over and over. Whereuponsaid the youth: "What, Nanabushu, are you doing? Perhaps you have been kindling fires (without any reason).""No,"said Nanabushu.And so, after the youth himself had leaped over, thenthe fire blazed up.And very cold was Nanabushu at the time.And then he said to him: "Don t ever do itagain, notdo it."tillyou go into camp, then may youAnd so truly that was what Nanabushu did. Not tillhe had put on the wood did he then leap over, whereupon the fire blazed up. Now, continually were theytravelling about, and often did the youth slay the ;gameever so frequently Nanabushu had good food to eat.Very fond was he of his nephew.Now, once Nanabushu had a dream that his nephew fellinto a river. Whereupon he then said to his nephew:"Iwish that you would be careful when you are followingafter game. And when you see a river, just fling a stickahead of you, for that is where youshall step ;eventhough it be a very small brook, do throw a stick aheadof you, and there you shall step, even though there beonly the dry bed of a stream. Don t ever forget what Iam telling you."
392Kinwa n jidac babamadisiwad. Ninguding kawin kitagwiciziwanodojiman. Me rdac anandang Nanabuju: "Mlsaganabatcka rnabandamamban."Windac uskinawa no pinanat awasiyan. Kaga a/dimat/>u5 mri wabandang pasa kamiganig. A x nawi uglmi kwandanka i gi^pan omicomayan, mldac iman krpa^kublsadki tcizlbingkra yani ima n .Windac Nanabuju wayabamnig kimadca nandawabamadodojiman. Mldac klmi kang kitcizlbi, meya pana odojiman10 kiwani a t. Medac glki tcimawi, medac ka ijimadcat nisadciwan.Ninguding idac animadablt zlbing, a pitci wlminilkwe;miidac ajicingicing wlmini kwat, mldac wabandangmlnan anamindim, mldac wa/ijro da pinang, kawindacuml kunazinan. Kinwa n j anugidotam wlmamot. Kagabl15 dac oma inabit icpiming, mri u wabandang agodanig mlnan.Minangwana ini /u me n sinatapigisininig. A pldac kawabandang,:kri- kidoambiminan.""Mri we kadicini kadag tcianra pt kl n wang,Medac minawa gimadcad. Ninguding, minawa anima-20 dabld zlbing, owabaman wabimangwan ogiskimanisln gaya;nibrkang inabiwag. Nanabuju dac ogagwadciman:"Wa-?"gunan kanawab^ndamakMedac a kitowad :"Manidogoma n ta x wag. Migiweoda^pinawad Nanaboju odojiman. Mi /( a we malnganiwayan25 kebiskwanda/o niwit, mra we kanawabamangit."Kagatsa onickimigon Nanabuju. Miidac ajigagwadcimad:"Anlndi andawad? Wawani wlndamawiciyuk."
"393So for a long time they went travelling about. Onceupon a time his nephew did not return home. Whereuponthought Nanabushu :dream must havecome true.""ThereforemyperhapsBut in the mean while the youth was in pursuit of somegame. Almost was he about to overtake (the game)when he saw the dry bed of a stream. Although he wasmindful of what he had been told by his uncle, yet therehe fell into a great river;he remained there.Now, Nanabushu himself on the morrow set out to lookfor hisnephew and when he found a; great river, thenat once he lost (track of) hisnephew. Hereupon hegreatly wept, and then he started off down the stream.Once as he went down to the river, very anxious was heto drink;and so, as he lay down to drink, then he beheldsome berries under the water, whereupon he wanted toget them, but he could not get hold of them. For along while he tried in vain to get them. Finally, as upthisway he looked, there he beheld the berries hanging.They were the things that cast the reflection (in the water).And when he saw it,he said: "This is what they shallbe called till the end of the world, high-bushcranberries." ]Thereupon he continued his way. Another time, whenhe came down to the river, he saw a White Loon and aKingfisher ;in the water they were looking. Nanabushuthen asked of them: "What are you watching for?"Thereupon they said : Manitous dwell in this place.It is they who took Nanabushu s nephew. Now, the skinof that Wolf, which they use for a flap over the doorway,is the thing for which we were watching."Truly, indeed, was Nanabushu angered. Thereupon heinquired of them: "Where do they live? Rightly declareit to me."1This episode does not properly belong at this point.
394/uMedac a kidowad : "Ml oma andawad Igimanidogka o da pinawad gidojiman.""Wawani dibadcimoyu k." Medacka/ijra ndomad ogiskimanisln.Mldac Nanabuju ka i*ji*o*jibrad ogiskimanisln5 kaya mangwan.A! gaga/t minwandamog. Mldac a kidowad :kistciglca tag, ka /l kina tamo klwag.lMro maoma nminising.""Klcpinku nibawadPa kic kaya nickadisi Nanabuju. Mldac pagidinad, kaga10 oglnisan ogiskimanisln; mrrdac wlnawadinad oglpicigupinan.Mri dac ka/rcimadcad Nanabuju no piming. Ogi*a wi*o ji a*nmi tigwabm kaya asawanan. Medac a kidot :Nanabuju"Tagatawiki l tcikija l ta wabang."Medac kaga t kistcimijakwadwayabang. Medac Nanabuju ka ijrrjad ima n tibicko15 minising, mldac ima n tcigibig klmbawit. "Mitigong nlngadijinagus,"pitci kasongag klckana kad." Mri dac imaa nkra sad omi tigwabm ima n oni kang. A pldac kizispamokang,a pitci glja l ta.Kagadac nayawa kwag ml cigwamo kiwad manidog.20 Medac a kidowad manidog: "KiwabandanawambanIni -u^k 11 klnawa iwe klckana kad?"i"Kawln," kidowaganint.Anintidac i kidowag n : "Aye 8 nlwabandanaban nlni k 11 .",Anint i kidowag : "Nasana ku Nanabujuta ijinaguz 1 !"25 Anode manidog mo klwag. Mrrdac anawad Wabimalkwan :"Taga, awigagwadclwadan Twe kiskana kad."Medac kagatka-rjrijad wabima kwa,medac kigagwadcibidot,kawin kanaga oglkawibidosin. Medac a/kidotWabima kwa : n "A, kawin Nanabuju awisi ;mi tigi i we!"
"395Whereupon they said: "This is the placewhere dwellthe manitous who seized your nephew.""Be sure to relate ittruthfully."And then he askedthe Kingfisher to come. Thereupon Nanabushu paintedthe Kingfisher and the Loon.Ah! truly were they pleased. Thereupon they said:"If it becomes very hot, then will all come forth. It isupon this island that they usually sleep."And all the while was Nanabushu angry. And whenhe let them go, he nearly killed the Kingfisher ;for as hewas going to seize him, he missed catching him. Thereupon off started Nanabushu into the forest ;he went tomake a bow and some arrows. And then said Nanabushu :"I will that it be very warm to-morrow." And so trulythere was a very clear sky on the morrow. ThereuponNanabushu went over to a place opposite the island, andthere on the bank of the river he stood. "Like a treewill Ilook, a (like) stump that is exceedingly strong."And so there upon his arm he put his bow. And whenthe sun was rising, itgrew very warm. And when it wasnearly noon, then out began coming the manitous.And then said the manitous: "Didyou yourselves eversee that stump before?""No,"said some of them.But some of them said: "Yes,we ourselves are accustomed to seeingit."Some of them said :Woe to us should Nanabushu takeon such a form!"All sorts of manitous came forth. And now they saidto the White Bear.: "I wishthatstump."you would gowrestle withThereupon truly thither went the White Bear and he tried;shaking it,but not a whit did he move it.Thereupon saidthe W7hite Bear: "Why,it is not Nanabushu; it is wood!"
.""396A! kayabi anint uoa^tanawan. Kaya win Nigik kimo-J O J Ockamu. Medac a kidot: "Ha, ha, ha, ha!" a pa pid, "kawPkanm ningiwabandazln."Midac minawa a kidowad :"Skoma", km, Miciginabik,5 awigutci ton !"Medac kaga t krijat. Medac ka ijitatibakuwad u l kwaganang.Me i dac ka/rjibapasi tad kinabi k.A n ,nlbiwa kra nimadca kizis.mri />uKagagu tciwa kwanamut Nanabujuka/i cipagidci-10 tanit miciginabigon.uMedac a kidot ginabik:A, kawin a 11 Nanabuju awisi ;mi tigi i we!"Mri dac ka i jipomawad. Ickwadac kimo klwagni n ma-jnidog, ml igiwe ogimag. Mi i dac ka ijinibawad klja tanig.15 Medac Nanabuju ka ijinasikawad omi tigwabm, wl a wibimwad.Nl n jiwanidac miskwadasiwan, ml i dac wa/rjidibatcimowad.Midac anad Nanabucu :tabatcimu kao un !o Mackut"Ic,tci tci tci!Kaguklo-awawaciininim." Me iodacNanabuju ka i ji O da pinad, mri dac ojibiwad.20 A n !kitciminwandamog.Midac anad: "Miskwadasi klo-adio^om tcra ni a t klwanor."D O OMidac agud miskwadasiwan :agawatacinuwad ijipimw1Kagu kwaya k pimwa kan ;Midac Nanabuju ka ijinasi kawad mi /u cmanidon. A pldac"25 ka U disad, mri ajipimwad, kwaya kigu wiyawing, kawindacuglmijwasin. Minawadac pajig odasawan uglnabisidon,mlidec ka ijipimwad agawatacininit, mri dac klmljwad.Minawadac wawlp pajig oglpimwan,Ini /u ugiman.
"Do""Ah !but397yet some of them feared it. And the Ottertoo came forth. Wh ereupon he said: "Ha, ha, ha,ha!" ashe "neverbegan laughing, before have I seen it."And then again they said: "Let us see you, Big Serpent,go tryit!"Whereupon truly thither he went. Whereupon he twinedround (Nanabushu s)neck. And then tight coiled theSerpent.WTell, far on itsway had gone the sun.When almost out of breath was Nanabushu, then washe letgo by the Big Serpent.Thereupon said the Serpent: "Why,that is not Nanabushu;it is wood !"Whereupon theyfelt at ease. And then at the lastout came two manitous; they were the chiefs. Thereuponwhere it was warm.they went to sleepAccordingly Nanabushu went after his bow and arrows,that he might go shoot them. Now, there were two redburned(Turtles),and now they were going to tell. Whereupon to them said Nanabushu :Hush, hush ! Don tyoutell! In return I will adorn you in gay color." AccordinglyNanabushu took them up, and then painted them.Ah !they were greatly pleased.Thereupon he said to them : Red-burned creatures youwill be called till the end of the world."WThereupon he was told by the red-burned (Turtles):not shoot straight at them ;where they cast a shadowis the place to shoot at them."And so Nanabushu went to where the manitous were.And when he got to where they were, then he shot atthem, right at their bodies, but he did not hit them.Now, another arrow he fixed upon his bow, whereupon heshot at the shadows they cast, and then he hit them.And so quickly at another he shot, at the chief.
Mri dac cigwa ki kanimind "AaNanabuju. a , Nanabujuunisan!"ugimanMedac Nanabuju ka ijimadciba rwad. A ! medac nibino pinanigut. Ninguding idac cigwa kaga udadimigunz\j nibi, medac wabamad a ka^widclciwan o namadabinid. Medac*anad :"A,niclma 11 ,manido nimamldawiik !""Wa /c e, amndi andanadcimat awe manido? Taga, oma nplndiganmwajing!"46. NANABUSIIU SLAYS TOAD- WOMAN, THE HEALEROF THE MANITOUS. 1Mri dac Nanabuju ka/rjipindigad aka kwidclciwajino-.10 A pldac ka plndigad Nanabuju kaya win, aka kwidclci krplndiga,mlidac ka ijikiba a ng uwac. Panima dec ka i pimidciwaninignipi, mlnawa glsaga*a*m Nanabuju. Ningudingidacajipimosad, onondawan awiy a :nagamonit"A ki ya kwagwagiyenimbicina U cin."15 Midac ka ijinasi tawad, mldac klwabamad mindimoyayan,omaka kln; wlgubln obimondanan, kayadac jiclgwanan ojagwansonana 8 a u mindimoya n .Nanaboju-o dec ogagwadciman!ni /u mindimoya a n :"Anln,no kimis, wa todamanIni /uwlgubln?"20 Midac a kidot mindimoya n kuca :"Nanabuju ogl pimwamanido 8 nmidac nlnanandawi a , g Igi /u manidog. Nanabujuu dac winandawapini kana onowa wlgubln ;miziwaa klng wri nablginigadawan. Klcpin dec toto kablgiskang,mri*we tcigi kanimint anlndi ayad Nanabuju. Kawinagin25 Nanabuju kidawisi?"1For other versions see Nos. 18 (p. 145) and 32 (p. 261).
399Now, then was the time they knew it was Nanabushu.the chief!"Nanabushu"Oh, is killingAccordingly Nanabushu started to flee. Ah ! andthenby the Water was he pursued. Now once, when nearlyovertaken by the Water, he then saw a Woodchuck sittingup. Whereupon he said to him: "Alas! my little brother,by a manitou am I pursued.""Well,where is the manitou about whom you are talking?Pray, come into this little hole of mine !".46. NANABUSHU SLAYS TOAD-WOMAN, THE HEALEROF THE MANITOUS. 1So Nanabushu came into the Woodchuck s hole. 2 Soafter Nanabushu had gone inside, then the Woodchuckwent in too, whereupon he closed (the entrance of) hishole. And not till the water had flowed past, then againout went Nanabushu. Now once, as he went walkingalong, he heard somebody singing :"From the ends of the world do I come with the sound of my rattles."After that he sought, listening for (the singer), whereupon he saw an old woman, a toad some linden-bark;she carried upon her back, and rattles too were hangingfrom the old woman sgirdle. Thereupon Nanabushuinquired of the old woman: "What, my grandmother, doyou intend doing with that linden-bark?"Whereupon said the old woman: Nanabushu"Why,indeed has shot the manitous, and I am going to heal themanitous. And for Nanabushu will be set a snare (made)from this linden-bark;all over the earth will twine be laid.And if it pulls when he steps into it,then will it be knownwhere Nanabushu is. Are you not yourself Nanabushu?"* Translated by the editor.
"""4-OO""Kawln,i kido Nanabuju. "Kldabimadcrrkina Nanabujtiwabamad?" Mldac anad: "Anindi ayayan?"a Mrrman pacu ugimag ayawad. Nongum unangucikmri -we kaga t wlkitcinanandawiiwayan, mri -we Nanabuju5 odojiman usagm kadacimigoyan nongurn unagucik."Mldac anad Nanabuju."Anmi ku ana a-man nagamoyan?"Midec mindimoya kidibadcimut : "Mlsa ku u i ana a-mannagamoyan:A ki ya kwagiyenimbicina U cin.10 A pri dac ka /l kina kawindamagut mri -* ka ijinisat.Mri dac ka ijipa kunat me i dec ka i ijipizi kawad, me-i dackro da pinang wlgobm klpimondang ;kaya dac jlcigwananugljagwasonan. Me i dac klmadcad ajani pan mindimoyayan.Kayawlndac kl a ninagamo:15ki "Ayagwagiye nimbicina O cin."A pri dac tagwacing andanint ugima 8 ,mri wabamadudojiman owayanini kibiskwanda Iganiwinint. Nanabujuowabaman tcitcipiskanit. Medac a kidot :!Niya nojis,ijiwijiyu k andanapiyan?"20 Kaga t idac ogri jiwinigon iman andanabipan mindomoyai-ban. Miidac wabamad a ki kon tclba kwan mriSve;Nanabuju udojiman uzagln ka kijidanig. A kawa ku wisimbanawe mindimoyaban. Mldac Nanabujui kido : "Kawlnningawlsinisl, panima n kri ckwa tayan, ningawlsin."Me-i dac25 a kidot Nanabuju:"Ka kina saga a mu k 11 ,nlna ta uma n
"From""401said Nanabushu."No," ("Do you suppose that) you wouldbe permitted to live ifyou should see Nanabushu?" Andthen he said to her: "Where do youabide?"is"Yonder, near by where the chiefs are. On this eveningtruly when I will do some wonderful healing, whereupon the upper arm of Nanabushu s nephewshall I begiven to eat this evening."So then to her said Nanabushu: "What is the natureof your song when you sing?"WThereupon the old woman revealed (it), saying: "Thisis the way I usually sing when I sing:the ends of the world do I come with the sound of my rattles.Now, after he had been told everything,then he slewher. And after he had flayed her and put on (her skin),he then took up the linden-bark and put it upon hisback;and the rattles too were hanging at his belt. Andthen he went in the same direction whither the old womanintended going. He too went singing along the way:"From the ends of the world do I come with the sound of my rattles."And when he arrived at the home of the chiefs, thenhe beheld his nephew s skin used as a flap over the entryway.Nanabushu beheld it move with a quiver. Whereupon he said: "Ah,me! my grandson, will youto the place where I am to sit?"lead meNow, truly was he led to the place where the old womanwould have sat. And then he saw a kettle with foodcooking in it it was the,upper arm of Nanabushu snephew that was cooking.It was usual for the old womanfirst to eat (before she began with the work of healing).And so Nanabushu said: "I am not going to eat, nottill after I have finished, then will I eat." And this saidNanabushu :26 PUBL. AMER. ETHN. SOC. VOL. VII.All of you go out of doors, I only here
Me402ningataya."A plidac ka kina kazaga a/mowad, mlima 11jingicinowad Igi /u ugimag,owabandanan udasawanan sasagakwisininig ima 11 ugima n wa 8 wlyawining. Mri dac kljacijigwawad,mri dac tkagakinisad. Mri dac klnibowad.5Me-rdac a kidot : "Mlsa klnibowad manido."Me i dac ajibibagiwad: mlsa klnibowad !"A, manidogA a 711 ,madcidoyu k wlgobm mi ziwa a king ta i-nabigamanon;mri dac tcigikanimint anindi ayagwan Nanabuju,kicpin toto kablgiskang."Midac ka /; kina ka ijimadcawad,10 kl pimabiginamowad wlgobm.A pri dac ka /l kina kamadcawad, Nanabuju ogipigiskijwanklstcitciba kwa manidowiyas. A pri dac ka klziza kwad,15:ugra nduman abinodclyan, meidac gra/camad. Paji^idacabinodciyan ogiki kanimigon Nanabuju ayawit ta l pabiwan.Midac anad "Pa ka, niclma, kagu dibadcimo kan !" i -dac Nanabuju ka-i-jipa kwa^ ang manidopimida, medacka ijimlnad kwlwizansan. Medac anad: "Ka ka kijoblzikadicinikasyantci a-ni a- klwang."Medac Nanabuju ka ijioda pinad manidowayanan kayadac20 odojiman wayanan, me i dac ka ijimadclba tod, mini kidackawabandang wlgubln bimabigamunig, ka x kina ogl a*nitotokibitonan.Medac a/kidowad ka /l kina :gabimadisiwa pan"A2^!ca ylgwaNanabuju to to kabigiskiga."kl ki tciki-25 Mri dac ci x gwa nlbi klmo kitciwang, kayadacmiwan; kayadac Igi /u asinlg icpimlng gro ndagoMcinog,Nanabuju kl a ndoskonind. Nibiwa oglnisigowan asinlnnlbi gaya. Nanabujudec wadciwing anagra^pa i we. A pri -
"403will remain." And after all of them had gone out, thenyonder, where lay the chiefs,he beheld his arrows that weresticking out from the bodies of the chiefs. Thereupon heshoved them in(farther), working them back and forth,whereupon he truly killed them. So now they were dead.Accordingly he said: "Therefore now dead are the manitous."And then they cried aloud: "Alas! now dead are themanitous. Now, then, take you the linden-bark (twine)everywhere over the earth, and stringit around;for thenit will be known where Nanabushu is, should he happento step into it (and be caught)." Thereupon they allstarted away, laying the linden-bark twine.And when all had started away, Nanabushu cut (themanitous) into pieces, and made a great cooking of themanitou-flesh. And when he had finished cooking, heinvited the children, and then fed them. Now, byone ofthe children that was peepingin was Nanabushu recoghe said to it: "Holdnized to be who he was. Thereuponon, my little brother, don t tell!"you And when Nanabushu sliced off some manitou-grease, he then itgave tothe small boy. Whereupon he said to him : Fond-of-Raw-Fat l shall you be called till the end of the world."Then, after Nanabushu had taken up the manitou-skinsand the skin of his nephew, he then started off running ;and, as much of the linden-bark he saw stringing about,all of it he touched as he went along.Thereupon said all who were then living:"Halloo!Nanabushu is now touching against the snare."Thereupon the water now began to come forth, and amighty rain began to pour; and also the rocks from abovebegan to fall, to the end that Nanabushu be crushed.Many were killed by the rocks and the water. Now,Nanabushu tried in vain to flee to a mountain. But when1A small frog.
404dec wayabandang mockaninig a r ki, mii /u klmawandocimadmi tigon kruji tod pmdazagan. Npjwaswi a t a kl posiwagima n pindazaganing a pi kani kiplg a ki. Mldac Ima 11kra-yawad pmdisaganing anindidac ; gaya awaslyan oglpo-5 zi a n, pinaji n ya 8 anode ,gaya awiya pabamisatcig. A pri dackinwa n j ayawad iman pindazaganing, ogikanonan na tago-: "Gitakaskigmit tonawana pangi a ki? Klcpin pldoyag,ninda uji ton a ki."Ni tarnidac a u a n wa n yan odanagra nonan tclgogmit, ka-10 wlndac ogrta U di^tazin a ki; kinondakisabawe. Usagabinilkarian Ini /u wi x gup, mri gu ka /l kina ka totawad, clcri bangaya mangwan gaya ami kwan. Medac kimojskinisat,mlnawa beijik ciclban, mangwan, mlgu gaya win ka i ji-tosmawa a ki. Mlnawadacwabisinit. Kawin ogikaski15 ami kwan ogi a nonan tcigoginit, migogayawin ka/ijiwabisit;kmondanlsabawe. Ana\vi l k u kamo n skitcisanitin, oglwawabamana k 1 tcita kunaminit, kawlndac kagon ogimi kan zi a ki.Mlnawadac wajaskwan ogra*nonan tcigoginit. Mlnawaoglsaga pinanwlgup.20 Midac kigogit wajask. Awacima n nibiwa ugiwi kupidonwlgup. Ningudingigu udodo kibidon i u sa x bab a s a u wajask,mf-i we msabawad. Medac Nanabuju ajiwl kubinad;medacwawabamacl wajaskwan, oglmi kan pangi a ki ta kunaminitidawini k, pang! gaya uda kwandan, a ki, onlngwiganang25 gaya papangi a tani. Medac Nanabuju ka ijioda pinang,ugipodanan wajaskwan, meidec ki pimadci-a d. Mlgu ka r -kina i u ka todawad. Mri dac ka ijiba a sang unindcing
"Can45he saw that the earth was overflowing- with water, thenhe gathered together some logs (and) made a raft.Sevenonly embarked upon that raft when the earth was floodedover with water. And so they remained there on theraft;some game-folk, too, he put aboard, birds, and allthe various creatures that flyabout in the air. And afterthey had been a long while on the raft, he spoke to themthat were good at :diving you procure a little earth ?If you fetch it to me I would create an earth."Now, he firstemployed the (?) (kind of duck), but (thebird) was not able to come within reach of the earth it;was drowned before itgot there. He had it tied withlinden-bark twine, for that was what he did to them all,-the Ducks and the Loon and the Beaver. And whenit came floating up to the surface, then another Duck,and also the Loon, had the same thing happen to them.They were not able to fetch any earth. And next hehad the Beaver dive but it also met the same; fate, itdrowned before it reached the bottom. Everytime thatone came up, he looked to see if it had hold of anyearth, but nothing of earth he found. So next he hadthe Muskrat dive;also he had it tied with linden-barktwine.So then into the water dived the Muskrat. Much fartherdown he pulled on the linden-bark cord. At last he feltthe Muskrat pulling at the cord, and that was when itwas drowning. Thereupon Nanabushu pulleditup ;and when he examined the Muskrat, he found that itwas holding a little earth in both its paws,and a littleearth it also had in the mouth, and there was a little ineach armpit too. Thereupon, after Nanabushu took theMuskrat upin his hands, he breathed upon it, whereupon he revived it. Now, that was what he had done tothem all. Now, when Nanabushu had dried the earth in
406iwa c ki a u Nanabuju, me i dac ka ijimamigunang iu a ki.Meidec mmawa ka/ijra-ndnad kagagiwan ningudc1a kitcisagibri nig,kawmdac kltagwicin zi kagagi. Mlnawadacwabimimm ugrarnonan;miidac krpldot wadi kwanans a c a uumlmi. Medac Nanabuju ka ijipada kidot iman i u a l kita kunang, miidac ka-rjra- pagidod nibl kang.Pakic kri- kidot:minis oma n "Taga, tayamagat."Pa kickaya ugipodadan.47. THE SCATTERING OF THE ANIMALS AND THEREGULATION OF NATURE.Mri dac ima n kra-yawad minising, Nanabujudec kl po-10 dadciga kiwi^aya I* minising; mlidec askam krarnimistcaga l ki.Mlgu u ka i todang kinwa n j. Kaningudwasugunaga kidacugi-a nonan adi kwan, "Skoma n kiwitaskan o c o /u a ki."Klmadcadac adi k. A pitci ki^a^kiwa^Iyu 1 a pl dagucing.Mlnawadac maTnganan ugl-a-nonan, kayawindac ma-rn-15 gan a pitci kra- kiwa^iyu 1 a pl tagucing. Ini widac awa n -slyan ka^posi^a^pan a pitci klpa ta rnowan, kaya winawaguanicinabag aja kianipa ta nowag i ; papamisatcig kaya pinacPyag.Nanabujudac ogiwawman kadijini kasowad awaslyag; kayagu pabamisawad pinacPyag uglwawlnan kadijini-20 kasowad l ; klgo n yan gaya. Kayadac klgidowag kadaciwadklzisog ningobibon, kayadac ka-u ndanirnak klwi tagljik
407his hands, he then rolled it into a ball. So then nexthe had the Raven (go find) if the earth could be seenanywhere out of the water, but the Raven did not return.Then next the White Pigeon he employed, whereupon atiny twig did the Pigeon fetch. And after Nanabushu hadstuck it into the earth which he had there in his hand,he then tossed it into the water. At the same time hesaid:UI will that an island come into existence here."And at the same time he breathed upon it.47. THE SCATTERING OF THE ANIMALS AND THEREGULATION OF NATURE.And so they remained there on the island, and Nanabushu breathed all over the island;and all the whilelarger grew the earth. Now, that was what he was doingfor a long while. And when the sixth day was up, hethen employed wouldthisearth."a caribou. "Ihave you go roundSo away started the caribou. It was very old when itreturned.Then next he employed a wolf, and the wolf was alsovery old when it came back. And then the game-folkthat he had had on board were becoming very numerous,and the people too were themselves now increasing innumber and; (the same was likewise true) of the birds.So Nanabushu called the game-folk by the names by whichthey were to be known and also the birds that; flyin theair, he named them by what they were to be called;and(it was) also the same with the fishes. And they alsodecreed how many moons there should be in one year,and also the number of directions from which the windswould blow, that from the vault of the sky in eightdirections would the winds blow. So this was what he
Mldac408cwa tcing tcru-ndanimak. Mri dac ka i- kot: "Anlc, mlsaka kina krirji toyan kanondcipimadisiwad anicinabeg."Medac iwa pi kisiswa/rdiwad miziwe a king. Ka/ijimadcawad,kaya wlndac Nanabuju klmadca.5Mlsa a kosid.48. NANABUSHU BREAKS THE NECKS OF THE DANCING GEESE. lNingudingisa / Nanabuju anipapimusat no pimmg. Ningudingumadabln saga-i gan, mldac iman wabamat nibawani ka c . A pidci omisawanima 8 wra mwat. Mldac anad :alctax, niclma-rdug, ondas, oma n ,pijayu k !" Anawidec10 krpljawag ni kag, kawin a pidci pacu plcaslwag. Minawaguoganona 8 "Nicima :i-dug oma n plcayu k, ka o-dclmininim!"!Ogusigo pacu x tciblcanit.Kaga pl no pimlng krija Nanabuju; mi tigonsan ugmasi kanan. Mi i dac ka iji u-jitodwigiwamans, mlnawa oganonanni kan : "Amba oma n ,15 udaminoda, kanlmimin!" Kagapl ogl way ajiman ni kansa^Medac ka ijipindigawad wigiwamansing, mri dac ajikanonatNanabuju: kina "Kapasangwabicimuyu:ajinagamutk." Mldac2Onimbidomm."PiisangwabicimowinanPasnngvvabicimowinan nimbldonan.Pasangwabicimowinan nimbldonan.Pasangwabicimowinan nirabidonan."Mlclac ka c ga t ajipasangwabiwad nlmiwad. A pri dacka kina pasangwabiwad, ogitabibinan ni kan l : mldac klpo-25 kugwabinad. Nijidac nasad, ugiki kanimigon mrrdac; ajipibagiwadA 8 e Xi !"a:, Nanabuju kinisigunan ka-ijisagidcisawadwigiwamansing. Nlja ta kanisat.1For other versions see Nos. II (p. 101) and 20 (p. 169).
And409said:"So, therefore, have I now finished the creation ofeverything from which the peoplewill derive life."And that was the time they scattered to all parts ofthe earth. After they were gone, then Nanabushu himselfwent away.And this is the end (of the story).48. NANABUSHU BREAKS THE NECKS OF THE DANCING GEESE. lOnce on a time Nanabushu was travelling about inland.By and by he came out upon a lake, and so there he sawnumerous Geese. Very keen was his desire to eat them.Thereupon he said to them: "Look, littlemy brothers!Hither, come here!" And although hitherward came theGeese, yet not so very close did they come. And againhe addressed them, saying: my "O little brothers! comehither, I want to kiss you." They were afraid to comeclose. At lastup inland went Nanabushu some osiers;he went to get. And when he had put up a small wigwam,again he spoke to the Geese, saying: "Come hither,let usplay, we will dance!" At last he persuaded the goslings.And so when they had goneinside of the littlewigwam,thereupon to them spoke Nanabushu, saying:your eyes when you dance." And then he sang:"A dance with eyes closed do I bring (to you).A dance with eyes closed do I bring (to you).A dance with eyes closed do I bring (to you).A dance with eyes closed do I bring (to you).""All shutThereupon they really closed their eyes when they danced.And when all had closed their eyes, he seized a Goose;whereuponhe broke her neck. And when he had slaintwo, he was found out; upon which they cried aloud, "Hey,then they flewby Nanabushu are we being slain !"out of the littlewigwam. Only two he had killed.
Mldac kra-nimadclnat Ini u ni kansan. Kf podawa tclgiblg,mldac ima n wiklciswat ni kansa 8 .Klnlngwa a-bwa, uzidansanogisagisidonan. Mri dac ka/ijikawicimut wlnibat, kimitcidiyacin.Mldac anat udiyan:"Kicpin anicinabag sagawa O -5 wat, wmdamawicin." Kaga clgwa nabat oganonigon:anicinabagsagawa-a mog.""Icta,Nanabuju onickaba to inabit, kawm awiya owabamasln.Minawa ki kawicimo. Pmic nl n jing ogltclcimigon. Kaga plklnibaNanabuju.Nanabuju."Kfkaba10 Anicinabag klsagawa O wat owabamawan awiya mitcidi-mlmawlnyacininit. "Nacka! ku x ca awa x ,pa e jik a 8 a /u anicinaba;owabandanan ni kfwizidan sagadanwangizinunig.IMedac aji a*ndawawanga i gat, mldacka O da i ji pinad Ini /u ni l kansan. Ogiklckijanan uzidansan ;15 ajisininigiban, ogl ijisiton 4 8 i /u mi tawang. Mldac kra*nimadcawadanicinabag.A pi i-dac kwaskuzit Nanabuju, owabandanan keyabia tanig uzidansan.7"Mlsaclgwa tciwisiniyan," i kido. Mri /<uaji O da pinang ni l kiwizit, mi a l ta uzidans ma kang minawa;20 ba e jik ododa pinan, minawa "Tiwaogimanibidon. e ! mawlja*rdugkaminuzuwat nini kansumag," i kido. Mldac ajiandwaa*nga i*gat, kawln awiya ayaslwan nikansima 8 . Mri adcanad udiyan: "Magica anicinabeg krkimodiwagnini kansima8 ."25 "Kawm," udigon."K^ga t, awiya kl kimoti. Nongum klgatanimis."Medac
4 uThereupon he carried the goslings away. He made afireby the edge of the water, and it was there he intendedto cook the goslings. He baked them in the embers, theirlittle feet he left sticking out. And when he lay downto go to sleep, he lay with his bottom exposed. Thereuponhe said to his bottom : "Ifany people come in view roundthe point, then you notifyme." When he was nearlyasleep, he was addressed: "Ah! some people are cominginto view round the point."Nanabushu leaped up from where he lay to look, buthe saw no one. Again he lay down to sleep.Even asecond time he was deceived. Finally to sleep wentNanabushu.Some people paddling into view round the point sawsome one lying with his bottom exposed. "Why,look!yonder is some one, it must be Nanabushu." Ashore wentone of the men he saw; gosling-legs sticking out of theashes. And so, when scratching among the ashes, hethereupon picked up the goslings. He cut off their littlelegs with a knife ;as (the feet) were before, so back inthe ashes he placed them. Thereupon the people continued on their way.And when from slumber awoke Nanabushu, he saw (that)the little legs were still there. "Therefore now shall I eat,"he said. So when he took hold of a gosling-leg,it wasa littleleg only that he found; another he took up, another he pulled out. "I declare! it must have been longsince my goslings were thoroughly cooked," he said. Thereupon he searched about in the ashes, but there was nothingof his goslings. And so he said to his bottom: "Perhapssome people have stolen my goslings.""No,"he was told."To be sure, somebody has stolen (them). This momentshall you be punished." Thereupon, when he had built up
ka/i jikistcipodawad, mldac iman ajidiyanit.A prrdac tcayagisut,"TcF, tcF, tcP !"j,"Ea>ce,lTci, tci, tcl, ka/rnwayan ka/kimotimigowiyanninikansimag."5 Wfkadac ki-a-nipasigvvl,ki a-nimadca no pimlng ;a pidciwlsagandam udiyan.49. NANABUSHU AND THE LITTLE FISHERS.Ningudingidac anipabimosad, ogimi kawa 8udclgansa^ ayanit.Mldac anad :"Anlndiglgiwa?""Pabanandawandciga."10 Mri dac ka ijipopo kutclbinat, ugimidcina 8 . Mldackl a--nimadcad. A pri dac tagucing udclg ugimi kawa* unldcanesas nibunit. Mldac ajino pinariad Nanabujun. A pli dacadimint Nanabuju, aninagamo Nanabuju:I 5"Udcigansugma kabopo kudcipinagwa.Udcigansag ma kabopo kudclpinagwa.Udcigansag ma kabopo kudclpinagwa.Udcigansag ma kabopo kudclpinagwa."Udclganidac oganonigon:"Klnmawm, kigmisag ninldcanisag!"20 "Kawln!" i kido Nanabuju. A pri dac adimint, mi tigunkkra^pagizo. 1 Udclgidac ugimlgadan 4 8 /u i mi c tik, a pidciuglplgwandan 8 l /ui i mi tig.Medac ka e ga t Nanabuju wlsagandankudiyank.,1Mi tigunk kra- pagizo,"he turned instantly into a log;" literally,"into or on toa"loghe threw himself,"but the sense is as given in the translation.
:"a great fire, he accordingly turned his bottom towards it.Ard when he was burning, "Ouch, ouch, ouch!" (hisbottom)said."Oh, Ouch, ouch, ouch! is what you would say afterhave been robbed of my goslings."Now, a long while afterwards he rose to his feet, hestarted off inland; a very severe painbottom.he suffered at his49. NANABUSHU AND THE LITTLE FISHERS.And once, when travelling along, he came upon someyoung Fishers. And this he said to them :yourmother?"Where is"She is off somewhere hunting for game."And when he had broken them in two at the wrist, heeased upon them. And then on his way he went. Andwhen home was come the Fisher, she found that her childrenwere dead. Thereupon she pursued Nanabushu. Andwhen Nanabushu was overtaken, he was going along singinga :song"Little fishers are the ones that I have broken in two at the wrists.Little fishers are the ones that I have broken in two at the wrists.Little fishers are the ones that I have broken in two at the wrists.Little fishers are the ones that I have broken in two at the wrists."By the Fisher was he addressed: "Then it was you, youslew my children !""No!" said Nanabushu. And when he was overtaken,he turned instantly into a log.1And the Fisher foughtthe log, ever so much did she tear the log with her teeth.Thereupon truly did Nanabushu suffer pain in his bottom.
"50. NANABUSHU AND THE RUFFED GROUSE.Menawa kra-nimadca Nanabuju a pidci kagidcidiyat.2Minawa pinansa umi kawa 8namadabinit. Anln ajinikasudkigiwa?""Kuckuncrasi."o5 "Nabisa a- !" ikuckungasi kido Nanabuju. Meclac ka i -jimldcinad, midac kra nimadcad.A pli dac tagucing kistcipina owabama 8 unldcanisa 8 mowiwinit."Awanan ka totonag?""Nanabujuninglmldcinigunan."10 Kinickadizi l a s a /u pina. Ogmo pinanan idac Nanabujun,mganidac anrrjanit kl poni a pina. Klckabi l kang anrijabanNanabuju. pinadac ki kazu cingubl kang. A pri dac ima npamusat Nanabuju, pina tcase ka klpasigu u ,anigu k gitatawanga.A ta! mi a pana Nanabuju ka ijika kabi kisa.15 Medac kltclcabi kitiyacink. Kl i nabit ima n kickabi kank,owabandanan umigln agu kanik ima n asinlng."Wa kunagkigatigom,"udidan. Midac !gi/uwa kunag Nanabuju udumigiwidiyan.Minawa mi tigonsan ugra*nimindciminanan."Miskwa-20 bimagog klgatigom tciani a^klyunk."5 1 . NANABUSHUAND THE MOOSE-HEAD.Midac kra nimadcad. Midac kmagickawad ininiwan,a pidci uniciciwan. A, migwana s !uctigwaning Nanabujuoganonan:uA, mdci, anmdi ajayan?"
415On his50. NANABUSHU AND THE RUFFED GROUSE.way continued Nanabushu with a bottom exceedingly sore. Next some young Ruffed Grouse he found, thatwere sittingdown. "What is the name of yourmother?""AFrightener.""The deuce! she is a frightener,"said Nanabushu. Andso when he had eased himself upon them, then on hiswayhe went.Now, when home was come the old Ruffed Grouse, she sawher children covered with dung."Who did that to you?"Nanabushu were we eased"By upon."Angry was the Ruffed Grouse. So she followed afterNanabushu, and in the path ahead of him the Ruffed Grousealighted. By the edge of a cliff was Nanabushu going,and the Ruffed Grouse was hidden among the balsams.And when by the place Nanabushu passed, the RuffedGrouse suddenly flew up ;with all her might she flappedher wings. Ah! then off tumbled Nanabushu over theprecipice. And then, alighting upon his buttocks, down heslid. On looking up at the precipice, he beheld his soressticking there to the rock. "Lichens shall you be called,"he said to them. And so the lichens were sores fromNanabushu s bottom.Next he went grabbing hold of the shrubs as he passedbe called till theamong them. "Red willows shall youend of theworld."51. NANABUSHU AND THE MOOSE-HEAD.Thereupon he started on his way. And then he metwith a man, very handsome was he. Ah, the feathersupon his head! Nanabushu spoke to him, saying: "Well,my friend, whither are you bound?"
ka/<ukizlba416"A, anicasago nimbabamadis ,kinidac, anindi ajayan?"1"Ka, anicaguna gaya nm nimbabamadis." Mi tigwablnIoda kunan a 8 a /u :inini, Nanabujudac oganonannlclci"Ta,ka e gatsa / unicici kimi tigwab. Skuma blc, mngagagwa-5 tagibina.""A,kawin! Kawlka awiya ninclawi a sl.""A, mano, nidci, kanagago adcina!" Kinwan j ugitacirnan.ri manKaga pi ugimlnigon lni /u mi tigwabln, Nanabujudac ugagwadagibinanmi tigwabin."Ta a ,ka e gatsa minwagizi.10 Skuma win 1 i wa kidasawan." Kinwa n janawi oglsagi tagon,kaga pl oglmlnigon. Ml i dac ka ijinabisitodatcabink;mi i dac kagwatagibinat Nanabucu mi tigwabin,mri/>ui jipimwad Ini/u ininiwan kanagickawa pan. Mo n -zunk ki i jinaguziwan a pl ganisat ; a pidci wminowan. Kistci-15 minwandam Nanabujukistciwlsinit. Ml i dac ka ijipigickijwad!ni /u mo n zon, a pidcidac wanicicink wiyas ugikijizanwamidcit; pimida gaya. Ka kljidanik, midac kl a-gwa i zalkwat. Cl gv/a wlmadandcigat, kiziba kwat. n "Tcie,tcie 11 ,"inwanik. Kawin omino tanzln. "Icta, pizan taga!"Acka-20 migu kijiwa rikwat. Nanabujudac klpasigwl,oglmanijan pangl ojobln. Midac adank ri /i11 kizlba kwat :7"K^gatsa kidombigis. Klwanickwam wlwlsiniyan. Owa gayagin mldcin." Midac Nanabuju a tod ri x upimida kizlbakwat oglta kwamigun. Mri ma n kra/godcink kistciginwa n c,25 plnic anode awaslyag ma-rnganag; kwingwa a gag,1 Translated by the editor.
Still""Oh, I am just simply travelling about; and you, whereare you going?""Oh, I too am simply wandering aimlesslyabout." Abow the man held in his hand, and Nanabushu addressedhim, saying: "Why, my friend, truly handsome is yourbow. Just you hand it over to me,I want to see howitpulls.""Ah,no! never do I turn it over to any one.""Oh, please, my friend, just only for a moment!" Along while, he coaxed him. At last he was given thebow, and Nanabushu tested the spring of the bow. Why,to be sure, it pulls finely. Just (hand me) over that arrowof yours."With all his pleading, yet a long while wasit withheld from him, but finallyit was given to him.Thereupon he fitted it in place on the bowstring and;when Nanabushu pulled upon the bow, he thereupon shotthe man whom he had met. Like a moose he looked,after (Nanabushu);had slain him he was ever so fat.Highly pleased was Nanabushu to have a great heap offood. Accordingly he cut the moose up into pieces, andvery nice was the meat he cooked to eat ;and the greasetoo (was savory). When it was done, he accordingly tookit out of the kettle. Just as he was on the point of eating,there was a creaking noise. "Tcie 11 tcie n !" was the , wayit sounded. He did not like the sound."Now,do youkeep silent !"louder grew the noise of the creaking.Nanabushu rose to his feet, sliced off a little bit of (fatty)tenderloin. And then he said to the creaking noise :"Really,too much of a noise are you making. You are annoyingme when I want to eat. This too do youeat." Andwhen Nanabushu placed the fat in where the creakingnoise was made, he was caughtfast.Accordingly therehe hung for a great while, until all sorts of game-folk -27 PUBL. AMER. ETHN. SOC. VOL. VII.
udigon.!"418udclgag, wagucag gltagwicinog kra rnwawad mozon ;kagagiwag gaya. Panima ka kina ka kidamunt l a s a /u mo n smri-"pidclnag, kipagidamigut Nanabuju ri - u kizlba kwat.Alpidci wiwisini krija iiman abini pan lni/u mozon. Mlya ta:5 u kanan l a tanig, ustigwanigagan kaya a tani. Medac ajiwabamadwawabiganodclya 9plndiganit iman mons ustigwanig.Owabandan pangl a tanig winindip."Apagic!"mldciyancinandam mldac ajikanonat wawabiganodciya "Kitagackitdnawana gaya nln ri /fU tcri niginiyan ayaniginiyag?"10"A,kawin !""Uzam kimindit," udjgon."A,manii kayanln mwlplndiga ima n mo n s ustigwaning!""Awawisa^" udigon."Oma n ya ta kistigwaning klgadagan ci /n y e ."Midec wawabiganodciyink gii ni kuguictigwanat. Mldac15 kl pmdi kwanit,"Pa kagu wlsinin," udigon. "Kaguumbikwanikan," udigon. Uzamidac Nanabuju kru-mbi kwani,mldec ka ijimistcanik ustigwan. Kawin kikackru sl tcigltcigutad. Mldac ka ijimadcad tibraj agwan ^kawin owabandan zln ajad. Ka kina mi tigon pa ta kucink ugagwatci-20 man: "AwananMina i k naningudino ; wlgwas namngutino azatiwan;ninguting. Mlnawa mi tigon opi ta kuckawan, "Awanangin?"udinan. Kl ijiksa."Mlsaxpacu rtclgibik indayamitug,"inandam. Wipagu kae gat nibi uda kugadan. Mldac igu25 kwaya k ka a ni i jinlminaslt, kra nipimadaga kwaya kiguajad. Awiya unundawan plpaginit anicinaban B: A 8 e, nackakuca 7 mo n ;, s !pamadagat Aa /u ! mawinadawata we
""Hey419wolves, martens, fishers, foxes arrived to eat the moose;ravens too (arrived). Not till the whole of the moose waseaten up, was Nanabushu freed from the grip of thecreaking place. Very eager was he to eat, and he wentover to where the moose had been. Onlyits bones wereleft, its skull was there too. Thereupon he saw somemice 1 go into the head of the moose. He saw that alittle bit of the brains was left. "Would that Imighteat it !" hesaying:thought. Thereupon he spoke to the mice,Could you bringit about so that Imight be ofthe same size as you?"he"Ah,was told.no!" he was told. "Of too large a size are you,""Ah, please let me go"Allwill youinto the head of the moose too!"right, then,"he was told. here at "Only your headbe made small."Thereupon like unto the head of a mouse was the sizeof his head. And so when he stuck his head in, "Slowlydo you eat,"he was told. "Do not liftyour head," he wastold. Now, too high Nanabushu lifted his head, whereuponthe size of his head enlarged. He was unable to get (hishead) free. Thereupon he started off, not knowing whitherhe was going ;he did not see whither he was bound. Everytree he bumped against he asked of it "Who are you : ?"A tamarack (it was) sometimes a birch; (it was) sometimes;a poplar once. Another tree he bumped against."Who are you?"he said to it. A cedar (it was)."Thenclose to the edge of the water I must be,"he thought.Soon then really into the water he stepped. Thereupon,when straight into the water he went, off he went swimming towards the way he was bound. Some people heheard calling aloud :!ming by Come on ! Let!Justlook ! aus go for him !"1In another version it was the flies.moose is swim
kra/<u420Mldac ka e gat ajipoziwad anicinabag wlnisawad mo n zon.Nanabujudac kiwackibagizo.9 e! aja wackataga!""ANanabuju anigu k pimadaga. Anicinabag cigwa pacu rpi-a-yawag. Midac Nanabuju cigwa taba kinank, mldac5 acimadclpa tod pagwana, kawin owabanda n zm apa tod.Mldac kru-jajabi kicink, mri dec klpasesink ri mo n suctigwanic.Mri^dac pidcmag kiwabit. Mri/<unimadclpatod. Nanabujun win ka i jinaguzinit mra ;a patogwan Nanabuju.>4panatibi10 Mlsa1a*kosit.52.NANAP.USIIU is MIRACULOUSLY FED BEAR-GREASEDNingudingisa anipa pimosaguban Nanabuju, me i daca pl wadisat adcidamon tanit; krpmdigadac andanit."Mri dac anandang adcidamo :Ningatacama Nanabuju."Medac pa tawlyas kra^tod onaganing,emlnawadec pa jik15 onagans ogimamon wra^tod pimida. Medac ka*i*jra dapinadudisinlman, mldac mo koman ajipajiba O dizut. Medacima n pimida wandcidciwaninig, pa kic :nondaguzi"Tc! tcitci tci tci tci, ma ku pimida!"Medac kra camad Nanabijun.Ka i skwawlsinit Nanabuju, "Kayanln nlngatacama20 adcidamo," inandam. Medac mo koman odo pinang, mldacaji u da pinat udasiniman. Medac ka i jipajigibawad udasimman,mri-u klnisidizut.1For other versions see Nos. 36 (p. 311) and 40 (p. 341).
421Thereupon truly into their canoes went the people, inthe hope of killing the moose. Nanabushu then quicklyturned about. He is"Hey! turning was swimming fast. The people now were coming close.And when Nanabushu touched bottom, then off he startedback!" Nanabushurunning without knowing where he did not see whither;he was running. And then he stumbled and fell, whereupon he cracked that wretched head of the moose. Andthat was when he could see. Accordingly away he startedrunning. Nanabushu then took on his own form;and offhe ran, no one knew where.And that is the end of (the story).52. NANABUSHU is MIRACULOUSLY FED BEAR-GREASE. lNow, once upon a time on his waywent Nanabushuwalking, and it was then that he came to where a squirrellived;and he went into where (the squirrel) lived.Now, this thought the squirrel:"I will feed Nanabushu."And so when some dry meat he had placed into a bowl,he next took a small vessel in which to putsome fat.Accordingly, taking hold of his stone, 3 he then piercedhimself (there) with a knife. Whereupon from thenceflowed some grease, at the same time he was heard saying:"Tci tci tci tci tci tcl, bear-grease!" ThereuponNanabushu.he fedAfter Nanabushu had finished eating,"So will I toofeed the squirrel,"he thought. Thereupon taking a knife,he reached hold of his stone. And so when he had piercedhis stone, he accordingly killed himself. 82 A synonym e for "testes."3 It is common with the Ojibwas of Canada to have Nanabushu die and then befetched back tolife, as here; the same, too, with his grandmother. This elementis rather out of keeping with the tales of the other Ojibwas.
kikra422Adcidamodac ogipapodanan Nanabujun, mri /<ukrpimadcia/d.53.NANABUSHU AND THE WOODPECKER.!Kra nimadcadac Nanabuju. Mmawa ogra/nro disan mamae n ta a nit wlmbina kadonk. Mldac ki pindigat andanit.5Mama e dec kra^kwandawa Ima n pa taclngwa kung.Oganawabaman andodaminit Ini/u mama e n.Anigagwatikwau- ima n mi tigung ;a pidcidac spimlngkitci a nigu kmadwa/kwa/irt mrivma n wandcipangicininitasibanan. Miwaninika kljiswad kl a camad Nanabujun.10 Ackwawisinit Nanabuju, "Kayannm nlngatacama mama."Npjidac u kanan ogru da pinanan. Medac ka ijikaciga-a ngnamdawayaT, mldac kla tod udanigumang. Medac a kwandawatima n mi tigung kaya win kagwati kwa 11 . A pidcidaclicpimmg ayat, mri /<utci a nigu k ajimadwa kwa u t. Mli-15 dac ajinisitizut.Kawln oginisasin asibanan. Mamandacoglpimadci i gon./>uMri nimadcad.Misaguna a kozit.54. NANABUSHU MARRIES.Anlc, ningudingsa kl n wa n Nanabucu klbabimusa pabamadisit,wina tagunici ka. Kaga pl ninguding anicinaba"20 odotisan ;ima dac ayawat Igi /u anicinaba e g u pimaya r dacima owabandan wlgiwamans ayanik. Mldac ka/rjinan zi-1For other versions see Nos. 35 (p. 305) and 42 (p. 357).
423Now, the squirrelbreathed upon Nanabushu, whereuponhe fetched him back to life.53. NANABUSHU AND THE WOODPECKER. lSo on hisway went Nanabushu. Next "he went to visitthe red-head at where he was in the hole of a tree. Andso he went into where the (red-head) lived.Now, the red-head climbed up a dead pine-tree.He watched what the red-head was doing. (The redhead) kept testing where to peck on his way up the tree ;and when very high up was heard the sound of himpecking with all his might, then down from there camefalling a raccoon. That was what he cooked when hefed Nanabushu.When Nanabushu was done eating,"I too will feed thered-head." Now, two bones he took. And so when hehad sharpened them at both ends, he accordingly placedthem in his nostrils. And when he climbed up the tree,he also tested where to peck. And when very high uphe was, he then was heard pecking with all his might.Thereupon he killed himself. He did not kill a raccoon.And by the red-head was he brought back to life. Andso on hiswayhe went.And that is as far as (the story) goes.54.NANABUSHU MARRIES.Well, once on a time they say Nanabushu went walkingalong, travelling from place to place, and all alone. Thenin due course of time to where some people were he came;now, off at one side of where the people were, he saw asmall wigwam standing. 3 Accordingly, when he went up2Reference is to the menstrual lodge,
tcibinandu"424kang, kita pabi dac ickwandank i kwawan owabamannamadabinit. Kawin kanaga plnabislwan ,a pri dac ka kanimigut:mlkanonigut "Kagu intawa plndika kan," udigon;"undcita oma n nijika nindaiya," udigon.tapm-!"5 "Mann, ningapmdiga udinan."Kago pmdika kan, "Kawmudigon. awiya oma 11dikasl." Kawin kanaga pi irndci-i-nabislwan.Nanabucii dac a pidci inandam wl pmdigat, midac ka i*-jiplndigat mi kl n wa n awi kwa aji a^pidcinawagi kwanit.;10 Panima dac wayabank kiglcap pitagwicinon ogmlaVwilkwapi a-camigut ; pa taniwlyas patod a 11 mindimoya, mrV uka a camat udanisan.Nanabucu dac oganonan Ini/u mindimoyayan:Kawlninanintawldigamasl a fi a /u kitanis?"15 "Niya,"i kitu a u mindimoya; "magwa kuca manido u -i !Kaya dac kawln tibanindisusl, osan udibanimigon. Ningawlndamawaa 11 a kiw^zl.""Anlc, manosa 7 . Minawana kawa ningababamadis.Klnicwasugunaga k ningatagwicin, mri />uki kan-20 daman kadi kitogwan a u a kiwa l n zi. w Midac ka/ijimadcatNanabucu klpabamadisit no piming anodci ; kagon ubabaniton madcit. A 4 /<upri*dac aninicwasugunagatinig mri55cigwa icat, anotc awaslyansa udanirnadclna . A pli dacani u di tang iwa wigiwamans owabandan, wawani plnictci-1Man is forbidden to enter a menstrual lodge; usually an old woman is about,who looks after the wants of the woman.2 A woman menstruatingis to be avoided for the evil power she then is saidto have.
425a woman he sawto he it, peeped in at the entry-way;seated there. Not even did she glance up at him;andwhen his presence became known, then was he spoken to(in these words): not "Do enter in, I he waspray," told;lsince I am here alone,"he was told."especially"Please let me come in!" he said to her."Do not come in,"he was told."Nobodyis allowedto enter here." Not even did she look up (at him) fromwhere she was.Now, Nanabushu was very keen to enter, whereupon hethen went in;then they say the woman bowed her head,holding it very low.Now, by and by on the morrow, during the morning,hither came the mother of the woman, bringing food tofeed her (daughter) dried meat was what the old womanfetched, and with that she fed her daughter.Now, Nanabushu spoke to the old woman, saying:I not marry your daughter?""May"Dear me!" said the old woman; "why,she is now in3the condition of a manitou ! And she is not at libertyyet to act for herself, under her father s control is shestill. I will tell the old man about it.""Well, all right. For another while will I wander about.At the end of seven daysI will return, then will I cometo learn what the old man shall say." Thereupon departedNanabushu, travelling from place to place inland all sorts;of things he killed to eat during his wandering. Andwhen the seventh day was drawing on, then thither hewent. And when he got up to the small wigwam, 4 he sawthat it was all set in neat order. And when he peeped:*These excuses by the mother are only a formality. She really has more tosay than the father, and could have given the answer then. It is a point8not toappear too anxious, however willing one may be.4 This isgiven as the same little wigwam, but as a matter of fact it would beanother into which the woman would go after her illness.
426gadanig. A pri dac ta pabandank iwa wlgiwamans, ubiganawabamigonlni /u i kwawan. "Amc, kitaplndiga," udigon.Mri dac a 8 a wi lkwa agwatcing kri ja midac wabandank;Nanabuco ubimiwanan, wlyas a/tanig, mizisa 8 5:kaya pinawa5 kaya. Midac awi kwa ka ijitclba kwat, midac a kitut :"Ningatawinandumak ninlngri Migog." ka-ijimadcatawi kwa, ugra-winanduman osan ugln kaya. Nlnganidackrpitagwicin awi kwa.lA pri dac tagucinuwat Igiwa ki tcra nicinaba^g, owaba-10 mawan Nanabucon namadabinit agamindaslng. Midaca kitut awa a kiwa n zi :"Anlc, Nanabucu, ninglwindamago4 u fi i ka/i- kituwanan ananimawatannindanisinan.laVwiKawin a pidci kagon uni tawitosin,nondasi." Wawani uglwlndamawanIni /u Nanabucon."Kicpindac anawanimasi-15 wat, manosa x intawa kitawidclwa." Midac ka icipasigwitla s a /u a kiwa n zioglsagini kanan udanisan, Nanabucondacnamadapinit ogrirnabra/n. Mri dac klkagl kamawat lni /uudanisiwan wawani tciwi pimadisinit.Midac ka ijiwlsiniwat.Ka i ckwawlsiniwat kfkanona20 Nanabuco: "Amba, pljayu k andayang, kayaklnawa tcipia yayag ima oda towad anicinabag."Midac ima klna a ngabit ; mojagidac kinandawandciga,anode kagouni ton awasiya^. Namngudino upiwidclwanma*kwan, midac ima panima pitagwicing ickwandank mrrma25 mwanawat. Wlbadacigu Nanabucu kli kitu : "WYkundiwin1All this isaccordingto custom.2At the back of the lodge, the proper placefor a male visitor to sit wherethere is no male owner of the lodge.3These words are purely formal, and have no meaning. A parent uses them,
"A5 As a rule, a man and his wife do not go away at once to live by themselves ;427intothe small wigwam, he was met with an expectant lookfrom the woman."Well, you may come in,"he was told.Thereupon the woman went out of doors ;and so, whenshe saw Nanabushu s pack, meat was therein, besidesturkeys and ruffed grouse. And so when the woman hadcooked a meal, she then said: will "Igo ask my parentsthe womanto come."Accordingly then departed she;went to invite her father and mother. Before (their arrival),back home had come the woman. 1Now, when the old folks arrived, they saw Nanabushuseated in the space behind the fire. 2 Thereupon said theold man: "Well, Nanabushu, I have been told what yousaid concerning the way you feel about this daughter ofours. She is not so very smart at doing things,dull."she is3He was careful to tell Nanabushu about her."So ifyou are not disinclined to taking her, why, you maythen4marry her." Thereupon rising to his feet, the oldman took his daughter by the hand, and where Nanabushuwas seated he had her sit beside him. And then hecharged his daughter that she live an upright life.Thereupon they ate. After they had eaten, then Nanabushu was told: "Now, do you come to where we live,so that you also may dwell yonder where the people havea town." 5And so there he lived with the people of his wife;andcontinually was he on the hunt for game, every kind ofgame he killed. Frequently he came home in companywith a bear, and not till he was come there at the doorway did he then itlay low with a club. So in a littlewhile Nanabushu said : feast there shall be of gamenomatter how capable his daughter is, but he does not permit any one else to saythe same thing of her.4 Another formal statement which serves to put the responsibilityon the man.they live a while either with his parents or else with hers.
ka428tcrirjictcigatanig awasimldcim, mizisa gaya, ka kinagu andaswawanagisiwat,pinewa 8 gay a."Midac ka/rciwl kumindwa nlbiwa anicinaba e g, kwawagi/<ukaya. Ka i ckwawl kunding dac mri i crirdaminowat,5 plpagadowawag. Pkwawag kaya pa kan klwadaminowag,7klpapasi kawawag. Mldac ka i- kidunk* 11: "Mlsa*! Nanabucuuwldigawin nongum wandci u daminuwin. Ml gadiciwabak l awlya kawldigadin,"krr kitowag.Mri fU kaya wlnawa ka i citcigawat anicinabae g awlya10 kawldigadin.55. THE ORIGIN OF LIKENESSES OF NANABUSHU.Mldac ima n mo n jag ki*a*yatla a /u Nanabucu. Ningudingidacki l kusiwag Nanabucu wlwan, o kumisandac oglwldciwigowan.Mojag kra*ndawandciga. Nanabuco, amik-kwan kaya ogmodcra/n ani t; ogl u ji ton Nanabuco mri /<u15 ka*a*batci tot ami kwan klpacipawat ; mistcigi /u kataijinils /ui i u l kan ka/uji tot.Ningudingidac ugimi kawan ki s tci-a mikwa^ tanitmrcrwiigi tcikaming, a pidci mamanditowan. Mldac anat wiwan :"Ninganodci a-g igi /u ami kwag." Nljinon Ini /u ami kwag20 andawat, mi i we pajik Miming minawadec Micibigwadominising.Mi i we kaya ami kwag ka tawagubanan. Uglpigwa*anan ! Ini /u ami kuwlcan. Mri dac klbabamajagamatuwa gistcigami anint uglnisan ami konsa 8 ; ,pajik kayaki tciami kwan;pajikidac ki s tci ami kwan kawm umi kawasln.1The ceremonyisalways after the wedding.-Pointed with a single barb. The shaft is longer than the barb,at one end through which to fasten the cord.and has a hole
"429food, and of turkeys, and of every kind of game thereis, and of ruffed grouse."And so there were invited to the feast many men,women too. And after the feast was over, they then playedgames, they came to play ball. The women too playeda different game, they played the double-ball game. Forand that isit was said: "This is Nanabushu s wedding,why to-day we play. Thus shall it ever be when any oneis married," (so) they said. 1Thus too have the people done whenever anymarried.one has55. THE ORIGIN OF LIKENESSES OK NANAP.USIIU.And so there for a long while continued Nanabushu.Now, once on a time to another place moved Nanabushuand his wife, and by his grandmother were they accompanied. Ever was Nanabushu in quest of game, for beaverstoo he hunted a ; harpoon Nanabushu made, and that waswhat he used when he speared the beaver; spine-of-apickerel-fmis the name of the bone (point) which he made.Now, once he found a place over here in the sea wherethe great beavers dwelt, they were very huge. Thereuponhe said to his wife: "I am going after these beavers."Two were the places where those beavers dwelt : one wasover here at Isle Royal, 3 and the other was at MichipicotenIsland. 4 Now, those were the places where the beaversdwelt. He destroyed the beaver dwellings. Thereuponhe wandered away, following the shore of this sea; someof the small beavers he killed, one large beaver too;butone other large beaver he did not find. So at last he3West and not far from Fort William.4 North of Sault Ste Marie.
nondawat5430Kaga prrdac kri nandam: "Intawaningaplgwa a/n Iu kunim, manodac ta i ska ta o o* ki s tcigami, mri u tcimilkawagaV ami11k."8 /ui iMldac ka*i*jiwijamat o kumisan iwiti u kuniming. A plfii dac ka pigwa a nk /u i iu^unim, "Mloman ayan, kanawandantcipimabonusik a^ ami11k,"udinan. A ! mldacklslgidciwanki i -u nibi. Minawadac Nanabuco klmadciyacagamaowa ki s tcigami. Mldac ima Micibigwadominising klajawikwaskunit; magwadac ima nlbawit owabaman nigigwan10 aniniska tanik. Mldac ka i jiminawa a jawigwaskunit, mldacima ugrirjacicing ajajklkang. Mldac kapasigwit, uglpa pitoni i ma 11 kra/na kwitiyacing.uwlngagu ajinagusitijinagwatini."Manu, nocica n yag pitclnag kadanipimadisiwatugaba pi tonawa."15 Mldac ka ijino pinanat Ini/u nigigwan uglpajipa wan 4 8 i /ut.mistcigiwani Wiwlsini klwan . "Intawa a kawa ningatamwaa 8 a /u kri nandam. Mldacnigig," ka-ijipa kunat,klpodawa; mldac /<uajra pwad. A pri dac ka kijiswat mriajiwawanabit. Uglpada kinan. Cigwadac kamanicank20 pajik 4 8 /u inigikutawag, mri /<uo kumisan madwakwlckucinitiwiti Bawi ting.Mldac ka/rjipasingutcisat,klmadclba tod. A pri dac pagamiba tod iwiti Bawi ting,"Anln?" udinan o kumisan.Mldac a kitut a fi25 klpimabonu a 11 ami k."a /u ma ka klmindimoya:"Ajaa pami,1At the head of Sault Ste Marie. By destroying it, the rapids were made.2The usual expression is which "my nephews," implied also "my aunts," meaningthe people.
nother name for Mother Earth, or the grandmother of Nanabushu. fjthought: "Therefore I will destroy the (beaver) dam, 1 nomatter if this sea should go dry, for then I shall find thebeaver."Thereupon he had his grandmother go with him toyonder (beaver) dam. And when he had demolished thedam, this "In place do you remain, do you watch thatthe beaver does not float by with the current," he saidto her. Ah !andthen out the water flowed. So oncemore Nanabushu set out, following the shore of this sea.And then across to Michipicoten Island he leaped and;while he was standing over there, he saw an otter wherethe water was running low. Accordinglyback across heleaped, whereat he slipped and fell in the mud. And so,when he rose to his feet, he laughed at the spot wherehe had left an imprint of his bottom; precisely like theform on him was the way it looked. "No matter, let mygrandchildren 3 that shall live hereafter have it to laugh at."And when he pursued the otter, he piercedit withthe fin spine of his harpoon. He was eager to eat, theysay. "Accordinglybefore (proceeding further)I will eatthe otter,"he thought. And so, when he had flayed it,he built a fire; thereupon he roasted it on the spit. Andwhen he had finished cooking it, he then sat down. Hestuck (the spit into the ground) with (the otter still)on it.And when with a knife he sliced off one of the otter sears, 3he then heard the sound of his grandmother whistlingoff yonder at the Sault. Thereupon leaping to his feet,he started off a-running. And when he came running upto yonder Sault, "What (is it)?"he said to his grandmother.Thereupon said the old Toad-Woman :floatingwith the current went the beaver."4"It isgone,3The otter on the spit can be seen, so it is said,as a shaft of rock on theWisconsin shore of Lake Superior.VYU.-
432A^I tci niskadisit dac l a s a /u Nanabucu mri /iU ka/ijimwanawat o kumisan. Miziwadac klmiskwiwabi ka i u wadci 11 ."Oma ka klwabi kunk ta i cini kata,"krr kitu Nanabucu.Mldac rrwiti anuglpaba a/ndawabamat lni /u ami kwan,5 kawmdac ugimi kawasln. Mlnawadac krpiklwii, kayabiki pabanandawabandcigat kayabi tcra yanit ami kwan ka;wmdac awiya oglmi kawasln. Miziwa anugipabaija ima;wlcan ka u ndclplgu ank, rniya ta mi tigdn piwandamowatami kwag kawabandangin.10 Minawadac kra nikiwa a yacagama. Tasing aniwabandanginrrma krircacicingiban, ugi tciba piton. Mldac imaMicibigwato wl kwadunk mri ma ka iji U nabit. "Kicpinanicinaba e g kabimiwabamiwat kicpin pang! asaman mlciwat/>unandawandamowat tcinama a mowat, mri pang! tciboda-15 dcigayan."Mldacigu ima a pana namadabit, anicinaba klnamadabitmri/>uajinagwa k i i* u asin. Mldac igu kagatajiwaba k -,kicpin awlya pang! a paginat asaman, "Nanabuju! kiblndakonin ningawinamaamin," mlgu kaga tajinamaanigwa k.20 Mlsa 1 a kosit, pinawidis kl*a-goda.56. NANABUSHU FLIP:S WITH THE GEP:SK./Ningudingisa minawa anipapimosaguban Nanabuju, midaclajiwabamad minawa ni ka s ayanit iman saga gamng. Mldaciajikanonat:"Taga, kaya nm ajinagusiyag ijiiciyu k."1In various places in the Ojibwa country may be observed a rock, island, orwhen seen from thehigh land looking like a human being either reclining or seated,distance, and it is generally called Nanabushu.
433And so angry was Nanabushu, that he then smote hisgrandmother (tillshe was dead). And everywhere wasthe mountain reddened with blood. "Toad Mountain shallit be called,"said Nanabushu.Thereupon off yonder he wandered, looking in vain forthe beaver, but he did not find it. So again he turnedhisway homeward, still yet was he roaming from placeto place to find if yet there were any beavers ;but hefound none. Everywhere he went wandering, but without success;there where he had broken up the beaverdwellings, all that he saw were the logs which the beavershad gnawed to pieces.So again he turned back home, going by way of theshore. As often as he beheld the places on the waywhere he had slipped and fell, heartily he laughed at them.And so yonder at Michipicoten Bay was where he satdown. "Ifpeople behold me when passing by, if theyshould give me a little tobacco in their wish for a fairwind, then gently would I blow (with my breath)."And so there he still sits, like a person sittingis theway the rock looks. 1 And that, sure enough, is what hapifpens ; any one offers a little tobacco (with) a O Nanabushu ! I come with an offering to you, we wish for afair wind,"then verily there comes up a fair wind.That is as far as the story goes, the gizzard of theruffed grouse now hangs aloft.56. NANABUSHU FLIES WITH THE GEESE. 2Now, once again was Nanabushu travelling along, whenhe then saw some more geese that were in a lake.Thereupon he spoke to them, saying: do"Pray, you make2For another version see No. 15 (p. 127).28 -PUBL. AMER. ETHN. SOC. VOL. VII.
"UglnodciAnodeKinwa^j ogltajima 8 .Kaga434pl,Awisa," udigon. Mri dacpa e pacik ka-rjimmigut umlguniwan. A prrdac tayapisanitmlgwana 8 mri u ka e, ga t ni king krijinaguzit Nanabuju.Klpazigwa u- 4ni ka8 .gayawm klpabawidclwad A pri*dac"Misaanitagwagininik,cigwa tcimadcayank," udigon.Mri dac cigwa pazigwa-crwat, cawanunk ani ijawad nagamowag:"A i natinag kijiga a i-natciwasayani.A inatinag kijiga a rnatciwasayani."A-rnatinag kijigairi-natciwascayani.Mri dac agut: miziwa inabi"Kagu kan, kwaya kiguajayank inabin. Cigwa pacu / anicinabek oda towag kadanrijayank. Kagu kanaga inabi kan. Tamadwanandnda-xgusiwag anicinabek. Kagu kanawabama kan."1 5 A pi ani irdi tamuwad anicinaba 8 {!oda cigwa wabamawagni "Akag pimisawad. a, inaska kuca ni !kagKa e gatsa mindi to pa e jik l a c a /u ni ka !" madwiri n-wa kazowag anicinabeg. Kaga pl krrnabi Nanabuju, mri /<uka ijipi taganamigut umngwiganang, klpo kwisani uningwi-20 gan ; mldac klpangicink Nanabuju."E e 1 ,pa e jik pangicin ni ka !" a wan, ugipabaminlcaa wawan wltabibinawat. A pri dac wadcanimi-i nt,indawa kipasigwi. "WrH H, Nanabujun nangwanajinagwi U nit !" Mldac klki tcipa pi a wad Nanabujiin.ka i*-25I}inawidiskra goda.
435me look the same as you."A long- while was he coaxingthem. At last,"Allhe was told.right," Accordinglyby each one was he given a feather. And when thenumber of feathers was enough (to cover him), then trulylike a goose was the look of Nanabushu. Up he alsoflew when he went about incompany with the geese.And when it was getting well on towards the fall, "Therefore now is it time for us to be going away,"he was told.Thereupon then up they rose on the wing,way southward they went, (and) they sang :as on their"By way of the mountain-ranges do I fly along through the sky,By way of the mountain-ranges do I fly along through the sky,By way of the mountain-ranges do I fly along through the sky."And then he was told: "Do not look everywhere, butstraight toward the way we are bound do you look. Fornot faraway do some people dwell in a town who shallbe in the way of our course. Do not for any reason look.Everywhere will be heard the voices of the people shouting.Do not look at them."When they came to where the people lived in a town,already were the geese seen flying past. "Hey! Just lookat the geese! Truly bigis one of the geese!"All sortsof noise did the peoplemake. At last did Nanabushulook, whereupon he was accidentally hit on the wing,broken was his wing ;and then down fell Nanabushu.went after"Hey!One of the geese is falling!" Theyit, they chased it hither and thither to captureit. Andwhen he was on the point of being brought to bay, hethereupon rose to his feet. "Wl i i i,that was what Nanabushu made himself look like!" And so they laughedheartily at Nanabushu.The gizzard of the ruffed grouse hangs aloft.
436SERIES VIII. Nos. 57-63.57.NANABUSHU AND THE FISH-TRAP."Nojis,"Ningutingsa klwan aTndawag Nanabuco o kumisan kaya.Mldac klwa n anat ocisan :udinan, "iwa zibi pacuka/a yamaga k, mfku ima plndcibonaganan uji a;wa l pani ku kicica n ibamg,"udinan.5Nanabucudac win kawm kagoi kitusi. Miya tagu a pananandawantcigat pabltod kago andawat. A pidcima kayaNanabucu klml kawiinimwi Ina tisokasu. Ningutingidac,klwaku a i ndawat, omi kwandan ka igu pan o kumisanundci tcipintcibonaganikat pawi tigunk. Mldec Nanabucu10 anandank :"Ictamltagic ka/rci pan no komis k tciplntcibonaganikayan. Magica no knmis aiya kusitug panii wiyasmldcit," inandam Nanabuco. "Kl n go n yandac kanabatcuwl a mwan," inandam. Mldac anat: "No l kumis, ka i ciyambanidacundcipmdcibonagani kayan?"815,""Ayai kitu mindimoya. "Imagutabawi tigunk mlimaaku pmdcibonawa pan kl n go n ya g kicicayabanlg," udinan."Kitcinanibiwa, kinlni ku, unisawabanln ki n go n ya c ,"udigono kumisan.Mldec kagat Nanabuco madci tad ujra/t pindcibonaga-20 nan, ki s tcimi l tigon udayawatciniganan, wasa kaya udondawanan,wlsongi tod uplndcibonaganan. Mldac ka klci a twlndamawat o kumisan, midac anat: "Ml,no kumis, kl kl-
437SERIES VIII. Nos. 57-63.57. NANABUSHU AND THE FISH-TRAP.Once on a time they say that Nanabushu and his grandmother were abiding there. And so they say that shesaid to her grandson: "My grandson,"she said to him,"over there hard by is a river, and it was there youruncles of old used to set fish-traps,"she said to him.Now, Nanabushu, so .far as he was concerned, had nothingto say. His only occupation was always hunting for game(and) bringing something home. And very lucky too wasNanabushu at getting game, to judge from his fame instory. Now, once on a time they say that while theywere living, (there),he remembered what his grandmotherhad said to him about going to catch fish with the fishtrapat the rapids. Thereupon Nanabushu thought: "Quiteso, that is what my grandmother had told me, that Ishould go to catch fish with the fish-trap. Perhaps mygrandmother may have grown tired of always eating meat,"thought Nanabushu. "Now, fish she probably wants toeat,"he thought. Thereupon he said to her: "My grandmother, (you remember) what you told me about catchingfish with a fish-trap?""Yes,"said the old woman. "It was at yonder rapidswhere your uncles of old used to fish with a fish-trap,"she said to him."Oh, great indeed was the number offishes they used to kill,"he was told by his grandmother.And then truly did Nanabushu begin makinghis fishtraps,huge logs he carried on his shoulders, and fromafar he carried them on his back, (for)he wanted to makehis traps strong.And then after he had finished themhe notified his grandmother, and this he said to her :
"udinan."A"!"ci a g pmdcibonagan, mldac kl n go n tcrarmwat," udinano kumisan.8,""Ayakitu imindimoya.Mldac weyabaninig Nanabucu kra wiwabamat upmdci-5 bonaganan, nlbawa dac k!n go n yan klplndciposowan mldac;7Nanabucu kl klwawanat. Ani a yat dac pacu anri- kitu Nanabucu : "No kumis! nlbawa kPgoyag mingmisag," i kito.Mldac kagatmindimoya ki s tciminwandank.Mldac a*rndawat, nibiwa kPgoyan Nanabucu onisan.10 Ningudingidacigu magwa nandciplndcibonaganat, onondawanawiya pinondagusinit, inwanit-,Acri nabit Nanabucu, andutank, wlkatcina u twagunanka i nwanik; magwadac andutank sasi ka unondawan15ketcipacu : "Tcike tcike,tcik"kayadac minawa tibicko :-,-!" Mldac Nanabuco wawlp nawatcipinatugi n ko n ya 8 madciba tod, ;ka a niwawajacacakucingigoNanabucu. Klwaba tod i kitut dac anitagwicing:"Nokumidida, awiyaninnondawa!""Anm anwat?"-20 -,F ml a nwat,"udinan.Mldac a/kitut mindimoya:a , kwlngwlci 7 udinawabanm"Wlwlsini, klnandudamagkicica n !"yabanlgcamat pa irndcri nwat. Kl n go n yan acam,"udinan.tci a*-Midac kaga t Nanabucu uta pinat ki n go n ya L , paginal25 anlndi ina kakaya ka tani tang. Mldac minawa weyabaninig
""ThereuponAnd439"There, my grandmother, have I finished the fish-traps,and now some fish willyou eat,"he (thus) said to hisgrandmother.said the old woman."Ay,"So then in the morning Nanabushu went to see hisfish-traps, and many the fish that were drawn into them ;thereupon Nanabushu went back home, carrying them along.And as he was drawing near, Nanabushu went along,saying: "O my grandmother! many fishes have I killed,"he said.Thereupon truly was the old woman highly pleased.And so while they remained there, many fishes Nanabushu slew. And now, once on a time while he was outhunting for fish at his traps, he heard the approachingsound of some creature. The sound it uttered was: "-,--!"Up Nanabushu looked, he listenedfor it,for he wanted to be sure of what was making thenoise ;and while he listened for it, suddenly he heard itvery close :"Tcike, tcike, tcik !" then again the same :- -!" Nanabushu quickly,gathered up his fishes, (and) started running ; (and) on theway Nanabushu went slipping on the logs and knockingoff the bark. On the way home he ran, and said as hewas arriving:"Omy grandmother! I hear something.""How did it sound?"l,--! was the way it sounded," hesaid to her.And then said the old woman: "Why,a Canada jayis what your uncles of old used to call it!" she said tohim. "That it wanted to eat, (and) was begging of youto feed it, was why it cried out in that way. Feed itsome fish,"she said to him.Thereupon truly Nanabushu took the fishes, (and) threwpart of them towards the place where he had heard the
,"Nanabucu440Nanabucu nandciplndcibobaganat, ml mlnawa awiya klnondawatnodagusinit. Mldac ka*rcipaginat kl n go n yan andanitang, mi kwandank o kumisan ka/i gut pitclnago. Kawlndacmamwatc wl klwapitosl. Mldac mlnawa aniklwat,5 anrrnat o kumisan: "Awiyamlnawa ninglnontawa nonda-mi ta kamig tanwawitam."gusit,Mldac agut a : "A, cangwaci au udinawabanin kicica n yabanig."Aye9Kigra camana ?"i kitu Nanabucu.10 "Mri wagwaya k," udigon o kumisan. "Nojis!" udigon ;"nlbawaawiya, aya a wicansag klga u disigunanig, mlcigua pana tci a camatwa,"camatwa wlwisiniwagudinan.kayawinawa.""Kmantawiskatagoktci a*-Mldac kiwa n Nanabucu minawa natciplndciponaganat.15 Nibiwa a pitci onisan kln go n ya c .Kaya windac mindimoyaaninama ta ku ka; wlnga omockina ton andawat pindik ;agwawat kaya agwatcing tasa kwa iganan uwlnga mamockinaniwanmini k l nasawat ki n go n; yan.Ningudingdac a rndawat mlnawa Nanabucu klwa11awiya20 onondawan plnondagusinit, pri nwanit : "Ko koko^o,Ko koko^o !"nawatcipinat kl n go n ya 8 minawa,aniwucacakucing. Midac mlnawa ani i nat o kumisan :"No kumidide, awiya ninondawa !"I kitu mindimoya:"Anln anwat?"25 Mldac Nanabucu ajinabuwat:"Ko koko^o, ko koko ho.
"How"44 1sound. And when on the next day Nanabushu went tolook after his fish-trap, he then again heard the sound ofsome creature. And after flinging the fish towards theplace where he heard the sound, he recalled what wastold him by his grandmother on the day before. He didnot find itnecessary to run on his way back home. Andso again, when he went back, he went and said to hisgrandmother: "Something again I heard making a noise,on the ground was where it sounded."oThereupon he was told: "Why,a mink was what youruncles of old used to call it. Did you feed it?""Yes,"said Nanabushu."That was proper,"he was told by his grandmother,"Omy grandson!" he was told; "by many creatures, bythe little animal folk, shall we be visited, and you shallalways give them food to she said to him.eat," "Theywill ask you to feed them, for they themselves are alsoanxious for food."Thereupon they say that Nanabushu went again to lookafter his fish-trap. Many indeed were the fishes he slew.And the old woman herself was busy smoking them onnook and corner inside of their home shethe rack ; everyfilled;and she also hung them up out of doors ; quite fullwere the drying-racks of all the fishes that he had killed.And once they say that while they were living (there),again Nanabushu heard something making a noise as itapproached, as it came, it(and) made the sound: "Ko kokoho, ko koko ho!" As Nanabushu fetched more fish, heagain went slipping over the logs along his course. Andso again he went and said to his :grandmotherO my!grandmother something I heard."Said the old woman :did it sound ?"And then Nanabushu mocked the cry:"Ko koko ho,ko koko ho !"
"Mldac!" ini442"O u!" i kito mindamoya."Ko koko ho udinawabamnkicica n yabanlg. Acam," udinan.Mldac kagat Nanabucu aninawatinat kl n go n ya 8 ; pa kicnanlngickat sagisit.Mldac iwiti ajipaginat ka tani tank,5 "Owa,nimicomis !" minawa nayap ajiklwat.Mldac minawa weyabaninig natcipindcibonaganat ; magwadac minawa mamojiginatkl n go n yan, awiya onondawanminawa nondagusinit. Midac minawa nandutank Nanabucu,"M na ,mna ,mnatam. Ml minawa ajinawatcipinat10 ug! n go n rma 8 . Madclba"No kumidide !awiyatod minawa ani i*nat o kumisan :minawa ninnondawa!""Anlnanwat, nojis?"i kitu.tt lMna m na m na inwa.", , ,"A a ,"i kitu rnindimoya ; "piswagunako kokoho udina-15 wabanm kicican yabanlg. Wlwlsini. Awacam," udinan.Mldec minawa Nanabucu aya pina tigu ani u da pinatkl n go n yan, paginat ka tani tank. Mldac minawa weyabaninigminawa natcipindcibonaganat. Minawa magwa mociginatkl n go n yan, minawa kago ini tam. Nanabucu kagwanisag20 kipagisu owa ijipasagipagisu.Mldac minawa nondagusinit"Ha-ha-ha-ha-ha-ha!" O, Nanabucu macl-awiya inwanit :clba tod !wawlp nawatcipinat ugl n go n -i ma ! jjKlwaba tod.inat o kumisan : "No kumidide !awiya nin nondawa,manido !"25"Anlnanwat, nocis?"Ha-ha-ha-ha-ha-ha!mrirnwat."
"What"was443"Oh!" said the old woman. "An owl was what youruncles of old used to call it. Give it food,"she saidto him.And then truly Nanabushu took up some fish;at thesame time he was trembling & with fear. And so he flung othem over in the direction where he had heard the sound."Here, my grandfather!" Thereupon back home againhe went.And so on the next day he went to look after his fish-and while he was at work again gathering the fish,traps ;he heard something again uttering a sound. And now,as Nanabushu listened again, "M, m, m !" the soundmore were the fish he fetched.he heard. Thereupon againStarting to run again he went, saying to his grandmother:"Omy grandmother! something againdo I hear."shesort of a noise did itmake, my grandson?"said." 1M, m, m! was the sound it made.""Why,"said the old woman-,"a fine soft-feathered owlwas what your uncles of old called it. It wants to eat.Go feed she said to him.it,"And so again, as Nanabushu with fear went and tooksome fish, he threw them where he had heard the sound.And then on the following morning again he went tolook after his fish-trap. While gathering the fish, againhe heard another sound. Nanabushu stood up with asudden start, and so brought himself to his full stature.And then again he heard the sound of some creaturescreaming out: "Ha-ha-ha-ha-ha-ha!" Oh, how Nanabushustarted !running speedily more of his fish he fetched.Coming home on the run, he said to his grandmother:"Omy grandmother! something do I hear, a manitou!""How did it sound, my grandson?"Ha-ha-ha-ha-ha-ha ! was the wayit sounded."
" 1Audinan444"A, nojis, ml tcinibuyang!"ojisan.no"Wawlp, kumis, ujl!"tam, klgamadcamin udinan.Anlc kaga t rnindimoya naningiwizit.Mldac wawlp caylgwa wrirmbomat Nanabucu o kumisan.5Midac anat U :, kiga irmbomin," udinan o kumisan.Mldac kagat.Midac ana tojisan: "Nama !"tagumag"Manu, gagu pabamanima kan !"Minawa mindimoyai kito :"Nojis! ningackipitagan nin-10 doni kanan."Midac kaga/t Nanabucu ajapagisut, awinawatinat o kumisanugaskipitaganini. Anawi wmigu Nanabucu mlni l kwlnigu kackiwanat ki irmbiwana,mlclac ima o kumisanukitcaya r kl-a sat o kumisan. Midac klmadciba tod, naga-15 tcinicindang upindcibonaganan. Mlclac Nanabucu madcad,madcinicimut.Mlnangwana win ka i ji U na^kunigavvat andaswawanagisiwatmini kigfu na ta a mwat kPsfon vaii, Midac kra noninto o Jni tam kwlngwlcitci a wiku tasumat Nanabucon.20 Iniwidac o kumisan ugiki kanimani awananen ayawinit,midac Nanabucu ka irndcisagisisik.Panimadac minawa anint pa kan kl a nonawag, kawmuglsagimasiwawan Nanabucon. Midac minawa anint kra/-nonintwa. Mldac awa pajik iskwatc ka ijat midac awa25 sigwaniko ko^o O n kasagimigut Nanabuco midac Ini /u;ka-u-ndcinagadcinicindank uplndcibonagan. Mldac wlnawaklmeyawisiwat anodcigu aiya a wicansag kiwisiniwat iman .
445"Why, my grandson, now are we going to die!" shesaid to her grandson."Bequick, my grandmother, get ready,let us be off!"he said to her.And then truly the old woman trembled (by reason ofage and fear).And so hastily was Nanabushu now going to carry hisgrandmother upon his back. Thereupon he said to her :"Come, let me carry you upon myback!" he said to her.And so that (was what) truly (happened).And then she said to her :grandson "Oh, my dried fish!""Never mind, don t bother about them!"Again the old woman said: my "O grandson! mytobacco-pouch am Iforgetting."Thereupon truly back Nanabushu hurried, as he wentand seized his grandmother s tobacco-pouch. Even thoughNanabushu put as much as he could carry upon his back,yet there on the top (of his burden) he placed his grandmother. Thereupon he started to run, leaving behind hisfish-traps. Now, as Nanabushu started, he began singing.It so happened that an agreement had been enteredinto among the various creatures, as many as there werethat used fish for food. Therefore the first one employedto go scare Nanabushu was the Canada jay.Now, his grandmother knew who they were, and forthat reason Nanabushu was not frightened at first.Then afterwards some others that were different wereemployed, but they did not frightenNanabushu. Thereupon some others were next employed. And the onethat came last was the screech-owl by whom Nanabushuwas frightened ;and on account of that one, he left behindhis fish-trap. Thereuponall the various little animal folkenjoyed the fruits of the labor (of Nanabushu and hisgrandmother) by eating the food there.
"44 658. NANABUSHU OBSCENELY JESTS WITH HIS GRANDMOTHER.Midac klwa 11 ninguting Nanabuco pabimiba tod, kawlnwrka kibisi kasl; ningutingdac klwan anipabimiba tod Nanabuctioganonigon o l kumisan :"Nojic, mwlsaga arm," udigon.Nanabuc kaya win i kito :5 misan."Pa kadiyamn,""Kawln, nojis," udinan, "niwlmlsl,"udinan ojisan.udinan o ku-ima"Migu misln,"udinan o kumisan.Amc, mi win kaga t mindimoya ajimizlgubanan ima.Midac minawa a 11 mindimoya anat ujica n :yanNojis!"10 udinan, "tc iga kwa ani a )^aba ton. Niwra-niuda pinan wfikis!ndima-o*yan,wudigon."Kitoskun kisindima/un,"udinan o ktimisaii.Midac kagat a u mindimoya ajikisindima-irt odoskun.Midac minawa a u mindimoya anat ocisan :"Sagakwang15 ani*i can ; nivvra-nikislya kwisiton nintoskun," udinan ocican yan.Midac minawa Nanabucu anat o kumisan: "Sobandan,"udinan.Amc, mi win minawa ajisobandank otoskun, mldac a u20 mindimoya anat ocican :yan nawatc"Nojis! pang! rkukwanin.""Anic?" i kito Nanabucu."Nlwlskwatciga,"Nanabucu i kito :i kito mindimoya."Kuntan."
"44758. NANABUSHU OBSCENELY JESTS WITH HIS GRANDMOTHER.And now they say that once while Nanabushu wastravelling about on the run, never did he come to a halt;and once they say that when he was running along, Nanabushu was addressed by his grandmother saying:grandson, I wish to go out,"he was told.And Nanabushu in reply said: "Simplyyour buttocks," he said to his grandmother."Nay, my grandson,"she said to him,"Iof relief,"she said to her grandson."Then do itWell,Mylean aside withthere,"he said to his grandmother.haveneedit was so that the old woman relieved herself atthe time in that position. And so again the old womansaid to her grandson: "O my grandson!" she said to him,"by the edge of the woods do pass along as you run.I wish to get hold of something on the way to wipemyself at the anus,"he was told."Withyour elbow wipe your anus,"he said to hisgrandmother.And it was true that the old woman wiped herself atthe anus with her elbow. Thereupon again the old womansaid to her grandson:"Into the thick woods do you go;for, as Igo I wish to clean my elbow with the limbs,"she said to her grandson.Whereupon again Nanabushu said to his grandmother:"Lick it with your tongue,"he said to her.Well, it was the same again, for she licked her elbowwith her tongue, whereupon the old woman said to hergrandson: "O my grandson! just raise your head a little.""Why?"said Nanabushu.want to spit,"said the old woman."INanabushu said: "Swallow it."
59- NANABUSHU FINDS CRANBERRIES AND BIG CHERRIES.Midac kaga tmindimoya ka i jikuntank usi kwagan, mldacminawa kl n wa n Nanabucu anibabimiba tod anip u k :o wlnga ocaylgwa a pidci aiya kusi, mlgu ka i jipimiba tod kljigatinigkaya tibi katinig. Ningudingidacigu anibabimiba tod Nana-5 bucu tibi katiniguban, mlclac kln wa n anandank : "Mimawlncayigwa wasa tagwicinowanan," inandam. Nawatcidaciguanigakipi tciba to ; magwa dac pabimusat, kago uda ku katanan,tibicko asinPsag. Mldac animanak ajia ndotcipitod;mldac ajimi kotclnang, uda pinang."No komis, naska kuca10 owa! Wagunanowa?" udinan.Mldac mindimoya oda pinang. "Maskigimini u ," udinan;"unicicinonmltcinaniwang," udinan. A pidci mamangiminagatiniwan.Mldac minawa madcawad, anipabimusat minawa Nana-15 bucu. Anidatatagi kwanit, kago ubi ta kuskanan uskljigunk;mldecaji a ndotcipitcigat, mmangwana minan. Mldacaji O da pinang, ajiwabanda a t o kumisan, inat :owa?" udinan o kumisan wabanda a t."Wagunanu"O ki tci a, sisawaminan," udinan. "Onicicinon midciga-20tag," udigon o kumisan. "Ml caylgwatci a niandawabandamankadaTndaiyang," udigon.Mldac kagat Nanabucu kra nipagitciwananat o kumisan.Midac kru cigat Nanabucu magwa nangawi mini kang,anindi nlbiwa kago ni tawiging maniwang. Mri ma krir-25 nabandank tcitawat. Mldac ima ka a rndawat.
44959- NANABUSHU FINDS CRANBERRIES AND BIG CHERRIES.And so truly, after the old woman had swallowed herspittle, then again they say that Nanabushu went runningalong at the top of his speed ;ever so tired had he nowbecome, for he had been running day and night. Andonce while Nanabushu was running along,ithappened tobe in the night, whereuponit is said that he thought:"It isplain that I must now have come a long way,"hethought. Slower then he ran;and while he was walkingalong, something he then stepped upon,it seemed likepebbles And so, not making out what they were, hefelt of them;and as he felt of them, he took them up."Omy grandmother, do look at these! What are thesethings?"he said to her.And then the old woman took them up. "Cranberriesthese," she said to him. "Good are they to eat,"she saidto him. Very large were they in size.Thereupon again they started, on his way again wentNanabushu walking. As he went along with his headlifted up, something touched him on the face ;and as hefelt of them, theyturned out to be berries. And as hepicked them, he showed them to his grandmother, sayingto her: "What are these things?"he said to his grandmother as he showed them to her."Why, big cherries," she said to him. "Good are theyto eat,"he was told by his "Soongrandmother. shall younow look for a place where we are to dwell," he was told.And then truly did Nanabushu put his grandmotherdown from off his back. Thereupon did Nanabushu makea camp in among the sand-berries, in where there wasan abundance of various kinds of berries growingin theground. And there he chose a place for them to live.So there was where they continued.29-I UUL. AMER. ETIIN. SOC. VOL. VII.
Kuma456o. NANABUSHU is MADE TO FAST BY HIS GRANDMOTHER,AND REVENGES HlMSELF.kita-Ninguding dac klwa 11 udigon o kumisan :"Nojis,kri gwicim kuca. Ml wlnawa ka/rjitcigawat kicicayabanlg,"udinan.Mldac agut:"Anln dac katijicitcigayan,no^kumis."5 "Klgamadca, nojis, kawm dac klgawlsinizi," udigon o kumisan."Apldac winibayan, nojic, plpagimicin," udigon."Kicpindac tapl tandaman, kigaganonin ima n tclnibayan,udinan."Mlya tagu ima ka irndciki kandainan kaarndcipimadisiyan,"udigon o kumisan.110 Midac kagat Nanabucu weyabaninig ka ijiminigut o l kumisana ka^ka^ a tcimldcit ; mldac kaga t Nanabuc klmidcit,kaya kima kadawlnang pangiuskljink.Anlc mi antotamowagubanan mawija anicinabag kri -gwicimowat.15 Mldac kl n wa n Nanabucu madcat kikicap. "Anigukmadcan, kagu abinabi kan," udigon o kumisan. MldacNanabucu anigu k c madcat. Kabagljik pabimusa, kayapabimiba to aiya pl.Mldac wunagucininig a pidci aiya/kusikaya pa kada. Minawa pimusa uwinga tibi katini kawln;20 owabanda n z!najat.Mldac kaga pl ajiplpagit: "A e 1 nokumis!mla pl oma tcinibayan,!"plonondawan6 kumisan l na kvva tagut: "E eM awas nawatc ijan!"
After"Hey.6o. NANABUSHU is MADE TO FAST BY HIS GRANDMOTHER,AND REVENGES HlMSELF.Now, once they say that he was told by his grandmother :"My grandson, you should indeed go into a fast.That was what your uncles of old used to do,"she saidtohim.Thereupon she was asked: "How, indeed, shall I do it,my grandmother?""You shall go away, my grandson, and you shall noteat food,"he was told by his grandmother."And whenyou wish to sleep, my grandson, call for me,"he wastold. "And if I think you have gone far enough, thenwill I tellyou to sleep there,"she said to him. "It isonly by such means that you can know how youare tolive in the future,"he was told by his grandmother.It was true that Nanabushu on the morrow ate thecharcoal that had been given him by his grandmother ;it was true that Nanabushu ate (it),and he blackened hisface a little.Now, that was what in olden times the people used todo when they fasted.Thereupon they saythat Nanabushu started out in themorning."With allyour speed go, (and) look not back,"he was told by his grandmother. And so Nanabushuwent with all his speed. All day long he went walkingabout, and now and then he was running. Thereuponin the evening he was very tired and hungry. Again hewalked till it was growing thoroughly dark ;he did notsee whither he was going. And then at last he criedaloud: "Hey-yo, my grandmother! in this very place willI !"sleep a while he heard the voice of his grandmother answeringin :reply there ! farther yet doyou go!"
Mldac!"Caylgwa45 2Anlc, nil gaga/t ; Nanabucukagat ki tcra nigu k madclbatod. Mmawa madclba tod a konamut minawa pipagit:"No kumis, ml oma a pl tcinibayayan!"onontawan : "Ee^ awas nawatc ijanminawa5Misa Nanabucu minawa madclba tod anigu k ki tcl a-yanakonamut; wmga aiya kusi. Mldac minawa pipagit:"Mma a pioma tcinibayan?"udinan o kumisan. Wi kagu: "Eoganonigon eM awas nawatc ican!"Mldac Nanabucu nickadisit. "Anim! Anin a kitut l a s a u ?10 Ningakiwa,"inandam. Ki tcianigu k rnadcat. Mldacwayibagu pabiga ugi^kandan paci/ tagwicing andawat.Mldac ani a yat owabandan wasa^kwanamagatinig wlgiwam.7Mldac anandank Nanabucu: "Ningaklmosabama, inandam."Wagunan wandciwasa kunawat ?"kagat kimotc15 ajina n zi t kang andawat. Mldac ajita pabandank, anln kadicinawato^umisan ! Owabaman magwa aminit o kumisan.Mldac ka i ci u da pinanglmi tigons paya tanig kanwa^watinigkaya, mldac ka ijiba kindanag pangi. Mldac ka ijisakisitod ickudank i u mi tig,midac ka/ijipiskanag ;midac20 ka iji-a gwunang omicomisan udiyaning.Midac kai jisa kisut a u a l kiwa n zi;mldacNanabucuka ijikasut ingutci midac 11; nanaga pimisagltciba tod aa kiwa 11 Miclac Nanabucu]!. ka-ijinosawabamat anra- paltonit ka a-niwasa kunanitigu. Wrkadac Nanabucu ki klwa
This"453Well, that (was what) truly (happened); Nanabushutruly began running at the very top of his speed. Againhe began running as far as his wind could hold out, whenagain he called aloud: "My grandmother, in this veryplace will I !"sleep time again he heard her (say):"Heythere! farther yet do you go!"Thereupon Nanabushu again began runningwith all hisspeed just as far as his wind would let him; very tiredhe became. And so again came his voice calling aloud:"Shall Isleep in the place right here?" he (thus) said tohisgrandmother. A long while afterwards he was addressed in the words: "Heythere! farther on shall you go!"Thereupon Nanabushu became angry. Wretch (thatshe is)!What is she saying?I am going back,"he(thus) thought. At the very top of his speed he started.And so in a little while he suddenly became aware thatclose home was he arriving. Upon which as he drewnear he saw that the wigwam was all lighted up inside.And then, thought Nanabushu: "I at her onwillpeepthesly,"he thought. "Whyis she making such a light?"And so truly on the sly did he approach where they lived.Thereupon he peeped in,, and whom did he see but his!grandmother He beheld his grandmotherin the act ofreceiving amorous pleasure. Thereupon, after he hadpicked up a small stick that was dry and long,he thengently lifted the flap of the doorway. And so after hehad lighted the stick in the fire, it flamed up into a blaze;whereupon he placed it against the buttocks of his grandfather.Thereupon was the old man set on fire ; upon whichNanabushu concealed himself in a certain place ;and aftera while out came the poor old man on the run. Andso Nanabushu fixed hisgaze upon him to see in whatdirection he was running as he went in flames. And after
,"udinankrr454andawat. Midac nayagin aniganonat o kumisan :"No komis,nintagwicin.""O u , nojis," udigon. Awidac mindimoya anawigu ogikikanimanojisanka ijictciganit, kawlndac kagokrr kitusl.5 Kaya iwa a pl kisa kawat, kri- kitu au mindimoya: "Nya,ogagwanisagi a n lni x omicomisan !" kitu.Midac kiplndigat Nanabucu, kawln dac po tckra camaslnNanabucu. Midac cigu ka i cikawicimut, mldac ka i nandank:"Magica kiglcap ningatacamik inandampitcinag,"10 Nanabucu kigicakidac udigon: kawin"Nojis, nongunikigatacamisinon. Kayabi klgaTgwicim," udinan.Midac kagat Nanabucu."Paba/a ntuklwusan," udinan. Udigon o kurnisan : ina kakaya, kagu x win iwiti ija udinan.kan,""Iwiti15 Ina kaka Nanabucu ka a ni ijiplskwabamat Ini /u ka pimisagitcisanipan. inandam Nanabucu. "Po tc "Anin!" ningatijaiwiti."Iwiti na patc inaka kaya udininamagontci i cat."Aye8o kumisan. Midac kagat Nanabucu20 ajimadcat ka-i ninamagut o kumisan. Midac anat : "Nokumis! kawin ningatagwijinzl unagucik kicpin kagoni tosiwan,"udinan."Kagu kwlnawlbi i ci kan." Midac kaga tmadcat Nanabucu. Kuma pidac aniyapimicka ani i catina ka kaya ka a-ni-i-jiwasa kunanigiban. Midac anibabi-
455a while Nanabushu returned home. And then, while outside but on the way in, he spoke to his grandmother,saying: "My grandmother,I have come back home.""So Isee, my grandson,"he was told. And thoughthe old woman knew what her grandson had done, yetnothing did she say. And at the time when he burned(the old man), then said the old woman: "Pshaw, he playedsuch a mean trick upon his grandfather!"she said.And now inside went Nanabushu, but nothing whatsoever was Nanabushu given to eat. So then straightto bed he went, and this was what he thought: "Perhapsin the morning she will then feed me," thought Nanabushu. But in the morning he was told: "My grandson,not to-day will I feed you. Longer yet shall you fast,"shesaid to him.And that truly (was what) Nanabushu (did)."Go forth and hunt for game,"she said to him. Hewas told by his grandmother:"Over in that directionyonder, don t you go over there,"she said to him.It was in that direction that Nanabushu saw him goinflames as he went running out of the camp at the time."Wretch!"thought Nanabushu. "In spite of (what I wastold), I will go there."Over in the opposite direction was he shown by thepointing of her finger where he was to go."Allhe said to his right," grandmother. Thereupontruly Nanabushu set out in the direction whither it hadbeen pointed out to him by his grandmother. And thenhe said to her: "Omy grandmother! not will I return inthe eyening if do I not kill he said toanything,"her."Don t become tired waiting for So then me." truly awaywent Nanabushu. Now, at a certain distance he turnedfrom the course he was bound into the direction whichthe other had been seen going in flames. Thereupon, as
udigon"456musat, Nanabucu owabandan wigiwamans pada kitanig ;undaba tani. Midac anicta pabit owabaman cingicininitomicomisan. Winga klpansowan ublwayani pi kwananingka/rna kiswadin. Mldac anicikanonat :Nimicomis," udinan ;"Kibimawatisin.""O", pmdigan, nojic," udigon.Mldac ka gatplndigat Nanabucu.Mldac, "Namadapinima agametasing," udigon omicomisan.10 Mldac kaga/t Nanabucu plndiga t, nanamadabit, pisindawatkagikitonit omicomisan. Mldac ki n wa n Nanabucu :"Kaga tsa mwlniba. Ningakic kiniba,"udinan omicomisan."Niban, nojis,"udinan.Mldac kagat nibat Nanabuco ajikawi tat;kumaa piclac15 kanibat Nanabucu mrajisakinkucikasut. Mldac, "E 1nabucu, kuckusin !"omicomisan.,NacMldac kagat Nanabucu unickaba tod. Medac anat omicomisan :"Nimicomic, mi kuca ki tci a- pwayabandaman,"udinan.20 "Anic, nojic, anabandaman ?"udinan."Awiya kln wa n kiplmiganigunanig,nintanabandam. Wawlngakl n wa n kiki klwi taskakunanig Pwanag. Sasa k.wawagkaya nintanabandam. Mlgu kaga t tcinibuyang, nimicomis."Mi cigwa Nanabucu anotc inanimat omicomisan i u ki a ni-25 -a i kitut. Mldac anat: "NingaTrclta minotc, nimicomis;mi nongum tibi ka l k tcibimawinauguyank," udinan. Midac
457he went walking- along, Nanabushu saw a small wigwamthat was standing smoke was; rising from it. So whendown. Thorhe peeped in, he saw his grandfather lyingoughly scorched was the fur upon his back, according tothe way in which he had burned him. And so he spoketo him as he went (in): "My grandfather," he said to him,"I amcome to visit you.""Why,come in, my grandson!"he was told.Thereupon truly in went Nanabushu.And then: "Sit down there at the other side of thelire,"he was told by his grandfather.And so truly Nanabushu went in, he sat down, (and)he listened to the talk of his grandfather. And then theysay that Nanabushu (said): "Verily, indeed, am Isleepy.I am going to take a nap,"he said to his grandfather."Go to sleep, my grandson,"he said to him.And so truly to sleep went Nanabushu as he lay prostrate;and later on, after he had gone to sleep, Nanabushuthen pretended to be in a nightmare. So then: "Hey,Nanabushu, wake up!"he was told by his grandfather.Thereupon truly Nanabushu leaped out of bed. Andthen he said to his grandfather: "My grandfather, nowtruly was Idreaming of a very fearful he saidthing,"to him."What, my grandson, did youdream?" he said to him."By somebody was I warned that we would be foughtagainst, was what I dreamed. Completely, was I told,have we now been encircled about by the Sioux. Andthey were whooping, such was what I dreamed. Thereforetruly are we destined to die, my grandfather." Alreadynow was Nanabushu entertaining all sorts of evil designsupon his grandfather, in that he kept on with talk. Sothen he said to him: "I will get ready, nevertheless, mycome tograndfather for on this very night will they
"Midac"A45 8Nanabucu kagat krircl tod; kruji tod ubi kwa kon. Midackrirji 4 tod anln wa/totwad omicornisan wa i jisagi a t.Midacminawa anadin : "Apl amaniswayang, notawatwa awiyasasa kwiiwat, kagi/ saga a nkan. Nm ni tam ningasagitcisa5 tcimlgasoyan, km dac pisan pmdik klgataya. Panimadacklgakanonin tcipisaga a man," udinan.Midac kagat.Midac katibi tatinig Nanabucu ka ijisaga a nk. Midacklwi taiya*! kapaba i jimaminslsiwit. Midac migwanan ka i -10 jisasakitclckiwagcimat kipabata kinat. Midac adank omowan: "Pltabanktclkaya r, mitcisasa kwayag," uditan."Aiyangwam,"uditan.Midac kiwa Nanabucu ka 11 iciplndigat,Aiyangwamisin, nimicomis.cornisan:midac anat omiAtcina klganibamin,"15 udinan. "A tawa-a n kaya ickuta,"udinan. Midac Nanabucu aiya/pl sasakinguci kasut."Mlgu, kaga t kanabatcpacu x prai-yawat, pamawina/u-nangwa,"udinan omicomisan.Midac caylgwa tcigaya*r weyabaninig, cayigwa kagatNanabucu omowansan sasa kwamagatiniwan.20 Midac wunickaba tod Nanabucu. n "O nimicomis! nln,ni tam mngasaga a m !"kagat Nanabucu sasa kwatkaya win. Midac ajikanonat omicomisan, a 11 nimico!"mis, pisaga-arn udinan.
"When"459attack us,"he said to him. Thereupon truly Nanabushumade preparations ;he made some arrows. He madewhat he was going to use to scare his grandfather.And then again he said to him :we becomefrightened by the threatening alarm, when you hear somebody whooping, don t you go outside. It will be my placeto dash out to the fight, and you shall quietly remaininside. And after a while I will speak to youto comeoutside,"he said to him.And so ittruly was.And after it was dark, Nanabushu went outside, whereupon all around the place he eased himself, dropping thedung here and there a little at a place. And then all aboutthe place he stuck some feathers which he placed standingupon every single dunghill. Thereuponhe said to hisdunghills: "When it is nearly time for the dawn to appear,then shall all of you whoop,"he said to them."Displayyour zeal," he said to them.Thereupon they saythat after Nanabushu entered thedwelling, he then said to his grandfather:Be onyourguard, my grandfather. For a little while shall we sleep,"he said to him. "Put out the fire,"he said to him. Andso Nanabushu now and then pretended that he was in anightmare. "Now, truly perhaps hard by are they approaching, they who are coming to attack us,"he said tohis grandfather.And then was itnearly time for the morrow to come,of Nanaalready then, indeed, were all the little dunghillsbushu a-whooping.Thereupon up leaped Nanabushu from his couch. "Ooutside." So thenmy grandfather! it is my place to gotruly did Nanabushu also whoop. And then he spoke tohis grandfather, saying:"Allright, O my grandfather!come on out!" he said to him.
460Mldac kagat a a kiwa 11 l n zi wa*a ni rjisaga*a nk, midacNanabucu aja kra- kutaskawat umi tigwabin wfpimwat omicomisan.Midac klpimwat uska tigwanining. Ka/ijinisat,midac klmadclpa kijwat ; kaya kipa kunat. Pangidac a ta5 oglmadclton wiyas kl klwawitot. Midac anitagwicing antawato^kumisan uki a nipagitciwanatawan.Midac mindimoya modcigizit.Midac kactina aji-aba a-nki 11 pimiwanan. A plidac wayabandank wiyas ugilkandanwagunan tind wiyas. Mldac a pidci kaskandank, kawin10 kago i lkitusl.iMldac Nanabucu: "Wawlp klzizan wiyas. Niwlwlsin,"udinano kumisan.Midac kaga/t gagi twan a l ndana kamigisit.Midac kiwlsinit, o kumisan kaya mldcinit wiyas. Midac15 kl n wa n minawa Nanabucu an at o kumisan :wawip ujl tan, klganingunisumin." udinan."NVkumis!Mldac kaga/t ajimadcawat, kagi twanigu a 11 mindimoyaanimadca. Mldac anici Nanabuc nlganlt. Mldac anitagwicing, anln kadijinank uda kiwa^ri mican klnanawicinon !20 Nanabucu win aja krklciwani ka. Mldac anat o kumisan :"Mlwekaya km kapamondaman," udinan o kumisan.Ma kwayanan minawa ucigan.Mldac anicimadcat "MlNanabucu, ijiwajiwani kan,"udinan. Mldac Nanabucu anijimadcat."Mldackaya kin25 wawip pimadcan," udinan.Mldac a 11 mindimoya kaga/t ajiwajiwaniikat. Mldacwawabamat Ini /u awayanan, ml wabamat mamama kizunit
"O"Make461It was true that when the old man was on his way outof doors, then indeed did Nanabushu already have hisarrow on the string ready to shoot his grandfather. Thereupon he shot him in the forehead. After he had slainhim, he then began to cut him (at the throat to bleedhe skinned him. And only a littlehim) with a knife ;andof the meat did he take along on his way back home.And so when he arrived where he and his grandmotherlived, he then laid down his pack.Thereupon the old woman was delighted. And so atonce she untied the pack. And when she saw the meat,she knew what kind of meat it was. Thereupon very sadshe felt in her mind, (and) nothing had she to say.Thereupon Nanabushu :haste (and) cook themeat, I want to he said to his eat," grandmother.And then truly with reluctance she went about her work.And so he ate, and his grandmother too ate the meat.And now they say that Nanabushu again said to his grandmother :my grandmother!quickly make ready, let usgo after our meat,"he said to her.Thereupon truly they set out, and against her desirethe old woman went along. And so Nanabushu went onahead. And when they arrived at the place, what did shesee but her dear old man all cut up in pieces! Nanabushuhimself soon had his pack all done up. Thereupon hesaid to his grandmother: "And this do you also carryupon your back,"he said to his grandmother.It was the bear-skin and the rump.And then away started Nanabushu. "Make your packof that,"he said to her. And so Nanabushu started away."And do you also quickly come away,"he said to her.Thereupon the old woman truly made up her pack.And as she gazed upon the robe, she then saw that itwas burned at the place about the buttocks; and now the
udinan462udiyawinit ina ka kaya midac ki kanimat a u;mindimoyakmisimint unabaman. Animamawi kakimotc.Kaya win dac Nanabucu, kawm udaglpwanawi tosln kakinawin tciklpimiwananatIni /u ma kwan. Anicagu wlpa-5 pinanimat o kumisan ml;ka irndcimlnat tcipimiwinananitIni /u owayanan. Amc, ml kl n wa n Nanabucu win aja pindikayat. Win dac mindimoya pi tclnag anitagwicing. MidacNanabucu anat o^kumisan : "Anin a pl tandiyan? Amc win?"mawija tagwijinslwan o kumisan."Wagunen10 ka-u citoyan iwiti? Intigu kaya kiglma u ajinagusiyan," udinano kumisan."Ka," udigon. "Misaguna a pisi kayan," udig on o kumisan.15"Wawlp ujrtan," udinan; "usklyandaginigan, kaya kiwitaiyar ickutang uskipingwi a ton,"udinan o kumisan."Nlndacningamanise. Agoc kaya au ma kwayan,"udinan."Animi kwagoc, mlnawatc ka/rciminopasut,"udinan o l kumisan.Anicagu wlmrkisumat o kumisan, ml wandci i nat.Midac kagatwawip gagi twan ijictcigat a 11 mindimoya.Anlcina atiso kan, pabiga kri jitciga ka/rnint. Midac minawa20 Nanabucu o kumisan: "Midacijipodawan, tclba kwan,"udinan. "Iwekapimondaman mlwe kagapa udinan.toyan,"Midac kagat a u mindimoya ka i citcigat ka i gut ojisanNanabucon. Midac sasaga a nk a 11 mindimoya owabaman
"Now463old woman knew that her husband was slain. On theway and now and then she weptin secret.And as for Nanabushu himself, he could have found itpossible to carry all the bear in his pack. All he wantedwas to make fun of his grandmother that was; why hegave her the robe to carry in her pack. Well, thenthey say that Nanabushu was soon inside the dwelling.And the old woman too presently arrived. ThereuponNanabushu said to his grandmother: "Why have you beengone so long? Why did you not come long ago?"hesaid to his grandmother."What were you doing overthere ? It seems as ifyou have been crying byof you,"he said to his grandmother.the looks"No,"he was told. "That is how longit takes me tocome,"he was told by his grandmother."Make haste to have (things) ready,"he said to her;a bed"prepareof fresh boughs, and round about thefireplace lay some fresh sand," he said to his grandmother."And Imyself will go and fetch some fire-wood. Andhang up the bear-skin,"he said to her. it"Hang upwith the fur side towards you, much better will itdrythat way,"he said to his grandmother. He only wantedto tease his grandmother, for that was why he spoke thustoher.Thereupon truly in haste (and) against her will did theold woman do it.According to the story, straightway shedid what she had been told. And now again Nanabushu(said) to his :grandmother must you build the fire,(and) cook the meal,"he said to her. "That which youfetched upon your back the same shall you boil,"he saidtoher.It was true that the old woman did what she had beentold by her grandson Nanabushu. And as often as theold woman went out of doors she saw her grandson making
"Noudinan4 6 45ojisan kago minawa ujitonit, kago udockutani ; paga-a- kukwanatig.Midac:"Wawlp,no kumis ! kinantawaniminoma pindik tcipra yayan."A-i ntaci taban agwatcing a 11 mindimoya." 1A U ,!wawlp plndigan Caylgwa o n su kita ki k! Kinantawanimin dac tcinimi kawiyan oma tci 4 kiwi l taiya r skutang,"udinan. "Pa kic klgamamlgwabawana kita ki k,"udinan.Anic, kagi twanigu a 11 mindimoya gaga t ijictciga ka i gutNanabucon ojisan.10 Midac mada*a*masut a 11 Nanabucu, pa l kic aiyaprtcinakpa kita-o wat Ini /u a ki kon kamamlgwabowananitcin o kumisan.Midac kagal t a u mindimoya kiwi tacagamacimut,aya l pi kaya mamigwapowanat lni /u uta ki kon;mldac winNanabucu nagamut. Ka i ckwammi a t Ini /u o kumisantabowadan u i udinan o kumisan.pimide,"15 mri-nat :Midac kagat ki twan ijictcigat mindimoya.Midac kl n wa n minawa anat o kumisan: "Klgi kandanina,no kumis, wagunan madclyan?"o kumisan.20kito i"Kawm," mindimoya.uMi guca iwa kinabam opa kita igan madclyan, ka)pimide kanotabowataman," udinan o kumisan.rii"Nya,awacima win!" i kitu mindimoya."Kaga t," udinan."Klgi kandan na klgri gwicimunkri-ciyamban? Mlna oma a pl tcinibayan kri ninamban ?25 mlwe a pl klwabaminan ka-i citcigayan. Nlndac kasa kawak kinabam udiyang,"udinan o kumisan.
something else, for some object was he whittling ;it wasa drum-stick. Thereupon: "Be quick, O my grandmother!I want you to come in here and remain."Busy at work out of doors was the old woman."Allright, be quick (and) come inside!" Already nowisyour kettle !boiling And I want you to dance for meround about this fire,"he said to her. "At the same timeI want you now and then to shake your kettle,"he saidtoher.Well,it was with much reluctance that the old womantruly did what she was told by Nanabushu her grandson.Thereupon did Nanabushu begin to sing, at the sametime now and then he struck the kettle which his grandmother had shaken (to keep the meat from scorching).Thereupon truly the old woman danced round about thefire, and now and then she shook her kettle;in the meanwhile Nanabushu sang. After he had made his grandmother dance, then he said to her: "Lapoff the grease(from the ladle),"he said to his grandmother.Thereupon truly against her will did the old womando it.And so they say that again he said to his grandmother:"Doyou know, my grandmother, what you are eating?"he said to his grandmother."No,"said tl\e old woman."It is indeed the hammer of your husband that you areeating, and its grease is what you are lapping with yourhe said to his tongue," grandmother."Oh,how disgusting youare!" said the old woman."It is he said to her. "Dotrue," you remember the.time when you bade me go and fast? And when I toldyou, Is it here that I shall sleep? that was when I sawwhat youdid. It was I who set fire to the buttocks ofyour husband,"he said to his grandmother.30 PURL. AMER. ETHN. SOC. VOL. VII.
"?" uclinanudinan.,"466Amc na mindimoya kagwinawrrnabitigu , kawln clackago i kitusl. Mldac Nanabucu ajiponimat o kumisan,kaya win mindimoya kawln kago i kitusl.6 1 . NANABUSHUSWALLOWED BY THE STURGEON.Mldac kl n wa n aTndawat Nanabucu o kumisan kaya.5 Ninguting kln wa n Nanabucu ajinanagatawandank inandam :"Intigasa mlgu nln ka i jipajigowanan,"inandam Nanabucu.Mldac anandank :Ningagagwatcima no kumis." Anlcinaatiso kan, mldac tkaga anat o kumisan : "No kurnis," udinan;"Kawlnklnawint a"mlnagu tagu pimatisiyang?"10 na wl ka mn ningru glsl?"udinan o kumisan."Minaguka ijiplnicipimatisiyano kumisan.Wl ka dac oganonigon, igut:"Nojis," udigon, "mlsagui u kaga kaki tuyamban. Namadabin, naska, kigawlndamon.Pisindawicinwawani," udigon. "Kaga t kra nicinaba ka ;15 mldacigu kl a*nitcatcagiunicinowat, pinic kaya wlnawa !gi /ukimgrrgog katihatwaban kipajigu kaya kisaya nudigon."Kaya win dac klwanicin. Klndac kaya, naska kigawlndamon ka irndcimo^inagusiyan oma dac nongum kra yayan.Awa kisayanmra* u kanigit, rrwitac iskwatc ayamaga k20 anicinabanagitcin wabinigatadaci u ; mldac ajini katag abinotcru-dapikwacimun, ijini kata. Mldac ima km wandatisiyan,nocis. A p! kanigit kisaya11,mldac klsagistcigatag
"467Naturally the old woman then became restless whereshe sat;so she had nothing- to say. Thereupon Nanabushuceased talking to hisgrandmother, and the oldwoman too had nothing to say.61. NANABUSHU SWALLOWED BY THE STURGEON. lAnd so it is said that Nanabushu and his grandmothercontinued living there. Once on a time they say thatwhile Nanabushu was meditating, he :thought IOO am curiousto know if I was the only one," thought Nanabushu.Thereupon he thought:"Iwill ask my grandmother." So,according to the story, he then truly said to his grandmother :"My grandmother," he said to her, "is it possiblethat you and I are the only ones living?"he said to her."Have I never had a mother?" he said to his grandmother."Is itpossible that simply without cause I came into being?"he said to his grandmother.So after a long while he was given reply, he was told :"My grandson,"he was told,"it wasalmost like that,(as you will see from what) I shall say. Be seated, listen,I shall inform you. Listen to me with care," he was told.there were some"Verily, people living; but then as timewent on they gradually passed away one by one, till atlast also went they whom you would call your parents.And there was also one that was your elder brother," hewas told. "And he too disappeared. Now about you,listen, (and) I will explain to you from what source youcame, and why now you are here. After that elder brotherof yours was born, then that which is the last to comewhen one is born was thrown away for it is called a;such is its name. So itplace-for-the-babe-to-rest-its-head,was from that source that you came, my grandson. At1For other versions see Nos. 7 (p. 49), 28 (p. 207), 29 (p. 215).
"468ingutcidac kra wra gotcigata. Mldac nagatc ka i cinontawintapinodcl madwamawit iwitiagotag i u pi kwacimunans.Midac ka/rcrrcayan, mldac ima klmi konan. Midac nmka ijini tawigrrnan," udinan."Kaya win dac kiga kisaya 115 uglni tawigi a*n. Midac ajini kasut au kisaya n i ban Nanapatam.Midac kaya kin ka ijiwlnigoyan Nanabucu," udigdno kumisan.Mldac Nanabucu ki s tcinanagatawantam, kaskandam kayami kwanimat nangwana ki irsaya n- i*t. Midac Nanabucu10 caylgwa klvvawanandank anln wa icitcigat,mldac anato kumisan: "No kumis, mama kata kamig wl ka kago kl -icisiwan iwi nangwana ki-i ciwabisiwangan."Untcitasa kawln kago kiglwlwlndamansinon,"udigono kumisan, "anica itcikaskandaman, kaya tcigwi nawi i n-15 andansiyan," udigon d kumisan. "Pisanigu tcipimadisiyan-,anicigu wabandaman kijik padciwayasayagin , kaya caylgwakisispamo ka a ngin aji o nanigwandagwa k, tci ijiO nanigwandaman.Ml i wl ka ka u l ndcikagcrrnisinowan," udigon/>uo kumisan.20 Mldac Nanabucu caylgwa inat o kumisan "No :kumis,"udinan, "ninganantupanl. Ninganantawabamag awananankanisiguwatnigrrgog kaya nisaya 11 ."Mldac agut o kumisan: "Kagu7, nojis. Ingutci klgatinigaton kl ya 11 ,"udigon.25""Kawln,udinan o kumisan, "po tcigu ninganantawaba-
469the time when your elder brother was born,it was thentaken somewhere out of doors and hung up. And soafter a while there was heard the cry of a babe at yonderplace where hung the little-rest-for-the-head. ThereuponI went to the place, and there I found you. Thereforeit was I who reared you,"she said to him. "Andyourmother herself brought up your elder brother. And thename of your elder brother was Nana patam. And sothe name Nanabushu was what you were called,"he wastold by his grandmother.Thereupon Nanabushu seriously began pondering, sadtoo he became at the thought that forsooth he had an elderbrother. And then Nanabushu straightway made up his mindwhat he would do, and so he said to his :"grandmotherMygrandmother, it is strange that never did you say anythingto me concerning what had actually happened to us.""It was for a purpose that I told you of nothing,"hewas told by his grandmother, "that for no cause youshould be sad, and that you should not be disturbed inyour peace of mind,"he was told by his grandmother."And that inpeace you should live; that you shouldbehold with a feeling of contentment the light of daywhen it comes;and that whenever the sun comes forth,when a sense of gladness pervades all things, you shouldbe joyfultoo. Now, that was why I never imparted anything to you,"he was told by his grandmother.Thereupon Nanabushu presently said to his :grandmother"My grandmother," he said to her, am "I going to war.I am going to seek those who slew my parents andmy elderbrother."And then he was told by his grandmother: "Don t, mygrandson. Somewhere willyou bring ruin upon yourself,"he was told.he said to his "I"No," grandmother, am determined to
"Na,"470mag."Mldac ajimadcat Nanabucu awipisa a nk wrirji todpigwa kon kaya sawanan. Mldac kin wa n pa ijiklwat wayibagumldac agut o kumisan l :"Anln, nojis?" udigon."Kawinkago,"i kitu Nanabucu. "Kawinpigwasasinon5 niwaga kwat. Skuma sipotcigan, no l kumis. Niwl kmibotoncwaga kwat."Mldac kagat a pagisut a 11 mindimoya, klskabak idacnani kibitot sipotcigan mlnat.Mldac ajru ta pinang Nanabucu, mldac ajimaclcra*sipo-10 tcigat.Mldac Nanabucu kuma a pl magwa asipotcigatmmondank agut: "Kos, klga," inwawag sipotcigan."Wagunanwantcrrkitut?" inandam. no kumis undcita"Magicaniwrr k klgagwatcimak,"inandam. Minawa ajimadcipotci-15A pidci Nanabucu nickadisi.gat ml minawa ani^ank :"Kos, kos, kos, klga, klga, klga."xnaska, agwiyan u i wa-kwat!" udinan o^umisan.ga"Anicakuca kidini tam a pana iu ijikijipantaman," udinan."Kawin,"udinan Nanabucu, "anicagu ningagantcigitamigun."Mldac Nanabucu tkaga nickadisit. Mldac20 ajru dakinang minawa sipotcigan. Sipotod waga kwat, mlguminawa agwut:"Kos, kos, kisaya n ,kisaya nudigwan.Mldac ajipasiguntcisat ;mldac ajinawatcipitod waga kwa t ;ajiki tcipapa kit^wat asinin anabitagawaninig.
he"47look for them." So then off went Nanabushu, he wentto seek (for a small straight tree, easy) to split,to the endthat he might make some arrows and some spears. Andnow it is said that on his early return to his home hewas then told by his :grandmother What now, my grandson ?"was told."Nothing,"said Nanabushu."Myaxe does not cut.Please let me have the whetstone, my grandmother.Iwant to sharpenthe axe."It was true that over leaned the old woman, and fromthe meeting-place of the wall and the groundforth a whetstone and gaveit to him.Whereupon over reached Nanabushu, taking it,she drewand thenhe began the work of sharpening (the axe). And so lateron, while Nanabushu was at work with the whetstone, hethen heard that which he was told: "Yourfather, yourmother,"was the sound of the whetstone."Whydoesitsay that?" he thought. "Perhaps my grandmother forsome reason isdeceiving me about what I had asked her,"he thought. Once more as he began using the whetstone,so again he heard it: "Your father, your father, your father,your mother, your mother, your mother." Exceedinglyangry was Nanabushu. "Hark, listen to what the axe issaying to me!" he said to his grandmother."Simply are you hearing the sound of what you arealways revolving in your mind," she said to him."No,"to her said Nanabushu, "simplyam I chided toanger." Thereupon Nanabushu truly was angry. And sohe once more took up the whetstone. While whetting theaxe, then again was he told: "Yourfather, your father,your elder brother, your elder brother," he was told.Thereupon he leaped to his feet thereupon he grabbedand fastened down the axe;he thoroughly poundedit witha stone right on the sharp edge.
","udigon,"4725Midac kagat ki tcrujftad wimadcat; nlbiwa ugrirjitonanublgwa kon osawanan kaya. Anicina atiso kan, kawmtibatutcigatasinon wagunan kayogwan krirji tod ki tci nlbiwaKlubigwa kon kaya odasawanan, u i klklckapitasitod owagakwat; mlya/tagu tabatcirnint kl ; kljllta*i tisut. Midac klwa nlNanabucu ajimadcat. Icta, mlgaya iwa anatcimint !U -ji tod tclman ;kiwlmbikawat mi tigon ; aniginitigu ogri nikukwaton ina.Midac klmawinawat micinamagwan.Midac kl n wa n Nana-10 bucu ajimadcat, pojo a t l c^kumisan. Midac kPwa 11 agut:Aiyangwamisin, nojis," udigon ; "ingutci klgatinikatonklya uo kumisan."Kawin, no kumis, ningatagwicin minawa oma," udinan.Misa 7 Nanabucu cayigwa ajipa kublnang utclnan, madcat1 5 kwaya k ki tcimicawagam ; kaga dac nanawagam tagucing,ml ajiplpagit, nagamut:"Micinamagwatug, micinamagwatug,Wi kwanjicin, wi kwanjicin!"Nagatcigu cayigwa matakamiska ki tcikami;tibicko20 pawftig ajipintciwank, ml a pl^itciwank.Midac kagat Nanabucu anigu k nagamut:"Micinamagwatug, wl kwanjicik!Kmawa katcaki a gwa nimgri-gog, kaya nindac wl kwanjicik!"Pitclnagigu ka i*ckwai c kitut, mi cayigwa wabamat mici-25 namagwan wl kwanigut. Ni tamigu kagicipa a botani i utclman, midac anijikuntaya bosut, anigumigut micinama-1Pojo a t, "bidding farewell to . . .used in Ojibwa to greet or to bid farewell.a verb from the French bon JOTII-,and
473Thereupon truly was he fully prepared to go ;arrows and spears had he made. So far as the storymanygoes, it is not told what he used when he made the greatnumber of his arrows and spears, for he had dulled hisaxe;it isonlytold of him how that he had made himselfprepared. And so it is said that Nanabushu started away.By the way, this too was what was told of him ! Hemade a canoe he hewed it out of a; log the measure;of himself was the size he made it,so it is told of him.Thereupon he went to assail the Great Sturgeon. Andso they say that Nanabushu set out, bidding farewell lto his grandmother. And then they say he was told :"Becareful, my grandson,"he was told; "somewherewillyou bring harm upon yourself,"he was told by hisgrandmother."No, my grandmother, I shall return again to this place,"he said to her. And as Nanabushu now shoved his canoeinto the water, he proceeded straight out to sea;andwhen almost at the middle part of the sea he was come,then he cried with a loud voice, singing:"Oye Great Sturgeons, O ye Great Sturgeons,Come one of you and swallow me, come one of you and swallow me !"And in a little while was the sea set in motion;likerapids when the current is strong,waves.Thereupon truly Nanabushu sang aloud :so was the flow of the"Oye Great Sturgeons, come swallow me !Ye that have slain my parents, come swallow me too!"As soon as he had finished speaking, then immediatelyhe saw a great sturgeon coming to swallow him. At firstround in a whirlpool spun the canoe, and then down intothe water he was drawn, swallowed by the Great Sturgeon,
""Kawasa.am474gwan, kigitclman.A lpanagu kiwa n kasaswanik u tawagan;minawa mi kawit, plndagiya11kl n go n yan aya. Midac pisanayat iwiti ;mldac klwa n caylgwa ki^kanimat lni /u kl n go n yananimadclnigut.5Midac a s a /u ugimaki n go n kiwat andawat anamiplg anawaya-rki tcigaming. Midac ki n wa n madwaki st tcisagaswa-i tiwat,madwaki s tcikaya animi tagusinit ; mamayawanitki kumint.i uNingutingdac ki n wa nmagwa nantutank, kago owabandan10 Nanabucu picagiwlnigut. Anicina atiso kan. Amantc ajiwabigubananNanabucu owabandan kl n wa n kago!picagibitanig,mlnangwana a 11 micinamagwa uda panga a ninik.Mldac ki n wa n ba l ka acimamatclt nani kinank udasawan;mldac ajipa pacipa a nk. Mldac klwa n nagatc nontawat15 madwa i- kitunit : "Ata, kagatsana nimacita lMidaca*."madwa/rcinantutamawat wlwan tcimina igut kago ka u n-Mldac cayigwa anuwfkwutod tcicicigaguwat,dcicigaguwat.kawin dac ugaski tosln. Midac madwa*i* l kitut :"Kawasa,Nanabucu nimani kag,"i kito.20 Anawi kagat ki tci a no kl Nanabucu tcicacigaguwanasiwint;mi ka/rjipimida kwanang umi tigwabln, mldac Ini /umantcima kwltNanabucu.Mldac minawa micinamagwa a kitut :nikagNanabucu,Nimai kitu. Mldac waylba klnibut, klnisat25 Nanabucu. Anic anawi ka kina mini k wada towat klwi-1Nimacita a-,"I "I am sick at heart," perhaps too literally rendered;qualmish"is nearer the sense.feeling
475canoe and all. All the while they say there was a hissingsoundin the ears,and when he recovered his wits, insideof a fish he was. Thereupon quietly he remained there ;and they say that now he knew that the fish was carryinghim away.And so the chief of fishes returned to the home underwater on the floor of the sea. And now they say that(Nanabushu) heard them holding a great smoker amongthemselves, and he also heard them holding forth withmuch talk; they were giving thanks for that he wasswallowed.Now, once they say that while he was listening,something Nanabushu saw that caught his attention. Well,on with the story. Wonder how he could see !(Nevertheless) they say that Nanabushu saw something in motion,and ithappened to be the heart of the Great Sturgeonthat was beating. Thereupon they say that softly hemoved (and) pulled out a pointed arrow;and then hethat in a littlebegan pricking it. Whereupon they saywhile he heard the voice of him saying: "Oh, truly indeedbut I am feeling sick at heart." l And then he heard himto makeasking his wife to give him a drink of somethinghim vomit. And so presently did he begin trying tovomit, but he was not able to do it. And then he heardhim saying: "Impossible, for Nanabushu ismaking mesick at my stomach," he said.True was it, indeed, that hard worked Nanabushu tokeep from being cast out so then crosswise he; placedhis arrows, and so by them he held on.Thereupon again the Great Sturgeon spoke: "No hope.I am in distress inside on account of Nanabushu," he said.And so in a little while he was dead, him had Nanabushuslain. Even thoughall that were living there had come
" 1AMldackundiwag tciwrpimatcrarwat otogimamiwan, anlc kawinanlc awiya kadicipitnatisit uda klpigiska i gatanig Mldac?ka irntcinibunit.Mldac win Nanabucu, ima ayat.5Mldac kagatkitcfrcictcigawat manido kasuwat. Anlcaja klnibu ki l tcikl n go n . Mldac ki n wa n wa-rjipagidanimawat,anawi kinwa n j ugl kanawanimawan ; magica ta a bitclba,klinandamog. Mldac intawatc ki n wa n caylgwa pagidanimawat,nawatc nawitc anti a pidci timlyag ki tcigami mrrmaip awipagidanimawat. A pidci ki tcimanido kasowag.Ka kina dac win Nanabucu ugi kandan ana kamigatinig,win dac kawin awiya ugi kanimigusm ima ayat pimadisitkaya. Ugi kanimawan krkumimint, kawin dac win ugi k-animasiwawan pimadisinit. Mldac ka i-ckwapagidanimawat,15 klpiklwayawanitlwat minawa. A pidci klpa taylnowag, miziwaanigu kwagi u ki tcigami krirndciwag kra wipagidanimawatutogimamiwan.Mldac ki n wa n win* Nanabucu andajiwawanandank anlnkatijikaski tod tcisaga a nk ima plndcaya-r kln go n ying kaya20 klningwa O mint. Mldac caylgwa Nanabucu ki kandankanln kadodank, mldac a kitut U : ambasino tawlki s tciijiwabak wrka ka i !",jiwabisinuk Nanabucu kisaguswa-at nlwing inaka kaya wandabinit manito 6 .Mldac klna kumigut. Mldac kagatka*ijiki s tcinodink,25 ka kina kago klpa kudamika a n ima klki s tcigaming inamaya-ra tagini. Mldac kaya win Nanabucu, klmonatawangai ninig iima ayat; mldac a 11 kl n go n ka/i cru-ki tciblskat.
477together by invitation for the purpose of bringing theirchief back to life, [but] (it was) not (to be) ;for how couldany one live with his heart cut to pieces? And that waswhy he had died.And as for Nanabushu, there he remained.Thereupon truly they were doing wonderful things asthey conjured for a miracle. It was no use, for alreadydead was the greatfish. And so it is said that they weregoing to bury him, for really a long while had they kepthim; perhaps he might come back to life, they thought.And so accordingly they say that when they were buryinghim, farther out upon the sea, where it was deep, they wentto bury him. Ever so mightily they conjuredfor a miracle.Now, Nanabushu knew everything that was happening,but yet by no one was it known that he was there andalive.They knew that he had been swallowed, but yetthey did not know that he was alive. And so after theyhad finished burying (the chief of fishes), then back theycame together to their home again. Exceedingly numerousthey were, from every part of the sea had they come tobe at the burial of their chief.In the mean while they say that Nanabushu had beenthinking out a plan how he might succeed in getting outfrom the inside of the fish which now was also lyingburied. And so, now that Nanabushu knew what he woulddo, he thereupon said: I"Oh,would that there rise amighty storm the like of which there has never been before!"Whereupon Nanabushu made a smoke offering toward thefour directions where sit the manitous.And so his prayer was answered. Thereupon truly thererose a mighty wind, everything that was on the floor ofthe sea came to the surface by force of the waves. Andas for Nanabushu, the sand (of the mound) where he hadbeen was washed away and then afterwards the fish came;
!"" lA!" udina478Midasugun kiki s tcinudin, mldac minawa ka/ijiki tcra/nwatin, mldac klmockantcit a u micinamagwa.Midac ningutingigu Nanabucu ayat ima anamaya i-kl n go n ying onondan kago a pitcimino tagutinig; mldacof"(cry gulls)."A pidci mino5 ajra/ntutank, mranitank :kayaskwag. "Amba,"tagusiwan awiya ; mlnangwanamldac anandank Nanabucu, "ningakanonag,"inandam.Mldac kagatcayigwa minawa onondawa 8 pldwawinaminit,migu minawa pa nwanit i : of"(cry gulls)."Mldac ajika-10 nonat :"let,niclmisa !Tskumana pagwanatcigananandamawiciyuk au k! D go nMldac kayackwag ajipasigwa O wat, kaya aninondagusiwatkagwanisaka kainig ani tagusiwat. Mi Nanabucu ka i cinawatinanginu tawagan, ka rjiki pi tanitisut. Nagatc dac15 minawa kra/ndutam, inlc minawa kl kandnat :pagwanatcigananandamawiciyu k a 11kl n o-o n" 1AU , niclm, 2c.Midac kagatajipisanayawat.Minawadac uganonan:"PagwanatciganandamawiciyLrka 11 k! n go n !" uclinan."Mackut klgasasaga-i ninim."20 Midac kayackwag ajikanonitiwat:"Nanabucu ima aya."Ka kinaguta awiya klki kanimigon au Nanabucu. Mlcminawa ajikanonat u :, niclmitug, pagwanatciganandamawiciyuk. Mackut klgasasaka rninim ; nlgan wanicicitpapamisat klgaticru*nicicrrnim," udina 8 .Niclmisa, "O my younger brothers!" the ending -isa occurs in story, and usually1in the mouth of Nanabushu.2Nicim, "my younger brothers," a vocative singular noun rendered by the plural :a common construction.
"479to the surface of the water. For ten days the wind raged,and afterwards there was another great calm, whereuponto the surface (came) the Great Sturgeon.Now once, when Nanabushu was inside of the fish, heheard something that sounded very pleasantly; and as helistened, he then heard: "(cryof gulls)." Very pleasantwas the sound of the creature;it turned out to be somegulls. "Well,"thus thought Nanabushu,"Iwill speak tothem,"he thought.It was true that soon again he heardthe sound of them coming hitherward, whereupon againthey came with the cry: of"(cry gulls)."And then helsaid to them :Hark, O my younger brothers ! Pleasepeck an opening for me into the belly of this fish!"Thereupon the gulls flew up and as, they went, theycould be heard uttering a frightful cry, for such was thesound they made. WhereuponNanabushu seized his ears(and) closed them with the hands (to keep from hearingthe din). And in a little while again he listened, whereupon again he spoke to them, saying: "O my younger3brothers !peck an opening for me into the belly of thisfish!" he said to them.became silent.Thereupon truly theyAnd so again he spoke to them,"Pecksaying: anopening for me into the belly of this fish!" he said tothem. "In return I will adorn you."Thereupon the gulls spoke one with another, saying:"Nanabushu is there."Indeed, by every creature was Nanabushu known. Andso again he spoke to them, saying: "Come, my youngerbrothers, peck an opening for me into the belly (of thisfish). In return I shall adorn you ; as beautiful as thecreature of the air that surpasses (allothers in beauty) ishow beautiful I shall make you,"he said to them.
""," udinan,"480"Kawln kuca nindakaskra/siwanan," udigo8..Awa /u "udina 8 .!"Klgakaskra/waMidac kaga tajimadci tawat pagwanatciganamawat; wl kadac ogackra/wan. Midac Nanabucu ka*rjisagitdtat, kaya5 isagitci tabatank utciman mi tigon kawlmbigawa pan. Midacpitclnag wawani wabamat lni /u micinamagwan kagumigutanigininit ; intigu minis agundak ajinagusinit agwantcininit.-ji-Midac ka u da i ji pinat pajik !ni /u kayackwan midac ka*i;wawacra t. Midac ka iciwapicki a tibicko t, koning klcra t.10 Midac ka i nat :nia klwang.""Kin win kayask kigatani i-jiwlnigotci a--Midac kagat kistciminwandank wabandisut a u kayaskajiwunicicit.A u"midac ijipazigirryu k."15 Midac anicina atiso kan, miya tagu paji k tagimimintkru da pinat kayackwan. Midac a potc ka*ijiTrnicicivvatka kina mini k a pl ka kina pasigo O wat. Midac Nanabucuka rjimadci tat klpigickicwat Ini /u kl n go n yari.Midac a plka*i*ckwananawijwat, ml kri^kitut kaya pa kic kiziswawa-20 binat n : "Klgo n klgatanijiwmigom tci a-ni-a- klwang. Klga-Kin dac,"tamuguwak kaya anicinabag tcra-nra^kiwang. - -udinan micinamagwan: "Kawin minawa wi ka klgatiniginisltcianra^klwang, kawln awiya tapimadisisl,"udinan. Midackaga t ka ijiwabatinig kln go n yansa s ki tcinlbiwa krirndci-25 Trci a t ima micinamagwang.Midac Nanabucu ajikiwa-ut nantawabamat o kumisan.Anitagwicingidac omi kawan o kumisan a pidci kawanda-
"You"Wesurely could not (make an opening into) him,"hewas told."Yea, (you can)!"he said to them. "You can do it!"Thereupon truly they began pecking an opening into(the fish) ;and after a long while they succeeded. Andthen afterwards Nanabushu crawled out, and he drew outhis canoe which he had hewn from a log.And then wasthe time that he took a careful look to see how big wasthe great sturgeon which had swallowed him;like anisland afloat upon the water was how it looked as it layupon the deep. Thereupon he took up one of the gullsin his hands;andthen he adorned it. And then hewhitened it, (white) like snow he made it. Thereupon hesaid to it :shall be called a gull from now till theendof time."It was true that exceedingly happy was the gull whenit looked uponitself and saw how beautiful it was."Now, then,"he said to them, "now fly away!"Now, according to the story, there was mentioned buta single gull that he took upin his hands. Yet nevertheless just as beautiful were all the rest when theyallstarted to fly away. And then afterwards Nanabushubegan cutting up the fish with a knife. And so when hehad finished cuttingitup, then he said, at the same timethat he was flinging the pieces in everydirection: "Fishesshall you be called till the end of time. And you shallbe eaten by the people till the end of the world. - - Andyou,"he said to the Great Sturgeon,"neveragain solarge shall you be as long as the world lasts, else nobodywould ever live,"he said to him. Therefore it truly cameto pass that he created little fishes in great numbers fromthatGreat Sturgeon.Thereupon Nanabushu paddled home in his canoe tofind his grandmother. And when he got there, he dis-3! PUBL. AMER. ETHN. SOC. VOL. VII.
482minit. Mldac anijita pabit, mic anat: "No kumis, nintagwicin,"udinan."A 1 , wagutugwansa pana wandclciwagwanu ku, aya avvacansag!"5 "Kawln, no kumis. Nm kuca, Nanabucu, kojis, patagwicin."Midac anijiplndigat.Mldac owabamat o kumisanagawa onsabinit, a^pana I dug klmawinit. Mldac Nanabucua pidci cawanimat o kumisan. Mldac nawatc ka ijia n-tci u-skinlgi a-t.62. NANABUSHU SLAYS HEWER-OF-HIS-SHIN.10Midac awe mindirnoya ki tciminwandank wabamat minawaojicayan.kra ndci u skinlgiint.Mldac anat ojisanwjicayan. Kawm dac wmigu ugi kandan zm pangi nawatc: "Panaawiyaninglpi U disigok ; ijiwat kinisigoyan. Minawa anint intigog,No kumis, nintagwicin, undcita pljiwat,"udinan ojisan.1 5 Midac Nanabucu niskadisit, midac anat o kumisan :"Kayabi klganaganin. Kawln maci nimi kawasl awananltugtcagi a gwan ningitislrnag.""A 1 !nojic," udinan, "klglkitimagis.Kawln kitakaski o sltcri jayan iwiti ayat a 11 kaklwuci i- k,"udinan.20 "Anticayat?""Mrrwitiayamaga k nawayaT ki s tciki s tcigamlnk paji kkminis. Kawindac wi ka awiya ijasliwiti.Migu apisi katawiya acatcin. Kawindac ki kand^zln amantc tcitagwici-
icovered his grandmother grievously sad in her thoughts.And as he peeped into the lodge, he said to her: U O myI have now come home," he said to her.grandmother!"Oh, I should like to know why they continually saythis to me, these little animal-folk!""Nay, my grandmother. It is really myself, Nanabushu,your grandson, who has now come home." And theninto the lodge he went. Thereupon he saw that his grandmother was barely able to see, (showing) that perhaps allthe while she had been weeping. And then afterwardshe had made her younger.62. NANABUSHU SLAYS HEWER-OF-HIS-SHIN.Thereupon the old woman was very happy to see hergrandson once more. And not at all did she realize thatshe had been made younger. So then she said to hergrandson: the time some "All creatures came to me here;they told me that you were slain. Again by some wouldI be told, O my grandmother!I have come home.With some design they came speaking thus to me,"shesaid to her grandson.Thereupon Nanabushu was angry, and he said to hisgrandmother:shall I leave"Againyou. Not yet haveI found the probable ones that must have slain all myrelatives.""Alas!my grandson,"she said to him, "youare tobe You pitied. may not be able to gothe one who made you an orphan,"she said to him.there where abides"And where is it?""Atyonder place in the centre of the great sea is anisland. And never has any one gone there. And hegoes for good whoever goes there. I don t know whether
"Mimawin!"udigon","4 8 4ajininowagwan iwiti, kunima gaya nowanda nibowagwan," udigono kumisan. Midac iwiti ayat a manido kasut Katcl-;kika arnk-uka kwan, mra*nint mi a pana ajitcigika*a nk i uuga kawan, ina. Klcpin awiya ijat iwiti ayabi ta iji a wang5 mitabwawa-a-ng uga kwan,"udinan."O nojisan.Mldac kagat kicandank Nanabucu,inandam wrijat. Mldac anat o kumisan : "Po tc ninganatawabama,"udinan. Mldac Nanabucu minawa ka i ji ujrtadminawa kru*ci tod usawanan, nisugun mini l k tci a batci tod10 ugrrjruji tonan. Mldac ka kici tpd minawa Nanabucumamadasitot utclmanic. Mldac madcat Nanabucu kwaya kka*i*ninamagut o kumisan. Ninguting dac klwan Nanabucu15:anibabimiskat, cigwa kaga t kago onondam kwaya k iijat.Aji agwamut andutang ; cigwa kaga t onondan. "Ta 11 ta nini tam. Mlc anandank "Na mri we no kumis ka/ijit,"x!inandam. Mldaclkagat madcat anigu k. Nanabucu kumapil cminawa nandu tam cigwa minawa onontam. "Twa ntwa n ,tvva n ,";ini tam. Nawatc pacutagwatini. Minawamadcat anigu k.20 Ningutingigu minawa anra-yinabit, kagoowabandan uniganimi; intigu kago pamipacibri gatag midac; aylnabit,4 8 /u icaylgwa tayabinagwa k minis ajayan,"inandam. Midac kagatanigu k pimiskat. Kuma pidac1Uttered with a slow, deep, nasal voice.
,","they have ever arrived at the place, or if they died onthe way,"he was (thus) told by his "Andgrandmother.over there is a manitou;he is called Hews-upon-his-Shin,for it is said of him that ever is he hewing uponhis shin.It is said of him that ifany one should go thither, thenat half way to the placemakes uponhis shin,"she said to him.would one hear the sound he"Really!"was she told by her grandson. Thereuponin truth did Nanabushu make uphis mind, he thoughtthat he would go. And so he said to his grandmother:"Determined am I to go look for him,"he said to her.Thereupon Nanabushu again made ready by making spearpointedarrows, enough to last him three days was thenumber he made. And so after he had finished them,then again Nanabushu put his canoe in order. And thenaway went Nanabushu straight towards where it had beenpointed out to him by his grandmother. Now, by andby, they say, as Nanabushu went paddling along (in hiscanoe), presently something he truly heard straight (on theway) whither he was going. He let his canoe go floatingquietly along upon the water while he listened to thesound-, presently he clearly heard a sound. n "Ta ta n l,(such) was the sound he heard. Thereupon he thought :"Hark! that is what my grandmother told me,"he thought.And so truly he hurried on. Nanabushu later on againlistened for the sound, presently again he heard it. "Twa n ,twa n ,twa nlwas what he heard. Nearer it now sounded.Again he hastened on.Another time, as he was looking about, he saw something in the way ahead of him ;it was an object like aline drawn across his course; and then, as he looked,"Perhaps that which is now cominginto view is the islandfor which I am bound," he thought. Thereupon he trulyhastened on with his canoe. Farther on he listened again
mldac"A,"ini486minawa andu tam, migayapi ani tang. n "Twi t\yi n ,"ini tam.LMri ma gwaya k andanitang pimidepinagwatinig a ki.Mlnangwana kaga t iu ka/rjinang. Midac minawa madcat,caylgwa owabandan wawani a l ki;mldac minawa ajia ndu-5 tank, ml minawa nondank. "Twi 11 twi n tam. Mlguajikuckwagamisag nibi apitcikiciwaganadank u i uga kwana u manido.Mldac kiwa n Nanabucu caylgwa anitcagisat ima kwaya kandani tank; kaga t anigabat owabandan undamuninik mi-10 l kana. Mldac anijiku pa a tod, owabandan wlgiwamansnpata-,kitanig klmotc anijina sickang ; anijita pabandank,owabaman a kiw^zlyan nananganasamapinit, mldacta kunaminit kago. Mldac ajiwabamat pa ki ta a/minituga kwan, tibicko-tclgiga gang mra s ndotank. Gagwani--i1 5 saka kamig dac apl twawakanandank. Mldac win Nanabucu,ima nibawit kanawabamat.Kuma pidac pigwa kitawan mldac agut:2"A-a-a l a a ,Nanabucu! kipinantupanltawina?" udigon.,"s"Ayeudinan Nanabucu.20 "Awawasa!" Pa kic l lpa pi kasut, apltcimanimat Nanabucon;kawin klwatanda n zl tcicagotci a t.Midac kaya winNanabucu,a /u , wawlp!"Mldac kagatplwananglt, pipasigwit kaya ;midac ajipi-1Uttered with a slow deep nasal voice.2 Kumatpidac pigwa kitawan midac agut,"after a while the other turned about
At,"for the souad, and he heard it the same as before. "Twi 11 ,1was the sound he heard. Straight from yonder placetwi","where the land was coming into view he heard the sound.It turned out truly to be (the island) that he had seen.And now, as he continued on, he presently saw the landin plain sight ; thereupon again he listened, and then againhe heard the sound. n "Twi twi n lwas what he heard.,And then the water trembled, so loud was the manitouhewing upon his shin.it isThereupon said that Nanabushu now drove hiscanoe straight for the place in the shore from whence heheard the sound come as he went ashore he saw;trulya path leading away somewhere. And as he followed itup from the shore, he saw a small wigwam standing ; andso secretly went he up to it; as he peeped in, he saw anold man seated in a squatting pose, facing him, and hehad hold of somethingin his hand. And as he watchedhim striking uponhis shin,it was like hewing upon a log,such was his manner of doing And it. frightful was thesound that he made when he struck. And as for Nanabushu, there he stood observing him.After a while the other then turned about, and said :"Aha, aha, aha, Nanabushu! Have you come to makewar uponme?" he was told.to him said Nanabushu."Yes,""Very well, then !" the same time he made a pretenceat laughing, so deep was his contempt of Nanabushu he;had no doubt but that he would prevail over him.And as for Nanabushu, too, "Come, make haste!"And so, in truth, up he slowly rose from his couch, andup he rose to his feet ;andthen he came out of doors.2and said." This is a very free rendering. A closer translation would be: "After acertain length of time by the one that turned about and looked up at him, hewas told" . . .
udinan.""E!"488saga-a-nk. "Amc, klga O nabandamin kadajiku tadiyang,"udigon.a4A aV udinan.Midac kagat wawanabandamowad. "Mro i ma," kitowag.5A nabi iTcagaka a nk-uga kwan. Tatataganabit kaya winNanabucu kru; wanigabawi, udacwlwin ta kunam, mi tigwabmkaya. Win dac Tcagaka a nk-uga kwan, uda kunanasinm atpagamagan. Midac cigwa kanonitiwat, Au Dackaga Nanabucu t kaya win u pimwan, kaya win dac Tca-10 gaka a-nk-uga kwan pa kitawan upagamigan. Midac kagii tki tciudcanimri tiwat. Nanabucu kagagu miya ta anano ki ttabazit, kaga t udotcanimrrgdn. Midac kaya win Nanabucu, papimwutcigat. Magwa dac cigwa ki tci pa pinlkutatiwat,kaya win Nanabucu caylgwa aga n sinadiniwan15 udasawanan. Magwasagu Nanabucu awiya onondawanpipagimigut icpiming ina kakeya,:igut , Nanabucu,udcickipunwaning pimwi!"ini tam Nanabucu. Nana kawecpipagi kaya win:n"Wa !" i kitu Nanabucu.1"Udcickipunwaning pimwi!"20 Midac agut Tcagaka-a-minit-uga kwan :Awanan kanonat?"udigon.Anln, Nanabucu?"Nanabucu dac i kitu : A-a-a-e 1 ,aga n smawagna nicPmayagckljigunk?"sayasldwabamiwat Midac kagat Nanabucu ajipimwat mi /u Tcagaka afminit-uga kwan ima ka*i-nint25 tcipimwat, anza pitanig upi kwanang winisisan ;mldac ajimijwat.Midac agut: "Wa, Nanabucu, mmangwana kinkaga t wmiciyan?" udigon.
was"4 8 9"Well, let us pick out a place where we are to fight eachother," (Nanabushu) was told."All he said to him.right,"Thereupon they truly sought for a place."Here is aplace," they said. Round about looked Hewer-of-his-Shin.And up into the air looked Nanabushu;he stood in hisplace, his shield he carried, so too his bow and arrows.And as for Hewer-of-his-Shin, he held in his hand a warclubof stone.Thereupon they now addressed each other,saying: "Ready!"And truly Nanabushu then shot at him,and then in turn Hewer-of-his-Shin struck him with hiswar-club. Thereupon exceedingly hard at work they trulykept each other. Nanabushu nearlyall the while wasoccupied in dodging the blows, truly was he kept stirringby the other. And as for Nanabushu, he too was activewith his shooting. While they now were in the thick oftheir fight with each other,then the supplyof Nanabushu spointed arrows began to run low. And in the midst (ofthe fighting) Nanabushu heard the sound of some onecalling out to him from above, saying: Nanabushu!"Hey,at the scalp-lock shoot him !" the sound Nanabushuheard. Though busily engaged, out he also cried :said Nanabushu."At his scalp-lockshoot him!"Whereupon he was told by Hewer-of-his-Shin :"What!"What(is the matter), Nanabushu? With whom are you speaking?"he was asked.Nanabushu then said: "Ah, few do you think are mylittle brothers of the sky who me?"protect he said to him.Thereupon truly Nanabushu shot the Hewer-of-his-Shin therewhere he was told to shoot him, there where his hair wastied in a bunch at the back, whereupon he hit him (withthe arrow). And then he was told: "Alas,O Nanabushu !is it true that now you really intend to kill me?" he was told.
!" udinan."4QO"A n -a n -a n -a n -a n"Minanga kipapa pinrrn!"udinan Nanabucu. Minawa pimwadin udcickibanwanining.Mlcru minawa nasab asfiit:"Wa, Nanabucu! minan^wanao o oklnigu kaga t wlniciyan?"udinan.15 "Mlnanga kito Nanabucu. ka!" i "Km kanisadwa mgligog," udinan, "kayakm dac kiwmisin!" udinan. Pa kicNanabucu a^rndanwawa to kaya bapimwutcigat. Midaccayigwa kawinawat. Midac agut minawa: "Ml, Nanabucu,!ijiponrrcin Maskut kago klgamlnin."10"Wawipmicin!"udinan.Windamawicin kaya anmcli15>katotawatwa nos ninga kaya ga kina kaya pamadisiwa pan!"udinan. Midac kaga tagut: "Kiwabandan na owa nongunandaclku tadiyang mimis? Ingiwidac mi tigog wayabamatwapata kisuwat mi i gi /u pamadisiwa pan. Midac iwe ka/rci-73Lgw^ tcimi tigfri wat," udigon. "Klcpindac poni i-yan,klgamlnin kadabatci toyan tciabitciba a wa," udigon."WawipWindamawicin anln katotaman tcra-bitciba*i -wayan.""Imaijan pindik kapi u ndcipasigwlyan, klgawabandan20 ima mi tiguma^ka kons, pidon dac oma n ."Midac kagat Nanabucu na n zi kank kawin t;kaya upagitinaslnumi tigwabln. Midac agut: "Kiwabandan o a tagoma n ma ka konsing, mi tiguma ka tonsing ;mi oma n a tag1Minanga kipapa pinH-n ! "You surely do not think that I am merely triflingwith you!"More literally: "Why,of course I am making fun of you!"But thesense is better with the freer rendering.
he491"Ah!" he said to him. "Yousurely do not think thatI am simply with ltrifling!"you to him said Nanabushu.Once more he shot him in the crown of the head. Whereupon again the same thing he was told: "Alas, O Nanaslayme?"bushu! is it true that surely now you mean tohe said to him."Of course!" said Nanabushu. "You who slew myparents,"he said to him, "youtoo shall Islay!"he saidto him. At the same time that Nanabushu was talking,he was all the while shooting. And then presently hebrought him down with his shooting. Thereupon he wastold again: "Now, O Nanabushu, do leave me alone!In return something will I give you."and"Hurry giveit to me!" he said to him. "Tellme,too, what you did to my father and mother and to allthose who used to live in times past!" said to him.Whereupon truly he was told: "Doyou see this islandwhere now we have fought each other? Those trees thatyou see standing are the same as they who used to livein times gone by. Such is the form I have made them,that they be as trees,"he was told."Now, ifyou leaveme alone,I will give you something to use to make themcome back to life again,"he was told."Make haste and tell me what I shall do to bring themback tolife!""Goyonder inside to the place from whence I rose tomy feet, and youwill see there a small wooden pail ;andbringit here to me."Thereupon Nanabushu truly went to fetch it;but hedid not lay aside his bow and arrows. And then he wastold: "You see what is here contained in this small pail,in this small wooden pail ;there is contained here the
"U"492ka/irndcra badciba a t kos klga kaya," udinan,anint pa kan. Midac kadotaman :klgabasagwaminawa11kuwa ami tig pmic tciwabamat mi tiguwit ; midacmi tigons katijitcakinaman o^o oma 11 ma ka konsing a tag ;midac katiji-5 cico a-man ima klpaskanaga kuwat au mitig,"udinan.11! mmagakina?" udinan."Misa"ga kina."Midac minawa ajipimwat udcickibunwanining, midac nisat."UwaM" udinan. "Anim 1 km a pana wa i cka toyan a ki !10 Nongumidac klgadici i n tci U ndcipimadak a ki,"udinan.Midac ka ijimadci tat klpigickijwat. Midac ajisaswawabinat,papa kan ka kina ijra ya paginat ;dac wawlnat kadawiniti,pabamiba i tiwat a klng aya*a*wacansag, kayapabamisatcig, ki tciawasiyag kaya. Midac minawa Nana-15 bucu ka-i cota pinang i u oma ka kons, kl ijictcigat ka i gut.Pitclnagigu pajik ka todawat mi tigon, pabigaklnibawi imainii^i. Midac minawa pajik ki totawat. Minawa nlbiwakri citciga. Ninguding idacigu ml gimi kawat osan oglnkaya, osaya a yan kaya Nana padaman.20 Midac Nanabucu agut usayanyan, pabigagu oma mikizumigonpa piwat:"Kiginondawinaklganoninan?"Nanabucu dac udinan: "Anlndi?" udinan."Kaga kimamaji i k a 11 a l kiwa n zl."1Anim, .... The"Dog" renderingissuch word as "wretch."literal,but the sense is better with some
493means by which you are to bring back to life your fatherand your mother," he said to him,"and all the others.Now, this you shall do :you shall scratch the bark fromthe tree until you see the part in wood and then a stick;shall you dip into this that is contained here in the littleand then shall you rub it upon the place wherewooden pail ;you have scraped the bark from the he said totree,"him."Oh! Is that all?" he said to him."That is all."Thereupon againhe shot him inthe crown of the head,whereupon he slew him. "There, now!" he said to him.1that "Dog you are, who was ever bent upon destroyingthe earth! So now I will derive from you the source bywhich the earth will be replenished,"he said to him.Thereupon be began slicing him into small pieces witha knife. And as he scattered the pieces about, in all thevarious directions he flung them then he named them;what they were to be, they that run about upon the earthas the little animal-folk, and they that flyabout in theair, and also the large animal-folk. And then next afterNanabushu had taken up the little pail,he did what hehad been commanded. As soon as he s had done it toone tree, straightway there stood in the place a man.And so to another he did it.Again to many he did (it).And then by and by he found his father and his mother,and his elder brother Nana padam.And then Nanabushu was told by his elder brother,for immediately was he here teased by him while the peoplelaughed: "Did you hear me when I spoke to you?"Whereupon Nanabushu said to him: "Where?" he saidto him."When the old man was about -to prevail over you."
"Awagunan494Mlnangwana au Nanabucu kablbagimigogubanan magwaklpa piciwa tiwat Tcagaka a i minit-uga kwan. Midac Nana8bucu kayabi a pidci undami tad apitclba a ti mi tigo nangwanaanindowiwat pamakisiwagubanan. Uwlnga moski-;5 namagat u minis.i63. NANABUSHU LEAVES HIS BROTHER, AND ALSO HISGRANDMOTHER.Midac Nanabuco anicina atiso kan tibatcimint, kra-nimi-^catogwan i i we minis, ka pltcipa tinlnit pamadisinitima11minising. Midac kaya win tibadcimint ima kiwunanigwandank.A pidac Nanabucu ga kina ka icictcigat, migrrnat10 klwawlndamawat .ka/u-ndcipimadisinit. Midackaya iwa a pi klwawinat u 8kadicini kananit i awaslya kayaawaslyansa 8 kaya pabamotanit a klng. Midac kaya tibatcimint iwa a l pi kiwawlnat u i k! n go n ya 8 ka u ci a t undcimi /u micinamagwan kabigickicwat, kaya15 wasinig; mri* anadcimint Nanabucu.wananan kadam-Midac kiwa ajikanonat osan ugm kaya:"mlsacigwa tcimadcayan. Klndac, nisaya n ,Nana"Nos," udinan,padam,mi gin oma n ayan tcikanawanimatwa oma ayadcig," udinan ;"tciuglma kandawatwa," udinan. "Nlndac niwri ja niwl-;20 nandunawa no kumis," udinan. "Nlnglwawindamawa,"udinan. po tcinanga tabicko kiglyawimin a pana kawltcayawindiyang,"udinan. "Kinwin, nisaya 11 ,wantci ta
495And so it was by him that Nanabushu was called uponwhile he and Hewer-of-his-Shin were fighting. And nowNanabushu was yet very busy bringing the trees back tolife ; truly it was they that used to live in a former time.To its fullcapacity was the island crowded.63. NANABUSHU LEAVES HIS BROTHER, AND ALSO HISGRANDMOTHER.Thereupon Nanabushu, according to the story that istold of him, must have set to work to enlarge the sizeof the island, so great was the throng of them living thereit is also told of him that there wason the island. Now,he very content. And after Nanabushu had finished everything, he then spoke to them, and told them upon whatthey should subsist. And that was also the time he namedwhat (the people) should call the big animal-folk and thelittle animal-folk and them that crawl upon the ground.And the storyis also told of him how that at the timehe named the fishes which he had created from the GreatSturgeon which he had cut up, and them that should notbe used for food, such is what theytell of Nanabushu.And then they say that he spoke to his father andmother, saying: "My father," he said to them,"the timeis at hand for me to go away. - - And you, my elder brother,Nana padam, do you stay here to watch over them whoare here,"he said to him; "to be ruler over them,"hesaid to him. "Andmyself, I shall Igo away; wish to seekhe said to him. had made herfor my grandmother,""Ia promise,"he said to him."Anyhow,we both havenot had the same kind of birth,so that we should ever behe said to him. "You aretogether," yourself, my elder(as for) myself, frombrother, like a real human being ; and
!"496anicinabang kiglya 11 , nlndac wayabinigatagmrrma wandciyan,"udinan usayan yan.Anawidac Nana patam kawin minwandanzl pabigatcipal ka/a/t uclmayan, anodac pagusaniman tciwldclwat.!5 Nanabucu dac ugi kaniman, midac anat :"Nisaya11nongumkijiga k klgawldclwin, mwlkicipa kan o O we minisnawatc tcimistcag," udinan, "pa kic tcigikandaman anmanigu kwag kaganawandaman."Midac kaga t ajimadcawat, tcatcikakusawat a kubiganig.10 Anibabimusawad dac ningudingigu maminonandam awinini; abanabit, a ki a ta !wayabandank Pa kic kayaanigagigitowag, kawln dac kago kitosl wasaya mint.i i"Kicrkata," udigon uclmayan Nanabucon. "Wlba tavvunagucin,kawln kigatagwicinzlmin andayang,"udinan usa-15 ya n nyan. Midac kra niwawlndamawat usaya yan kadici irgima^kandawanitima ayanitci 8 .Kaga^idac udigon usaya n yan : "Niclm!" udigon, "wagunandackm wandciogima kandawasiwatwa, kin kipimatcra twalgi /u ?"pamadisiwat udinan.20 Midac Nanabucu ajina kwa/tawat usayanyan:"Nisaya"!"udinan, "kin ma kldinanimin tcikanawanimatwa," udinan.Utnudigon.Midac cigwa anitagwicinowat ka U ndcimadcawat;cayigwa7ima anra-yawat pacu mi wabandank wasaya/rmintki tci
497what was thrown away (at birth) was the source fromwhich Ihe said to hissprang,"elder brother.And though Nana patam was not pleased with the thoughtthat so soon he was to part from his younger brother,yet it was useless for him to beg (Nanabushu)to let himgo along.But Nanabushu knew his feelings, and so said to him :"Omy elder brother! during this day will I go with you,for I wish to walk round this island, so that largeritmaybecome*" he said to him, "and at the same time that youmay know how bigis the region over which you are tokeep watch."And so they truly started off, they went walking alongthe shore by the edge of the water. Now, as they thuswalked along, of a sudden mindful was the man as he;looked behind, land only did he see. Now, as they wentthey talked, but nothing to say had he who was the elderbrother. us "Letquicken our he was told pace!" by hisyounger brother, Nanabushu. "Soon will the evening comeon, and we shall not have returned to where we live,"he said to his elder brother. And then, as they wentalong, he explained to his elder brother how he shouldrule over them who were there.And so at last he was asked byhis elder brother :"Omy younger brother!" he was asked, "what is thereason that you are not chief over them, you who broughtback to life them that now are alive?" he said to him.Accordingly Nanabushu gave answer to his elder brother :"Omy elder brother!" he said to him, "it is you whomI wish to watch over them,"he said to him."Oh!" he was told.And now they were arriving at the place from whencethey had started ;as they were now drawing nigh to theplace, then he who was the elder brother beheld a mighty32 PUBL. AMER. ETHN. SOC. VOL. VII.
"Audinan," udinan,498zibi undi tagwayanik. Mldac anat uclmayan:"Anti wandclmagak owa zlbi? Kawin kago niwabandanzlnaban,"udinan uclmayan.Mldac Nanabucu anat: "Kaga/t,"udinan. "Kiwabandan5 na agaming? Mrrma ka/u-ndcimadcayang," udinan.Mama kadandam idac Nana padam. Mldac anandank :"Tibi ka-u ndcikaski-o wangan?"inandam.Nanabucu dac awantcicigu pa ba pi ;ani i-yinabit pa kicani aTndawabandank kago mi tig owayacawa kuwabinank10 slbink ka Lrndcikaski o-wat. Medac kagat kra-nimi kang.u!"usayayan."Kin ni tam acawandawan.""Anln ka ijikackioyang?" udinan."Awa u kawln, klgapwanawiuslmin!" udinan.Mldac kagatajra-cawanduwat ; miguni tam a tod uzit1 5 minawa dac pajik umbinang, ml aja agaming kita ku^klt.Midac tcipwapigwa l kitat ml aja kaya win Nanabucu.Mldac inabit, ml wabandang anigu kuta tigwayanig u zibiiabiding a ta ka u da a*mlt.Mldac ima caylgwa Nanabucu wlpa ka a/tusaya n yan.20 "Mlsa u i,nisaya n"tclpaka-i nan. Mi iwitikwaya kijan.Mi iwiti tciwabamatwakanaganangwa," udinan."Owitidackaya nln nlngatija,"udinan.Mldac pa ka i tiwat. Anicna atiso kan, kawln Nanabucutibatcimasl ina kawe tcigra wina kawa wabamat umgiigo25 a pl wanagadank i u minis. Mlya ta tabatcimint ajipa ka a t
499river flowing by. Thereupon he said to his younger brother :"From whence flows this river? Nothing (of a river) didI see before,"he said to his younger brother.Whereupon Nanabushu said to him: he said to"Ay,"him. "Doyou see the other shore? It is from overthere that we started,"he said to him.Astonished then was Nana padam. And then he thought:"Wonder where shall we be able to getacross?" thus hethought.But Nanabushu, on his part, only gave a laugh ;as hewent he observed, and as he went he was at the sametime seeking for some kind of a log to lay across thestream so that they might be able to cross. It was truethat he found one on the way."Come on!" he said tohis elder brother. "You first cross over on the log.""How shall we be able to getover?" he said to him.we shall not fail in the"Why, undertaking!"he saidto him.Thereupon truly crossed he over upon the log the;moment he put down one foot and then lifted the other,that very instant he stepped on the other shore. And sobefore he turned about (to see if the other was coming),then was Nanabushu also across. And as he looked, hethen beheld how wide was the river which only at a singlestep he had passed across.It was there that Nanabushu now meant to part withhis elder brother. "The time has come, my elder brother,"he said to "forhim, me to part from you. Straightyonder way do you go. Over there will you see themwhom we have left,"he said to him. "And over in this(other) direction I myself will he said to him.go,"Thereupon they parted from each other. According tothe story, not is it told if Nanabushu first went to seehis parentswhen he left the island. All that is told of
udinan.500usayayan kaya awiwabamat o l kumisan. Midac Nanabucukiwa ninat tibickoanitagwicing o kumisan andanit ayeyanit,ka i na pan udanang:"Nintagwicin,no kumis."ais"Nya5 a c pana!"!nyaais ! Anlnsa a pidci wa ijinanapagansumiyaji kito mindimoya."Kawm, no kumis! Nm kagat" udinan.Midac a-i ijinabit skwandang, mldac kagat wabamatojisan pipmdiganit. "Nya! nojis mmangwana kaga t tiigwucing!""Kmibu nintinandanaban," udinan.10 Midac Nanabucu wabamat o kumisan, a pidci wabiskanigustigwanini mldac anandank :"Papiga ajiwabickanig ustigwan,"inandam. Mldac agut o kumisan :"Nojic,katcinananingrirndand kitinandam ? Kinwan janiwak kigri nand,"udinan ojisan."Mldackaya kanabatc caylgwa tcinagani-15 nan," udinan ojisan."Ayec,no kumis. Mi owiti kadacayan ka pi u ndciyan,udinan. "Mri witi nisaya n kra sak tciirgima kandonag."Mldac kagatmindimoya ajimadcat, aja a nat ojisan.Kaya win dac Nanabucu animadca, ningutci pa kan ijat;20 kayabi nongum pimusatug, tibi nongum ayagwan ; magicakaya kayabinongum pamusagwan.
him is that he parted from his elder brother and that hewent to see hisgrandmother. And now they say thatwhen Nanabushu arrived at the home where his grandmother was, he said to her the same thing that he hadsaid to her in times "Igone by: have come home, Omy grandmother!""Oh,dear me! Oh, dear me! Why should you alwaysdesire to afflict me grievously with such words!" said theoldwoman.I!" he said to her."Nay, myIt isgrandmother! trulyThereupon, vas she looked toward the doorway, thenverily she beheld her grandson come entering in. "Ah,me ! it ismy dear grandson who has actually come backhome!" she said to him. "He is dead, such was mythought of him," she said to him.And so as Nanabushu looked upon his grandmother,exceedingly white was her hair. And this he thought:"In so short a while has her hair whitened," he thought.Whereupon he was told by his grandmother: "My grandson, do you think that you have been absent but a littlewhile? A long time have you been gone,"she said toher grandson."Andperhapsthe time has come for meto leave you,"she said to her grandson."Yes, my grandmother. To yonder place from whenceI now have come shall you go,"he said to her. "Atthat place have Iplaced my elder brother, that he mightbe ruler over you (and the rest)."And then truly the old woman departed, she followedback the footsteps of her grandson.And Nanabushu himself went his way, off in some otherdirection he went still to this, day must he be travellingalong, wherever the place he now may be and, perhapseven to this day he may be walking.
PUBLICATIONS ISSUED BY THE AMERICANETHNOLOGICAL SOCIETY.TRANSACTIONS OF THE AMERICAN ETHNOLOGICAL SOCIETY.Vols. I-HI, 1845-51. (Out of print.)BULLETIN OF THE AMERICAN ETHNOLOGICAL SOCIETY,1860-63! (Out of print.}JOURNAL OF THE ANTHROPOLOGICAL INSTITUTE OF NEWYORK. Vol. i, No. i, 1871-73. (Out of print.}Dr. C. H. BERENDT, Analytical Alphabet for the Mexican and CentralAmerican Languages (printed in facsimile). (Out of print}TRANSACTIONS OF THE AMERICAN ETHNOLOGICAL SOCIETY.Vol. III. Reprinted in 1909.PUBLICATIONS OF THE AMERICAN ETHNOLOGICAL SOCIETY.I. WILLIAM JONES, Fox Texts. 1907. 383 pp.II. EDWARD SAPIR, Wishram Texts. 1909. 314 pp.III. JOHN R. SWANTON, Haida Songs; FRANZ BOAS, Tsimshian Texts.1912. 284 pp.IV. ROLAND B. DIXON, Maidu Texts. 1912. 241 pp.V. WALDEMAR BOGORAS, Koryak Texts. 1916. 153 pp.VI. JOHN W. CHAPMAN, Ten a Texts and Tales from Anvik, Alaska;with Vocabulary by PLINY EARLE GODDARD. 1914. vi + 230 pp.VII. Part I. WILLIAM JONES, Ojibwa Texts. Edited by TrumanMichelson. 1917. xxi + 501 pp.Part II. WILLIAM JONES, Ojibwa Texts. Edited by TrumanMichelson.In press.VIII. JOHN R. SWANTON, Haida Texts. In press.IX. WILLIAM JONES, Kickapoo Texts. Edited by1915. 143 pp.Truman Michelson.
RETURNTO *>202CIRCULATION DEPARTMENTMain LibraryUNIVERSITY OF CALIFORNIA, BERKELEYFORM NO. DD6, 60m, 1/83 BERKELEY, CA 94720$
GENERAL UBRflBY . ac. BEBKELEy
Change language