UK Qualifications-2013 - Cache
UK Qualifications-2013 - Cache
UK Qualifications-2013 - Cache
You also want an ePaper? Increase the reach of your titles
YUMPU automatically turns print PDFs into web optimized ePapers that Google loves.
<strong>2013</strong>at the heart of connectingpeople to higher education<strong>UK</strong> <strong>Qualifications</strong>For entry to university or college in <strong>2013</strong>This guide provides accurate and up-to-date information about a wide range ofpre-HE qualifications and entry routes to HE. The publication is intended primarilyto be a working manual for admissions tutors and staff involved in admission andrelated activities in universities and colleges. It should also be useful for staff inschools, colleges and careers services who advise applicants on entry to HE.
ContentsEdexcel BTEC Professional courses levels 4-7 (QCF) 69Edexcel BTEC level 4 HNC Diploma (QCF) 70Edexcel BTEC level 5 HND Diploma (QCF) 70EDI (Education Development International) <strong>Qualifications</strong> 70EDI Level 3 Certificate in Personal Training 70EDI Level 3 Award in IT User Skills (ITQ) 71EDI Level 3 Certificate in IT User Skills (ITQ) 71EDI Level 3 Diploma in IT User Skills (ITQ) 71EDI Level 3 Award in Food Safety Supervision for Logistics 71EDI Level 3 Certificate for Working in the Health Sector 72EDI Level 3 Certificate in Preparing to Work in Adult Social Care (QCF) 79EDI Level 3 Award in Awareness of Dementia (QCF) 79EDI Level 3 Award in Awareness of End of Life Care 79EDI Level 3 Award in Hospitality Supervision and Leadership Principles (QCF) 72EDI Level 3 Certificate in Hospitality and Catering Principles (Professional Cookery) (QCF) 72EDI Level 3 Award in Practical Supervision of Food Safety in Catering 73EDI Level 3 Award in Nutrition for Healthier Food and Special Diets 73EDI Level 3 Award in Principles of Supervising Customer Service Performance in the Hospitality, Leisure, Travel and Tourism Sector 73EDI Level 3 Certificate in Customer Service 73EDI Level 4 Certificate in Delivering Learning using a Virtual Learning Environment (VLE) 74EDI Level 4 Certificate in Teaching Advanced ICT 74EDI Level 4 Certificate in Teaching ICT Skills 75EDI Level 4 Certificate in Education Principles and Practice 75EDI Level 3 Award in Preparing to Teach in the Lifelong Learning Sector 75EDI Level 4 Award in Preparing to Teach in the Lifelong Learning Sector 75EDI Level 3 Certificate in Teaching in the Lifelong Learning Sector 76EDI Level 4 Certificate in Teaching in the Lifelong Learning Sector 76EDI Level 3 Certificate in Management Principles 76EDI Level 3 Certificate/Diploma in Principles of Bus and Coach Engineering and Maintenance (Mechanical/Electrical/Body) 77EDI Level 4 Diploma in Education Practice: ICT Advanced 77EDI (LCCI IQ) level 3 Certificate in Accounting 77EDI (LCCI IQ) level 3 Certificate in Accounting (IAS) 78EDI Level 3 Certificate in Transition to Playwork (from Early Years) 78EDI Level 3 Certificate for Retail Knowledge (QCF) 81EDI Level 3 Certificate in Principles of Sales 81EDI (LCCI) Level 3 Certificate in Business Principles and Practice 82EDI (LCCI) Level 3 Award in Professional Ethics and Finance 82EDI (LCCI) Level 3 Award in Computerised Accounting Skills 82EDI (LCCI) Level 3 Award in Understanding Financial Statements 83EDI (LCCI) Level 3 Award in Principles and Practice of Costing 83EDI (LCCI) Level 4 Award in Islamic Finance and Banking 83EDI (LCCI) Level 4 Award in Business Finance and Banking Operations 84EDI (LCCI) Level 4 Certificate in Applied Business Economics 84EDI (LCCI) Level 3 Award in Introduction to Business Planning and Strategy 84EDI Level 3 Certificate in Contact Centre Operations 80EDI Level 5 Diploma in Management and Leadership 80EDI Level 3 Diploma in IT User Skills (ITQ Apprentice) 80EDI Level 3 Certificate in ICT Systems and Principles 81EDI Level 3 Certificate in Principles of the Creative and Cultural Sector 78Sports Leaders <strong>UK</strong> Level 3 Certificate in Higher Sports Leadership 138Institute of Commercial Management (ICM) 95ICM Certificate/Diploma/Advanced Diploma Programmes 95ifs School of Finance 96ifs Certificate in Financial Studies (CeFS) 96ifs level 3 Diploma in Financial Studies (DipFS) 97National Vocational Qualification (NVQ) 103NCC Education 104NCC Education International Foundation Year (IFY) 104NCC Education Level 3 Diploma in Business 104NCC Education Level 3 Diploma in Computing 105NCC Education Level 4 Diploma in Computing (QCF) 105<strong>UK</strong> QUALIFICATIONS 5
ContentsNCC Education Level 4 Diploma in Business Information Technology (QCF) 105NCC Education Level 4 Diploma in Business (QCF) 106NCC Education Level 5 Diploma in Computing (QCF) 106NCC Education Level 5 Diploma in Business IT (QCF) 107NCC Education Level 5 Diploma in Business (QCF) 107Pre-Master’s in Business 108Pre-Master’s in IT 108NCC Education Level 7 Diploma in Business Management (QCF) 109NCC Education Level 7 Diploma in Strategic Business IT (QCF) 109NCFE 109NCFE Certificate in Art and Design 110NCFE Certificate in Creative Craft 110NCFE Certificate in Interactive Media 111NCFE Certificate in Personal Training 111NCFE Award in Counselling Skills and Theory 111NCFE Diploma in Counselling Skills 111NCFE Award in Employability Skills 112NCFE Award in Job Search and Interview Skills 112NCFE Award in Learning to Learn for Higher Level Studies 112NCFE Award in Managing Diversity 112NCFE Award in Practical Supervision of Food Safety in Catering 113NCFE Award in Preparing to Teach in the Lifelong Learning Sector 113NCFE Certificate in Employability Skills 113NCFE Certificate in Palliative Care 113NCFE Certificate in Working in the Health Sector 114NCFE Certificate in Supporting Teaching and Learning in Schools 114NCFE NVQ in Advice and Guidance 114NCFE NVQ Diploma in Custodial Care (new QCF version for January 2011) 114NCFE NVQ Diploma in Customer Service 125NCFE NVQ Certificate in Spectator Safety 125NCFE NVQ Diploma in Spectator Safety Management 125NCFE Certificate in Leisure Management 126NCFE NVQ Diploma in Leisure Management 126NCFE Diploma in Outdoor Learning 126NCFE NVQ Diploma in Outdoor Programmes 126NCFE Certificate in Travel Services 127NCFE NVQ Diploma in Travel Services 127NCFE NVQ Diploma in Personal Training 127NCFE Certificate in Retail Skills (Management) 127NCFE Certificate in Retail Skills (Visual Merchandising) 128NCFE Certificate in Retail Skills (Sales Professional) 128NCFE Diploma in Retail Skills (Visual Merchandising) 128NCFE Diploma in Retail Skills (Management) 129NCFE Diploma in Retail Skills (Sales Professional) 129NCFE Certificate in Retail Knowledge 129NCFE Award in Preparing to Teach in the Lifelong Learning Sector 115NCFE Certificate in Early Years Foundation Stage Practice 115NCFE NVQ in Food Manufacture 115NCFE NVQ in Health and Social Care 115NCFE Certificate in Logistics Operations (new QCF version for 2011) 116NCFE NVQ in Occupational Health and Safety 116NCFE NVQ Certificate in Witness Care (new QCF version for 2011) 116NCFE Certificate in Principles of Business and Administration 116NCFE NVQ Certificate in Management 117NCFE NVQ Diploma in Business and Administration 117NCFE NVQ Certificate in Business and Administration 117NCFE NVQ Diploma in Customer Service 117NCFE Award in Understanding the Principles and Practices of Assessment 117NCFE Award in Assessing Competence in the Work Environment 118NCFE Award in Assessing Vocationally Related Achievement 118NCFE Certificate in Assessing Vocational Achievement 1186 <strong>UK</strong> QUALIFICATIONS
ContentsNCFE Diploma for the Children and Young People’s Workforce 119NCFE Award in Understanding the Internal Quality Assurance of Assessment Processes and Practice 119NCFE Award in the Internal Quality Assurance of Assessment Processes and Practice 119NCFE Certificate in Leading the Internal Quality Assurance of Assessment Processes and Practice 119NCFE Award in Understanding the External Quality Assurance of Assessment Processes and Practice 120NCFE Award in Externally Assuring the Quality of Assessment Processes and Practice 120NCFE Certificate in Leading the External Quality Assurance of Assessment Processes and Practice 120NCFE Diploma for Entry to the Uniformed Services 120NCFE Diploma in Managing a Music Business Enterprise 120NCFE Diploma in Radio Production 121NCFE Diploma in Healthcare Support Services 121NCFE Award in Employment and Personal Learning Skills in Health 121Certificate in Stroke Care Management 121NCFE Certificate in Working in End of Life Care 121NCFE Award in IT User Skills (ITQ) 122NCFE Award in Supporting Teaching and Learning in Schools 122NCFE Certificate in Contact Centre Operations 122NCFE Certificate in IT User Skills (ITQ) 122NCFE Certificate in Management 123NCFE Certificate in Principles of Customer Service 123NCFE Certificate in Supporting Teaching and Learning in Schools 123NCFE Diploma in IT User Skills 123NCFE Diploma in IT User Skills (ITQ) 123NCFE Diploma in Specialist Support for Teaching and Learning in Schools 124NCFE Certificate Cover Supervision of Pupils in Schools 124NCFE Certificate in Teaching in the Lifelong Learning Sector (level 3) 124NCFE Certificate in Teaching in the Lifelong Learning Sector (level 4) 124NCFE NVQ Diploma in Business and Administration 124NCFE NVQ Diploma in Contact Centre Operations (level 3) 125NCFE NVQ Diploma in Contact Centre Operations (level 4) 125Oxford, Cambridge and RSA (OCR) Examinations 129OCR National Award and Certificate in Science 130OCR Asset Languages 130OCR Certificate/Diploma for iMedia Users 131OCR Certificate/Diploma for IT Professionals 132OCR Level 3 Certificate in Mathematics for Engineering 133OCR Level 5 Certificate in Teaching Learners with Specific Learning Difficulties 133OCR National Certificates, Diplomas and Extended Diplomas 134OCR Level 3 Diploma for the Children and Young People’s Workforce 136OCR Preparing to Teach in the Lifelong Learning Sector (PTLLS) Award 137OCR Certificate in Teaching in the Lifelong Learning Sector 137Technical Certificate 138Vocationally Related <strong>Qualifications</strong> (VRQs) 152SKILLS/ENRICHMENTAdult Literacy and Adult Numeracy 154ASDAN Certificate of Personal Effectiveness (ASDAN CoPE) 154ASDAN Award of Personal Effectiveness (ASDAN AoPE) 155ASDAN Certificate in Career Planning 155ASDAN Level 3 Award and Certificate in Employability 155ASDAN Level 3 Award and Certificate in Community Volunteering 156ASDAN Universities Award 156Cambridge ESOL Examinations 156CSV Learning Together and Student Community Partnerships 157ASCENTIS Level 3 Certificate in Personal Development for Progression (formerly known as the Curriculum Enrichment Programme) 157The Duke of Edinburgh’s Award 157Engineering Education Scheme in England (EESE) 158Essential Skills 158Essential Skills Wales 158Functional Skills 159Key Skills 159Industrial Careers Foundation 160<strong>UK</strong> QUALIFICATIONS 7
ContentsTrident Trust ‘Skills for Life’ Programme 160OCR Level 3 Certificate for Young Enterprise (QCF) 160PHASED OUT QUALIFICATIONSOrdinary level (GCE O level, O level) 161Alternative Ordinary level (AO level) 161Advanced level (GCE A level) 162Advanced Supplementary (GCE AS) 163Special Papers (SPs) 164Certificate of Secondary Education (CSE) 164Joint 16+ Examinations 164Certificate of Extended Education (CEE) 164Certificate of Extended Studies (CES) 165Certificate of Further Studies (CFS) 165Intermediate Certificates 165Senior Certificate Examination (SCE) 165Use of English 165BTEC <strong>Qualifications</strong> prior to September 2002 (including former BTEC, BEC and TEC qualifications)– First, National and Higher National <strong>Qualifications</strong> 165Higher National <strong>Qualifications</strong> – Engineering 165BTEC <strong>Qualifications</strong> prior to 1986 (including BEC, TEC and Joint Committee <strong>Qualifications</strong>) 166Access to HE Certificate 166Advanced General National Vocational <strong>Qualifications</strong> (Advanced GNVQ) 166Sixth Term Examination Papers (STEP) 167Part One General National Vocational <strong>Qualifications</strong> (Part One GNVQ) 168ifs Certificate in Financial Services Practice (CFSP) 168Advanced Subsidiary Vocational Certificate of Education (ASVCE, three-unit VCE) 168Advanced Vocational Certificate of Education (AVCE, six-unit AVCE) 169Advanced Vocational Certificate of Education: Double Award (AVCEDA, Vocational A level Double Award) 170Diploma of Achievement 170General National Vocational <strong>Qualifications</strong> (GNVQ) 171National Christian Schools’ Certificate (NCSC) 171Progress File 172OTHER ENTRY ROUTES TO HIGHER EDUCATIONAccreditation of Prior Learning (APL) 174Credit for Higher and Further Education <strong>Qualifications</strong> 174The Open University (OU) 176WALES 178NORTHERN IRELAND 179<strong>Qualifications</strong> in ScotlandIntroduction 181The Scottish Credit and <strong>Qualifications</strong> Framework 181Awarding and Accrediting Body – Scottish <strong>Qualifications</strong> Authority 183CURRENT SCOTTISH QUALIFICATIONSNational Courses (SCQF levels 4 to 7) 183National Units (available at SCQF levels 1 to 7) 184Core Skills 185Access 2 and Access 3 185Advanced Highers (AH) 185Awards 186Core Skills 186Scottish Baccalaureate 187Scottish Baccalaureate in Expressive Arts 187Scottish Baccalaureate in Languages 188Scottish Baccalaureate in Science 189Scottish Baccalaureate in Social Sciences 190Higher National Certificates (HNC) 191Higher National Diplomas (HND) 191Highers 1928 <strong>UK</strong> QUALIFICATIONS
ContentsIntermediate 1 and Intermediate 2 (Int 1, Int 2) 193National Certificate Group Awards 193National Qualification Group Awards 193National Certificates 194National Progression Awards (NPAs) 194Professional Development Awards (PDA) 194Scottish Progression Awards (SPA) 195Scottish Vocational <strong>Qualifications</strong> (SVQ) 195Standard Grades (S Grades) 196Scottish Curriculum Reform 197PHASED OUT QUALIFICATIONSCertificate of Sixth Year Studies (CSYS) 199General Scottish Vocational <strong>Qualifications</strong> (GSVQ) 199National Certificate Modules 199Scottish Group Awards (SGA) 199Scottish Certificate of Education Highers (SCE Highers) 200CERTIFICATES AND OTHER SUPPORTING EVIDENCE LIKELY TO BE OFFERED BY APPLICANTSScottish <strong>Qualifications</strong> Certificate (SQC) 201Commemorative Certificates 201Scottish Certificate of Education (SCE) 201Certificate of Sixth Year Studies (CSYS) 201Record of Education and Training (RET) 201Certificates awarded by Scottish Vocational Education Council’s predecessor bodies: Scottish Business Education Council andScottish Technical Education Council (SCOTBEC, SCOTEC) 201Progress File 201National Record of Achievement (NRA) 201Young Enterprise Scotland 201Modern Apprenticeships in Scotland (MA) 202ROUTES INTO HIGHER EDUCATION IN SCOTLANDScottish Access to Higher Education Programmes, Courses and Pathways 204Scottish Wider Access Programme (SWAP) 204Access Courses run by Higher Education Institutions 204Community Education, Voluntary Organisation Routes 204Summer Schools 204Credit Accumulation and Transfer 204International Foundation Programme (IFPS) 204AppendicesAppendix A – Contact details 205Appendix B – The UCAS Tariff 209Appendix C – GCSE subject availability 218Appendix D – Discontinued GCSE Subjects (last examinations 2002) 222Appendix E – GCE A level and AS subject availability 225Appendix F – Advanced Extension Award subject availability 230Appendix G – AVCE/ASVCE/AVCE Double Award subject availability 231Appendix H – Additional Admissions Tests 232Appendix I – English Language Proficiency 233Appendix J – National Courses Available in Scotland (Intermediate to Advanced Higher level) 235Appendix K – National Qualification Group Awards (Scotland) 237<strong>UK</strong> QUALIFICATIONS 9
List of abbreviationsList of abbreviationsA AdvancedAA Advanced ApprenticeshipABC ABC AwardsABL Awarding Body LinkageABRSM Associated Board of the Royal Schools of MusicACAC Curriculum and Assessment Authority for Wales (no longer current)ACCAC Awdurdod Cymwysterau Cwricwlwm Ac Asesu Cymru/<strong>Qualifications</strong>,Curriculum and Assessment Authority for Wales (now DCELLS)ACER Australian Council for Education ResearchACGI Associate of City and Guilds InstituteADA Advanced Double AwardADES Association of Directors of Education in ScotlandAEA Advanced Extension AwardAEB Associated Examining Board (no longer current)AGNVQ Advanced General National Vocational Qualification (no longercurrent)AH Advanced HigherAICE Advanced International Certificate of EducationAIDA Award in Digital ApplicationsALCC Associate of London Chamber of Commerce and IndustryAO Alternative Ordinary levelAPEL Accreditation of Prior Experiential LearningAPL Accreditation of Prior LearningAQA Assessment and <strong>Qualifications</strong> AllianceAS Advanced Subsidiary (from September 2000)AS Advanced Supplementary (last examination 2001)ASC Association of Scottish CollegesASDA Advanced Subsidiary Double AwardASDAN Award Scheme Development and Accreditation NetworkASVCE Advanced Subsidiary Vocational Certificate of Education(last award 2006)ATD Advanced Technician DiplomaAVA Authorised Validating AgencyAVCE Advanced Vocational Certificate of Education (last award 2006)AVCEDA Advanced Vocational Certificate of Education Double Award(last award 2006)BEC Business Education Council (no longer current)BHS The British Horse SocietyBIS Department for Business Innovation and SkillsBMAT BioMedical Admissions TestBTEC Business and Technology Education CouncilCABs Component Awarding BodiesCACHE Council for Awards in Children’s Care and EducationCAE Certificate of Advanced EnglishCAS Creativity, Action, ServiceCATS Credit Accumulation and Transfer SystemCBI Confederation of British IndustryCBS Cambridge Business SkillsCCEA Northern Ireland Council for the Curriculum, Examinationsand AssessmentCCLC Council for Citizenship and Learning in the CommunityCCP Certificate in Childminding PracticeCCP Contact Centre ProfessionalCEE Certificate of Extended Education (no longer current)CEFR Common European Framework of Reference for LanguagesCeFS Certificate in Financial StudiesCELS Certificate in English Language SkillsCEP Curriculum Enrichment ProgrammeCES Certificate of Extended StudiesCfE Curriculum for ExcellenceCFS Certificate of Further StudiesCFSP Certificate in Financial Services PracticeCIB Chartered Institute of BankersCIDA Certificate in Digital ApplicationsCIE Cambridge International ExaminationsCIOBS Chartered Institute of Bankers in ScotlandCIT Cambridge Information TechnologyCLS Community Learning ScotlandCNAA Council for National Academic Awards (no longer current)COSLA Convention of Scottish Local AuthoritiesCPD Certificate of Professional DevelopmentCPDCPECQFWCRACSCACSECSVCSYSCTADABsDASDCEDCELLSDDPDEBFDENIDfEDFSMDIDADipFSDPPWDPWDTEPEBECTSEDIEFLEQFEQLESBESOLEUFABFADFCFCEFDFEFEFCFEHQFEIFEntoFLAWFLICFMPFSMQFTCFTDGAMSATGCGCEGCGIGCSEGDGLHGNVQGOALGSVQHHASHATHEHEFCEHEIHEPIHESAHIEHLHMIEContinuing Professional DevelopmentCertificate of Proficiency in EnglishCredit and <strong>Qualifications</strong> Framework for WalesCentre for Recording AchievementCambridge Skills and Career AwardCertificate of Secondary Education (no longer current)Community Service VolunteersCertificate of Sixth Year Studies (no longer current)Certificate for Teaching AssistantsDiploma Awarding BodiesDiploma Aggregation ServiceDiploma in Child Care and EducationDepartment for Education, Lifelong Learning and SkillsDiploma Development PartnershipDiploma in English for Banking and FinanceDepartment of Education in Northern IrelandDepartment for EducationDiploma in Financial Services ManagementDiploma in Digital ApplicationsDiploma in Financial StudiesDiploma in Playgroup Practice in WalesDiploma in PlayworkDiploma in Trust and Estate PracticeEuropean BaccalaureateEuropean Credit Transfer SystemEducation Development InternationalEnglish as a Foreign LanguageEuropean <strong>Qualifications</strong> FrameworkEquestrian <strong>Qualifications</strong> LimitedEnglish Speaking BoardEnglish for Speakers of Other LanguagesEuropean UnionFederation of Awarding BodiesFoundation Art and DesignFirst CertificateFirst Certificate in EnglishFirst DiplomaFurther EducationFurther Education Funding CouncilFramework for Higher Education <strong>Qualifications</strong>Further Education InstitutionFurther Education National Training OrganisationForeign Languages at WorkForeign Languages for Industry and CommerceFinal Major ProjectFree-standing Mathematics QualificationFull Technological CertificateFull Technological DiplomaGraduate Medical School Admissions TestGeneral CertificateGeneral Certificate of EducationGraduate of City and Guilds InstituteGeneral Certificate of Secondary EducationGeneral DiplomaGuided Learning HoursGeneral National Vocational QualificationGlobal Online Assessment for LearningGeneral Scottish Vocational Qualification (no longer current)HigherHeadteachers’ Association of ScotlandHistory Aptitude TestHigher EducationHigher Education Funding CouncilHigher Education InstitutionHigher Education Policy InstituteHigher Education Statistics AgencyHighlands and Islands EnterpriseHigher LevelHer Majesty’s Inspectorate of Education10 <strong>UK</strong> QUALIFICATIONS
List of abbreviationsHNCHNDHPATIADIASIBIBCCIBMYPIBOICAAEICCEICCSICFICMICTIDCSIELTSIFPSIFSIGCSEITITOIVAIWAJACJACQAJCGJCQJMBKSLCCILCGILCMLCMMLEAGLMCLNATLSCLSNLTSNMCGIMEGMFLMMLMSATNCNCEENCSCNCSCBNCVQNDNDAQNDTEFNEANEABNIACENICATSNICCNICCEANISEACNISECNNEBNOCNNQFNRANTONUCCATHigher National CertificateHigher National DiplomaHealth Professions Admission TestAdvanced Diploma in Computer StudiesInternational Accounting StandardsInternational BaccalaureateInternational Baccalaureate Careers-related CertificateInternational Baccalaureate Middle Years ProgrammeInternational Baccalaureate OrganizationInternational Curriculum and Assessment Agency ExaminationsInternational Certificate of Christian EducationInternational Certificate in Computer StudiesIndustrial Careers FoundationInstitute of Commercial ManagementInformation and Communication TechnologyInternational Diploma in Computer StudiesInternational English Language Testing CertificateInternational Foundation Programme – Scotlandifs School of FinanceInternational General Certificate of Secondary EducationInformation TechnologyIndustry Training OrganisationIntegrated Vocational AssessmentInstitute of Welsh AffairsJoint Advisory CommitteeJoint Advisory Committee for <strong>Qualifications</strong> ApprovalJoint Curriculum GroupJoint Council for <strong>Qualifications</strong>Joint Matriculation Board (no longer current)Key StageLondon Chamber of Commerce and Industry InternationalLicentiate of City and Guilds InstituteLondon College of Music (no longer current)London College of Music and MediaLondon East Anglian Group (no longer current)Learning Materials for ChangeNational Admissions Test for LawLearning and Skills CouncilLearning and Skills Network (no longer current)Learning and Teaching Support NetworkMember of City and Guilds InstituteMidlands Examining Group (no longer current)Modern Foreign LanguageModern and Medieval Languages TestMedical School Admissions TestNational CertificateNational Council for Educational ExcellenceNational Christian Schools’ CertificateNational Christian Schools’ Certificate BoardNational Council for Vocational <strong>Qualifications</strong> (no longer current)National DiplomaNational Database of Accredited <strong>Qualifications</strong> (replaced by theRegister of Regulated <strong>Qualifications</strong>)National Design and Technology Education FoundationNorthern Examining Association (no longer current)Northern Examinations and Assessment Board (no longer current)National Institute of Adult Continuing EducationNorthern Ireland Credit Accumulation and Transfer SystemNorthern Ireland Council for the Curriculum (no longer current)Northern Ireland Council for the Curriculum, Examinations andAssessment (often abbreviated to CCEA)Northern Ireland Schools Examinations and Assessment Council (nolonger current)Northern Ireland Schools Examinations Council (no longer current)National Nursery Examination Board (no longer current)National Open College NetworkNational <strong>Qualifications</strong> FrameworkNational Record of AchievementNational Training Organisation (now replaced by Sector Skills Council)Northern Universities Consortium for Credit Accumulation andTransferNUSNVQOOCEACOCNOCROCSEBOfqualOIBONCONDOUPDPDAPDPPFIGQAQAAQANQCDAQCFQIARETRITSSACCASBASBSSCAASCAVASCESCOPSCOTBECSCOTCATSCOTECSCOTVECSCQFSESEBSECSEECSEEDSEETLDSEFICSEGSFASFEFCSGASHEFCSIFPSLSLSSPSPASPASQASQCSSAScotSSCSTEPSTUCSUfISUJBSVQSWAPTDTECTECNational Union of StudentsNational Vocational QualificationOrdinary level (no longer current)Oxford and Cambridge Examinations and Assessment Council (nolonger current)Open College NetworkOxford, Cambridge and RSA examinationsOxford and Cambridge Schools Examination Board (no longer current)Office of the <strong>Qualifications</strong> and Examinations RegulatorOption Internationale du BaccalauréatOrdinary National CertificateOrdinary National DiplomaOpen UniversityProfessional DevelopmentProfessional Development AwardProfessional Development PlanningProgress File Implementation GroupQuality AssuranceQuality Assurance Agency for Higher EducationQualification Accreditation Number<strong>Qualifications</strong> and Curriculum Development Agency (no longercurrent)<strong>Qualifications</strong> and Credit FrameworkQuality Improvement AgencyRecord of Education and Training (no longer current)Regulatory IT SystemScottish Advisory Committee on Credit and AccessScenario-Based AssignmentSchool Based SyllabusSchool Curriculum and Assessment Authority (no longer current)Standing Conference of Authorised Validating AgenciesScottish Certificate of Education (no longer current)Standing Conference of Principals (now GuildHE)Scottish Business Education Council (no longer current)Scottish Credit Accumulation and TransferScottish Technical Educational Council (no longer current)Scottish Vocational Education Council (no longer current)Scottish Credit and <strong>Qualifications</strong> FrameworkScottish EnterpriseScottish Examination Board (no longer current)Secondary Examinations Council (no longer current)Southern England Consortium for Credit Accumulation and TransferScottish Executive Education DepartmentScottish Executive Enterprise, Transport and Lifelong LearningDepartmentSpoken English for Industry and CommerceSouthern Examining Group (no longer current)Skills Funding AgencyScottish Further Education Funding CouncilScottish Group AwardScottish Higher Education Funding CouncilScottish International Foundation Programme (no longer current)Standard LevelSchool Leaders ScotlandSpecial Paper (no longer current)Scottish Progression AwardSupporting Professionalism in AdmissionsScottish <strong>Qualifications</strong> AuthorityScottish <strong>Qualifications</strong> CertificateSector Skills Alliance ScotlandSector Skills CouncilSixth Term Examination PaperScottish Trade Unions CongressScottish University for IndustrySouthern Universities Joint BoardScottish Vocational QualificationScottish Wider Access ProgrammeTechnician DiplomaTechnician Education Council (no longer current)Training and Enterprise Council (no longer current)<strong>UK</strong> QUALIFICATIONS 11
List of abbreviationsTOEFLTSAUACE(S)UALUCASUCCAUCLESUfI<strong>UK</strong>CAT<strong>UK</strong>CESULEACULSEBULSEDUMSUODLEU<strong>UK</strong>VCEWBADWJECYEYPLATest of English as a Foreign LanguageThinking Skills AssessmentUniversities Association for Continuing Education (Scotland)University of the Arts, LondonUniversities and Colleges Admissions ServiceUniversities Central Council on Admissions (no longer current)University of Cambridge Local Examinations SyndicateUniversity for Industry<strong>UK</strong> Clinical Aptitude Test<strong>UK</strong> Commission for Employment and SkillsUniversity of London Examinations and Assessment Council (no longercurrent)University of London Schools Examination Board (no longer current)University of London Schools Examination Department (no longercurrent)Uniform Mark ScaleUniversity of Oxford Delegacy of Local Examinations (no longercurrent)Universities <strong>UK</strong>Vocational Certificate of EducationWelsh Baccalaureate Advanced DiplomaWelsh Joint Education CommitteeYoung EnterpriseYoung People’s Learning Agency12 <strong>UK</strong> QUALIFICATIONS
<strong>Qualifications</strong> inEngland, Wales andNorthern Ireland<strong>UK</strong> QUALIFICATIONS 13
IntroductionIn general group or overarching awards provide added value andarguably the achievement may be greater than the sum of theparts. However, this is where challenges arise for HE admissions.A group award such as the IB is significantly larger than thetypical A level entry requirement of three A levels, and issuesarise of equitable treatment of applicants offering largeprogrammes of study.In the case of the IB the offer is typically based on the overallnumerical score for the qualification as a whole, but wherea group or overarching award packages existing qualificationsthere is the possibility that HEIs may unpack the qualification intoits components and base entry requirements and conditionaloffers on achievement in components, potentially underminingthe integrity of the award as a whole.It is recommended that HEIs frame entry requirements and offerswhich respect the achievement of the award as a whole, whilesetting hurdles in individual components where this is consideredappropriate.Breadth is a feature of group or overarching awards but can takea number of forms. The IB Diploma requires achievement in anumber of domains and therefore guarantees substantial breadth.Typically group or overarching awards which package existingqualifications eg AQA Bacc and WBQ do not impose any rules ofcombination on the optional qualifications and therefore thechoice of A levels can provide either breadth or specialism. Thebreadth in such group awards is provided by the genericelements for example key skills, General Studies etc. The projectcan contribute to breadth but may often be related to the mainsubject(s) of study, and in Diplomas it is a requirement that theproject should be related to the subject line of the PrincipalLearning. Diplomas have a substantial amount of applied learningwithin a single subject line, but it should be noted that these linesare themselves very broad. The ASL of Diplomas can be usedeither for breadth and contrast or for additional specialism in thesubject line. Thus Diplomas can be either broad or specialised,but in all cases they involve generic functional skills and personallearning and thinking skills.PROJECTSIncreasingly group awards include a project which can potentiallybe a valuable preparation for study within HE. This is a mandatoryfeature of Diplomas, the IB (Extended Essay), the WBQ (IndividualInvestigation), the Pre-U Diploma (Independent Research Report)and the Scottish Baccalaureates (Interdisciplinary Project). Inmost cases the candidate, in consultation with the centre, hasfreedom of choice of topic, but for Diplomas the topic must relateto the Principal Learning subject line, and the ScottishBaccalaureate will require the project to be interdisciplinary.The Extended Project will be widely available for learners taking Alevels and other qualifications and should be a valuable adjunctto such programmes, offering potential for either breadth orgreater depth. The project can take a number of forms, forexample Dissertation, Investigation/Field Study, Performance orArtefact. However, in every case a Production Log is completedby the learner and verified by the supervisor, and the candidate isrequired to produce a written report, evidence and a presentation,giving structure and rigour to the process.In the context of an A level programme the Extended Projectis not mandatory. If HEIs consider it to be of value to supportprogression to HE, they are urged to encourage its uptake andto include it in entry requirements and conditional offers if thatis felt appropriate. Entry Profiles could be used to give guidanceon good uses of the Extended Project to support progression toparticular HE courses.OFQUAL’S NEW ROLEOn 1 April 2010 the Apprenticeships, Skills, Children andLearning Act formally established Ofqual as a non-ministerialGovernment department, reporting directly to Parliament and theNorthern Ireland Assembly. The key change instigated was a shiftin focus from accrediting qualifications to regulating awardingorganisations. A consultation period came to an end at thebeginning of February 2011, which aimed to establish theirrequirements and how best to respond to the responsibilitiesinherited from QCDA. Ofqual continue to be responsible formaintaining standards, improving confidence and distributinginformation about qualifications, examinations and assessments.As part of the responsibilities inherited from QCDA, and to fulfiltheir statutory obligation to inform the public about regulatedorganisations and qualifications, Ofqual are now also responsiblefor the Register of Regulated <strong>Qualifications</strong>. This replaces theNational Database of Accredited <strong>Qualifications</strong> (NDAQ), previouslymaintained by QCDA. The main difference between the twosystems is that whereas NDAQ contained details of all accreditedqualifications, the Register contains details of all regulatedqualifications. This ties into Ofqual’s new role regulating awardingorganisations, rather than accrediting qualifications.The new Register of Regulated <strong>Qualifications</strong> can be found at thefollowing link: http://register.ofqual.gov.uk/STUDENT NUMBER CONTROLS FOR <strong>2013</strong> ENTRYThe Higher Education Funding Council for England (HEFCE) capsthe number of publicly-funded undergraduate places for homeand EU students at English institutions. This is necessary to helpcontrol the budget for student finance. HEFCE introduced a newnumber controls for entry into higher education at Englishinstitutions in 2012. Universities and colleges were given thefreedom to expand their number of places for highly-qualifiedapplicants - defined as those holding AAB+ at A level orequivalent.For <strong>2013</strong> entry, HEFCE have moved the AAB+ and equivalent toABB+ and equivalent. This means that applicants who achieveABB+ and equivalent will not count towards an institutions corenumbers.Further information regarding this policy and the full HEFCE ABB+and equivalent list can be found on the HEFCE and UCASwebsites.WOLF REVIEWFrom 2014, only 70 ‘equivalent’ qualifications will count in schoolGCSE performance tables following the recommendations ofProfessor Alison Wolf’s review of vocational education. The keyrecommendations of the review were :gggggIncentivising young people to take the most valuablevocational qualifications pre-16, while removing incentives totake large numbers of vocational qualifications to thedetriment of core academic study.Introducing principles to guide study programmes for youngpeople on vocational routes post-16 to ensure they aregaining skills which will lead to progression into a variety ofjobs or further learning. In particular, to ensure that thosewho have not secured a good pass in English andmathematics GCSE continue to study those subjects.Evaluating the delivery structure and content ofApprenticeships to ensure they deliver the right skills for theworkplace.Making sure the regulatory framework moves quickly awayfrom accrediting individual qualifications to regulatingawarding organisations.Removing the requirement that all qualifications offered to14- to 19-year-olds fit within the <strong>Qualifications</strong> and Credit<strong>UK</strong> QUALIFICATIONS 15
IntroductiongFramework, which has had a detrimental effect on theirappropriateness and has left gaps in the market.Enabling FE lecturers and professionals to teach in schools,ensuring young people are being taught by those best suited.Further information regarding the Wolf review can be found onthe Department for Education’s website.WELSH QUALIFICATIONS REVIEWThe Welsh Government launched a review of qualifications for14-19 year olds in Wales in September 2011. The Review willmake recommendations for consideration by Welsh Ministers inNovember 2012. It aims to create a clear and simple systembased on coherent programmes of learning, with relevant, valued,internationally recognised qualifications underpinned byassessment that is robust, valid and proportionate and which willhelp drive improvements in literacy and numeracy. WelshMinisters have indicated that no significant changes will be madeto qualifications in Wales during the review, and that any changesin the future will take into account its recommendations.A LEVEL REFORMDuring the collation of this publication, Michael Gove (Secretary ofState for Education) announced his intention to reform A levels toensure that their ‘single, most important purpose’ is to prepareindividuals for higher education. The Minister feels thatuniversities should have greater involvement in the design andcontent of A levels and that this should occur during the creationof the qualification and after each examination cycle. Awardingorganisations will be asked to provide evidence of involvementfrom higher education before the qualification is accredited. It isthe Department for Education’s desire that these new A levels arelaunched in 2014, with the first examination in 2016.At the time of writing the outcomes of the Ofqual Consultationhad not been published.CURRICULUM FOR EXCELLENCECurriculum for Excellence seeks to build upon the principle of abroad general education whilst also allowing for flexibility of studyand stretches from the age of three to S3 and from S4 to S6.The purpose of the curriculum is to ensure all children and youngpeople in Scotland develop the knowledge, skills and attributesthey require to flourish in life, learning and work. The curriculumis focused on four capacities:ggggsuccessful learnersconfident individualsresponsible citizenseffective contributors.Further information can be found in the ‘<strong>Qualifications</strong> inScotland’ section of this guide.16 <strong>UK</strong> QUALIFICATIONS
The <strong>Qualifications</strong> and Credit Framework (QCF)The QCF allows learners’ achievement to be recognised andrecorded as they progress. It allows credit to be awarded for units(small steps of learning), and for the credits to be combined toallow for the award of a qualification. The flexibility of the systemallows learners to accumulate units and to work towards theachievement of the qualification most relevant for them.Ofqual, together with its partner regulators in Wales (DfES)and Northern Ireland (CCEA), is responsible for regulation of the<strong>Qualifications</strong> and Credit Framework (QCF). In Wales, the QCFforms part of the Credit and <strong>Qualifications</strong> Framework for Wales(CQFW). The framework is regulated to secure the validityand reliability of the award of qualifications within it and giveconfidence in the range of achievements across learners,subject areas and qualification types.DETAILS OF THE QCFUnits are the building blocks of all QCF qualifications. Thedevelopment of units within the QCF is explicitly separated fromthe development of rules of combination, the accreditation ofqualifications and the subsequent assessment of units and awardof credits and qualifications. The qualifications system has eightmain elements:ggggggggdeveloping unitsplacing units in the unit databankdeveloping qualificationsaccrediting qualificationsoffering units and qualifications to learnersassessing achievementawarding creditsawarding qualifications.QCF UNITSOfqual maintains a unit databank. Recognised awardingorganisations can place units in the unit databank without furtherintervention from Ofqual. Once units are in the databank, theymay be used to build qualifications. Awarding organisations userules of combination to group units together and developqualifications. At this point the units included in the qualificationare made available to learners and the qualification is offered foruse. The awarding organisation is responsible for carrying outassessments of units and awarding credits and qualifications.IDENTIFYING QCF QUALIFICATIONSEvery unit and qualification has a credit value and a level. Onecredit represents 10 notional hours of learning, showing howmuch time a learner working at the level of the unit would onaverage take to complete the unit or qualification. Levels indicatedifficulty and vary from entry (1) to level 8.The size of a qualification is indicated by use of one of thefollowing terms in its title:gggAward (1 to 12 credits)Certificate (13 to 36 credits)Diploma (37 credits or more)Awards, certificates and diplomas can exist at any of the levelsand the level is included in the qualification title. The title of aQCF qualification follows a standard format of the level, size anda description of the content, e.g. Level 3 Certificate in MechanicalEngineering Technology.(Note – where there are a range of qualifications from the sameawarding organisation within the award, certificate or diplomaband covering the same content and title these will be identifiedby the use of “subsidiary” and “extended”, e.g. subsidiarydiploma, diploma, extended diploma).REGULATORY PROCESSESOfqual recognises organisations that meet the regulatoryrequirements. Ofqual also monitors the performance ofrecognised organisations and the quality of the units andqualifications they develop.A list of all qualifications that have been referenced to the QCFcan be found at http://register.ofqual.gov.uk/ and this includestheir unit content as well as qualification and unit credit values.RELATIONSHIP TO THE NQF AND FHEQ (FRAMEWORKFOR HIGHER EDUCATION QUALIFICATIONS)England currently has two qualifications frameworks that non-HEqualifications may be referenced to: the QCF and the National<strong>Qualifications</strong> Framework (NQF). The levels of the NQF and QCFuse the same descriptors and have been referenced together.The Framework for Higher Education <strong>Qualifications</strong> (FHEQ)describes the achievement represented by higher educationqualifications. The framework applies to degrees, diplomas,certificates and other academic awards granted by a highereducation provider with degree-awarding powers. The NQF andQCF levels 4-8 and the FHEQ are referenced at the same levelsalthough the size of qualifications varies.<strong>UK</strong> QUALIFICATIONS 17
The <strong>Qualifications</strong> and Credit Framework (QCF)QUALIFICATION LEVELSThe following diagram shows how the framework levels relate to each other along with examples of qualifications at various levels.18 <strong>UK</strong> QUALIFICATIONS
<strong>Qualifications</strong> currently offeredABC Awards level 3 Diploma inFashion Retail [501/1540/6]QUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 3BACKGROUND:This qualification was originally developed in association with theFashion Retail Academy London. It has a uniqueness over existingprovision within this sector inasmuch as there is integratedlearning through practical application – in-store and academicactivities. This delivery and assessment approach ensures thelearners have a fulfilling experience in developing their personalattributes along with skills and knowledge to excel in the fashionretail industry and harbour an entrepreneurial talent.The Diploma has achieved full status within the QCF.PREREQUISITES:The level 2 Diploma in Fashion RetailorGCSE English and Mathematics grades A – C or level 2 equivalent.Aptitude and enthusiasm for the fashion retail industry.Minimum age 16 years.NUMBER OF UNITS/STRUCTURE:Learners must achieve a minimum of 79 credits. 47 credits mustcome from the mandatory level 3 units in Group A (5 units) and aminimum of 32 credits from the level 3 optional units in Group B.For further details see www.abcawards.co.uk/retail-/-warehousing-/-distribution/retail/.The qualification equates to a minimum of 576 GLH.ASSESSMENT METHOD:Internally assessed and internally and externally moderated.GRADING SYSTEM:Grade UCAS Tariff pointsDistinction 160Merit 120Pass 80The Associated Board of theRoyal Schools of Music (ABRSM)The Associated Board of the Royal Schools of Music (ABRSM)conducts around 650,000 exams in more than 90 countriesaround the world each year. ABRSM’s core activity is theoperation of an authoritative and internationally recognisedsystem of exams and assessments to encourage and motivateplayers and singers at all levels through the provision of goalsand measurement of progress.Exams are available for more than 30 instruments, singing, jazz,ensembles, practical musicianship and theory of music. Manystudents will start with the Prep Test, a simple and positiveassessment at the pre-Grade 1 level. Graded exams start fromGrade 1 and are numbered progressively in order of difficulty toGrade 8. The practical exams require candidates to demonstrateproficiency in set pieces, scales and arpeggios, sight-reading andaural skills. Theory of music exams give students opportunities toacquire: a knowledge of the notation of western music, includingthe signs and terminology commonly employed; an understandingof fundamental musical elements such as intervals, keys, scalesand chords; skill in constructing balanced rhythmic patterns orcompleting given melodic or harmonic structures; and an abilityto apply theoretical knowledge and understanding to scoreanalysis. For students who progress beyond Grade 8 ABRSMoffers professional diplomas (DipABRSM, LRSM and FRSM) inthree subject areas: performing, directing and teaching.ABRSM Graded Exams in MusicPerformance and Music TheoryQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Grades 1–3 = level 1Grades 4–5 = level 2Grades 6–8 = level 3BACKGROUND:ABRSM’s Graded Exams aim to provide a clear frameworkagainst which to measure musical development. They provideteachers and candidates with an authoritative and internationallyrecognised examination and assessment system to encourageand motivate players and singers at all levels, from the earlieststages to conservatoire entry level, through the provision of goalsand the measurement of progress.In their own time and at their own pace, candidates from widelydiverse backgrounds and with differing aspirations can derive benefitfrom ABRSM’s rigorous and educationally sound structure.To acknowledge levels of musicianship and attainment withingrades through the award of additional marks leading to Merit orDistinction in recognition of higher levels of:gggggtechnical fluencymusical understandinginterpretative insightsensitivity of responsecommunication skills.Grades 1–8 are available in Music Performance (piano, organ,violin, viola, cello, double bass, treble recorder, flute, oboe,clarinet, bassoon, saxophone, horn, trumpet, cornet, flugelhorn, Eflat horn, trombone, baritone, euphonium, tuba, guitar, harp,percussion and singing); music theory.Grades 1–5 are available in Music Performance (descantrecorder, jazz piano, jazz flute, jazz clarinet, jazz saxophone(soprano, alto and tenor), jazz trumpet, jazz cornet, jazzflugelhorn, jazz trombone).Grades 4–8 are available in Music Performance (harpsichord).Grades 6–8 are available in Music Performance (bass trombone).DATE OF FIRST AWARD:1889PREREQUISITES:Grade 5 in Music Theory, Practical Musicianship or a solo jazzsubject is required when taking Grade 6 or above in MusicPerformance.ASSESSMENT METHOD:ABRSM’s Graded Exams are assessed according to criterionreferencedmethods. Assessment is based on candidates fulfillingthe syllabus requirements against published criteria for eachelement of the exam. The criteria are published in ABRSM’s guideThese Music Exams, which is available free of charge on requestor as a downloadable PDF from http://www.abrsm.org/resources/theseMusicExams0607.pdf. Assessment is, therefore,manageable, safe and appropriate to the needs of learners. It is<strong>UK</strong> QUALIFICATIONS 19
<strong>Qualifications</strong> currently offeredbased on candidates fulfilling criteria against appropriate andcarefully chosen repertoire and supporting tests which provide alogical progression through the grades.Assessment is by individual examiners appointed by ABRSM.ABRSM uses generalist rather than specialist examiners, ieexaminers are engaged for their overall musicianship rather thanfor particular instrumental/vocal expertise.Techniques for applying the criteria are demonstrated in depthduring initial examiner training and in the subsequent in-serviceprocess.The entire assessment is carried out by the examiner appointedby ABRSM at the date and time specified. As each element of theexam is presented, the examiner makes a written record on themark form which describes what has been heard and supportsthe mark awarded against the criteria published for the grade.The standard of the exam is set by the pass marks andexaminers add or deduct marks from that. Marks are notawarded either by deduction from the maximum or by additionfrom zero.Each syllabus includes an outline of what the examiner will belooking for, eg for Piano candidates, the examiners will payattention to:gggggggggaccuracy of notesaccuracy of timequality of touchvariety and gradation of tonechoice of tempoobservance of marks of expressionrhythmphrasing and accentuse of practical fingering.EXAM TIMING:There are three main exam sessions a year (roughly in March-April, June-July and November-December).GRADING SYSTEM:The practical exams (Music Performance) require candidates todemonstrate proficiency in set pieces, scales and arpeggios,sight-reading and aural skills. Assessment is given at three levelsfor each exam: Distinction, Merit and Pass. 130 marks arerequired to pass with Distinction, 120 to pass with Merit, and100 to achieve a Pass, out of a possible 150 marks.Practical Grade UCAS Tariff pointsGrade 8 Distinction 75Grade 8 Merit 70Grade 8 Pass 55Grade 7 Distinction 60Grade 7 Merit 55Grade 7 Pass 40Grade 6 Distinction 45Grade 6 Merit 40Grade 6 Pass 25Theory Grade UCAS Tariff pointsGrade 8 Distinction 30Grade 8 Merit 25Grade 8 Pass 20Grade 7 Distinction 20Grade 7 Merit 15Grade 7 Pass 10Grade 6 Distinction 15Grade 6 Merit 10Grade 6 Pass 5QUALITY ASSURANCE:This is provided by the Examinations Board, which comprisestwo delegates from each of the four Royal Schools of Music inthe <strong>UK</strong> and is chaired by the Principal of one of the RoyalSchools, with ex-officio membership for the Chief Executive andChief Examiner.The entire assessment process takes place under the supervisionof the Examinations Board which:ggggratifies the appointment and dismissal of examinersratifies the appointment of examiner trainers and moderatorsmonitors all aspects of syllabus creation and developmentmonitors all examining activity.Complaints concerning the conduct of an exam or about theresult must in all cases be addressed to the Quality AssuranceManager for Grades.PROGRESSION/ARTICULATION:The syllabus structure from Prep Test to Grade 8 provides acarefully graded scheme which covers all levels. Each gradebuilds progressively on the skills of the previous level to provide alogical framework for progress.Skills are assessed consistently across all the grades withassessment components unchanged whilst demands ofrepertoire, technique, knowledge, ability and independence ofthought increase. ABRSM’s exams offer a framework forprogressive musical training against periodic, unbiasedassessment.ABRSM’s exams are listed as entry qualifications in the musicdepartment prospectuses of many universities (eg Durham,Bristol, Edinburgh and Birmingham), colleges of higher educationand conservatoires. In addition, they are used to illustrate thestandards required for entry to youth orchestras, choirs and othersimilar bodiesDiploma in the Principles ofInstrumental/Vocal TeachingLicentiate in Instrumental/Vocal TeachingFellowship in Music EducationQUALIFICATION ABBREVIATION:DipABRSM, LRSM and FRSMQUALIFICATIONS AND CREDIT FRAMEWORK LEVELS:DipABRSM – level 4LRSM – level 6FRSM – level 7BACKGROUND:The Instrumental/Vocal Teaching Diplomas are designed forcandidates who are intending to take up, or have alreadyembarked upon, the teaching of an instrument or instruments. Ateach level, skills as an instrumental teacher of individuals and/orgroups are explored and assessed in increasing depth.PREREQUISITES:DipABRSM – ABRSM Grade 8 Practical in the instrument taughtor a permitted substitution, and ABRSM Grade 6 Theory (1992syllabus).LRSM – DipABRSM (Principles of Instrumental/Vocal Teaching) inthe instrument taught or a permitted substitution, and ABRSMGrade 8 Theory (1992 syllabus).20 <strong>UK</strong> QUALIFICATIONS
<strong>Qualifications</strong> currently offeredFRSM – LRSM (Instrumental/Vocal Teaching) in the instrumenttaught or a permitted substitution.ASSESSMENT METHOD:Teaching Skills, Viva Voce, Written Submission, Quick Study and(LRSM only) Case Study Portfolio and Video of Teaching PracticeEXAM TIMING:Exams are held throughout the year.GRADING SYSTEM:Distinction, Pass or fail. Detailed criteria outlining the variouslevels of achievement and attainment descriptions are included inthe syllabus.QUALITY ASSURANCE:A Diploma Board oversees all matters relating to diplomas. Aswell as ratifying procedures and monitoring decisions taken by itscommittees, the Diploma Board advises on standards andconsiders all matters of quality assurance.Diploma in Music DirectionLicentiate in Music DirectionFellowship in Music DirectionQUALIFICATION ABBREVIATION:DipABRSM, LRSM and FRSMQUALIFICATIONS AND CREDIT FRAMEWORK LEVELS:DipABRSM – level 4LRSM – level 6FRSM – level 7BACKGROUND:The Music Direction diplomas are available for directors ofinstrumental groups or choirs. Live and written componentsdemonstrate command of directing technique in rehearsal andperformance, understanding of the repertoire and knowledge ofthe instruments and voices within the ensemble.PREREQUISITES:DipABRSM – ABRSM Grade 8 Practical or a permittedsubstitution.LRSM – DipABRSM (Music Direction) or a permitted substitution.FRSM – LRSM (Music Direction) or a permitted substitution.ASSESSMENT METHOD:DipABRSM and LRSM – Rehearsal and Performance (withprogramme notes), Viva Voce and Arrangement.FRSM – Rehearsal and Performance, Written Submission, VivaVoce and ArrangementEXAM TIMING:Exams are held throughout the year.GRADING SYSTEM:Distinction, Pass or fail. Detailed criteria outlining the variouslevels of achievement and attainment descriptions are included inthe syllabus.QUALITY ASSURANCE:A Diploma Board oversees all matters relating to diplomas. Aswell as ratifying procedures and monitoring decisions taken by itscommittees, the Diploma Board advises on standards andconsiders all matters of quality assurance.Diploma in Music PerformanceLicentiate in Music PerformanceFellowship in Music PerformanceQUALIFICATION ABBREVIATION:DipABRSM, LRSM and FRSMQUALIFICATIONS AND CREDIT FRAMEWORK LEVELS:DipABRSM – level 4LRSM – level 6FRSM – level 7BACKGROUND:The Music Performance diplomas are designed to reflectcandidates’ day-to-day experience as performers, whetheramateur or professional. As well as demonstrating skills as asoloist, from LRSM there is the opportunity to specialise in one ofthree roles: orchestral musician, chamber ensemble member orkeyboard accompanist.Subjects: piano, harpsichord, organ, violin, viola, cello, doublebass, guitar, harp, recorder, flute, oboe, clarinet, bassoon,saxophone, horn, trumpet, cornet in B flat, flugelhorn, E flat horn,trombone, baritone, euphonium, tuba, percussion, singing.PREREQUISITES:DipABRSM – ABRSM Grade 8 Practical in the instrumentpresented or a permitted substitution.LRSM – DipABRSM (Music Performance) in the instrumentpresented or a permitted substitution.FRSM – LRSM (Music Performance) in the instrument presentedor a permitted substitution.ASSESSMENT METHOD:DipABRSM and LRSM – Instrumental/vocal recital (withprogramme notes), Viva Voce and Quick Study.FRSM – Instrumental/vocal recital, Written Submission, Viva Voceand Quick Study.EXAM TIMING:Exams are held throughout the year.GRADING SYSTEM:Distinction, Pass or fail. Detailed criteria outlining the variouslevels of achievement and attainment descriptions are included inthe syllabus.QUALITY ASSURANCE:A Diploma Board oversees all matters relating to diplomas. Aswell as ratifying procedures and monitoring decisions taken byits committees, the Diploma Board advises on standards andconsiders all matters of quality assurance.Access to Higher EducationDiplomaQUALIFICATION ABBREVIATION:Access to HE DiplomaNATIONAL QUALIFICATIONS FRAMEWORK LEVEL:The Access to HE Diploma stands outside the NQF and QCF. Itwas recognised as a level 3 qualification in the Labour ForceSurvey and is regarded as level 3 equivalent for fundingpurposes.BACKGROUND:The Access to Higher Education Diploma replaced the Access toHE certificate in 2008/9. All Access to HE courses now lead to<strong>UK</strong> QUALIFICATIONS 21
<strong>Qualifications</strong> currently offeredthe award of the Access to HE Diploma. Applicants who startedan Access to HE course prior to 2008-09 may offer the Access toHE certificate.The first Access to HE courses were introduced in the late 1970sto provide a route into HE for mature students. A nationalframework for course recognition, now managed by the QualityAssurance Agency for Higher Education (QAA), has been in placesince 1989. The QAA Recognition Scheme for Access to HigherEducation (the Recognition Scheme) describes the regulatory andquality assurance arrangements for Access to HE courses, whichare managed at local level by Access Validating Agencies (AVAs).Full details of the Recognition Scheme are available atwww.accesstohe.ac.uk.AVAs develop and validate courses through partnershiparrangements with HE and FE institutions, and act as theawarding bodies for the Access to HE Diploma. There arecurrently 14 AVAs in England and Wales, which are licensed andregulated by QAA. Contact details for AVAs are given atwww.accesstohe.ac.uk/avas/contacts.aspAll recognised Access to HE Diplomas are listed on the Accesscourses database, which can be accessed from the Access to HEwebsite at www.accesstohe.ac.uk.QAA is currently conducting a review of the Access to HEDiploma specifications, to ensure that the qualification continuesto meet the needs both of adults taking it, and the HE institutionsto which those adults progress. For more information on thereview, please see www.accesstohe.ac.uk.PREREQUISITES:Access to HE courses are intended primarily for those who havefew, if any, formal qualifications. Some Access to HE courses mayrequire level 2 achievement or completion of a Pre-Accessprogramme, but any specific prerequisites for individual coursesare determined at local level.NUMBER OF UNITS/STRUCTURE:The Access to HE Diploma is a credit-based qualification whichrequires the achievement of 60 credits (with at least 45 achievedat level 3). A course leading to the Access to HE Diploma has aunitised structure and provides a planned, coherent programmeof study in a defined subject area. Access to HE Diplomas can bedeveloped in any subject approved by a validation panel, in orderto respond to student demand and HE progression opportunities.For each separately validated Access to HE Diploma, the required60 credits are derived from achievement on a specified set ofunits (defined by the rules of combination) which are approved atan AVA validation panel. Typically, courses include units in severalacademic subjects relevant to the particular Diploma, supportedby units in study skills and other core subjects. Units of Access toHE Diplomas vary in size (credit value), and the total number ondifferent courses may also vary. However, the total volume of 60credits is the same for all Access to HE Diplomas.Titles of Access to HE Diplomas indicate the subject of study in astandard format, for example, Access to HE (Nursing) or Accessto HE (Business Studies). Access to HE Diplomas may alsoprovide preparation for HE progression in a number of differentareas, for example, Access to HE (Humanities) or Access to HE(Combined Studies). There is no prescribed or limited set of titles,and details of curriculum for Access to HE Diplomas are approvedlocally. Diplomas issued by AVAs carry the specific award title,and include the QAA Access to HE logo, accompanied by thewords ‘recognised by the Quality Assurance Agency for HigherEducation’.ASSESSMENT METHOD:QAA requires assessment methods on Access to HE courses toprovide a range of assessment experiences which are appropriatefor a preparation for HE study in the named progression route.Student achievement for the award of the Access to HE Diplomais verified through a system of internal and external moderation,which is overseen and regulated by the AVA, according torequirements made by QAA.EXAMINATION TIMING:Determined by the provider at local level.DATE OF RESULT PUBLICATION:Determined by the AVA at local level. Results are normallyavailable from AVAs by the end of the first week in August.GRADING SYSTEM:There is a common system for grading the Access to HE Diploma,which was introduced in 2009-10 (applicants who completed anAccess to HE course prior to 2010 may present an ungradedqualification). It is a system of unit grading, with each level 3 unitachieved by a student being given a grade of pass, merit ordistinction. Because the number and size of units is not the samefor all Access to HE Diplomas, the number of grades achieved bystudents on different courses also varies. The total number ofgrades therefore reflects the structure of the particularprogramme of study and is unrelated to the student’s standard ofperformance. Achievement transcripts are issued with Access toHE Diplomas, which identify the set of named units achieved by astudent, together with the number of credits and grades achievedfor each unit. Grades are not aggregated or averaged. There is nooverall grade.A set of seven generic grade descriptors, specified by QAA,identifies types of performance that are relevant to study in HE.The descriptors provide the common definitions and a standardreference point for grading decisions on all Access to HEDiplomas. The award of a pass grade equates to the achievementof the learning outcomes of the unit, and there are separate setsof statements which identify the standard of performancerequired for the achievement of merit and distinction grades. Fulldetails of the grading system and specific advice for HEadmissions staff about making offers is available at is available atwww.accesstohe.ac.ukQUALITY ASSURANCE:The quality assurance of Access to HE is managed at regionaland course level by the AVAs, with requirements specified inQAA’s Recognition Scheme. AVAs’ procedures and practices aremonitored and reviewed by QAA.PROGRESSION/ARTICULATION:The Access to HE qualification has national recognition and maybe offered for entry to any <strong>UK</strong> HE undergraduate programme.Advanced Level ApprenticeshipNQF/QCF LEVEL:Advanced Level Apprenticeships (note: Intermediate LevelApprenticeships and Higher Apprenticeships are also available).BACKGROUND:Advanced Level apprentices work towards work-based learningqualifications such as NVQ Level 3, Key Skills and, in most cases,a relevant knowledge based certificate such as a BTEC. To startthis programme, apprentices should ideally have five GCSEs(grade C or above) or have completed an Intermediate LevelApprenticeship.Apprenticeships are increasingly recognised as the gold standardfor work-based training. There are over 85,000 employers22 <strong>UK</strong> QUALIFICATIONS
<strong>Qualifications</strong> currently offeredoffering Apprenticeships in more than 130,000 locations; thereare over 200 Apprenticeships suitable for hundreds of job roles.The Apprenticeships, Skills, Children and Learning Act, whichreceived royal assent on 12 November 2009, incorporates thegovernment’s plans for expanding and extending theapprenticeship programme. The act incorporates proposals thatwere originally published in July 2008 as the DraftApprenticeships Bill, which stated that ‘In the coming years thegovernment wants apprenticeships to be seen alongsideuniversity as a great option for young people who want the bestjobs, the best careers and the best chance to get on in life.Apprenticeships are key to the strategy to raise the age ofparticipation in education or training for all young people to 17from <strong>2013</strong> and to 18 from 2015, with high-quality vocationaltraining clearly recognised as a mainstream route for youngpeople’.National strategic responsibility for apprenticeships lies with theNational Apprenticeship Service. Local provision is commissionedwith local authorities.The Specification of Apprenticeship Standards for England (SASE)and The Specification of Apprenticeship Standards for Wales(SASW) released in early 2010 outline a standard Frameworkconstitution for Advanced Apprenticeships (AA):gcompetence and knowledge qualifications must beunderpinned by National Occupational Standards (NOS)gqualifications must be regulated by Ofqual to <strong>Qualifications</strong>and Credit Framework level 3 and be approved by therelevant Sector Skills Councilgto include functional skills in Mathematics and English atlevel 2, plus ICT at level 2 where it is directly relevant toperformance in the sectorgAA frameworks at minimum of 37 credits on QCF, with 10+credits from competence-based qualifications, and 10+ fromknowledge-based qualifications.All Advanced Apprenticeship frameworks in England and Walesstarted after 6 April 2011 will comply with these revisedspecifications.Potential changes in the new 2010 government’s approach toWelfare to Work are likely to create 400,000 new apprenticeshipsand work-based training places over two years.More information on apprenticeships can be found atwww.apprenticeships.org.ukDATE OF FIRST TEACHING:1995DATE OF FIRST AWARD:1997PREREQUISITES:Sector Skills Councils (SSCs) and Sector Bodies are responsiblefor determining and publishing entry criteria. SSCs and SectorBodies design the content of each Advanced Apprenticeshipalong with their employers.NUMBER OF UNITS/STRUCTURE:Dependent upon NVQ and other qualifications in the AdvancedApprenticeship framework. All advanced apprentices pursue acompetence element (which can be either a National VocationalQualification or a qualification accredited in the new <strong>Qualifications</strong>and Credit Framework) at a minimum of level 3, Key Skills at alevel set by each sector, and additional elements includingtechnical certificates, defined by employers as required in theirsectors (eg underpinning knowledge and understanding asdefined by relevant vocational education qualifications). Thetechnical certificate is often in the form of a BTEC or similarqualification, and is usually taken by the apprentice on a dayreleasebasis. The Apprenticeship Blueprint (2005) acknowledgedthat flexibility can be achieved by moving away from the threequalificationsapproach and puts emphasis on the need forapprentices to develop occupational competence, with thenecessary underpinning knowledge and the transferable or KeySkills with appropriate qualifications.ASSESSMENT METHOD:See NVQ. Most technical certificates may be assessed byexamination.GRADING SYSTEM:Pass/Fail of each element of the Advanced Apprenticeshipframework: NVQ, Key Skills, technical certificate.QUALITY ASSURANCE:Awarding organisation/Ofsted.PROGRESSION/ARTICULATION:Progression to FE and HE, including foundation degrees.Advanced Extension AwardQUALIFICATION ABBREVIATION:AEANATIONAL QUALIFICATIONS FRAMEWORK LEVEL:Level 3BACKGROUND:AEAs were introduced for advanced level students in England,Wales and Northern Ireland in summer 2002. They replacedSpecial (S) papers and were designed to challenge the most ableadvanced level students, ensuring that they were tested againststandards comparable with the most demanding found in othercountries. Candidates were assessed on their ability to apply andcommunicate effectively their understanding of the subject, usingthe skills of critical analysis, evaluation and synthesis.They were available to students whatever their school or collegeand whichever specification they were studying, and required noextra content to be taught. They also helped universitiesdifferentiate between the most able candidates, particularly insubjects with a high proportion of A grades at advanced level.Following the changes made to GCE A levels in 2008, specificallythe introduction of the A* and ‘stretch and challenge’, it wasdecided that AEAs were no longer required. They were thereforewithdrawn after the June 2009 examinations.The exception to this is the Mathematics AEA offered by Edexcel,which will continue to be available until at least August 2015.For a list of the subjects in which AEAs were available, please seeAppendix F.DATE OF FIRST TEACHING:2000DATE OF FIRST AWARD:2002PREREQUISITES:A candidate did not have to enter for the relevant awardingorganisation’s corresponding GCE A level. However, AEAs wereaimed at the top 10% of students nationally in each subject.Teachers should have been confident that candidates who wereentered for AEAs were likely to obtain grade A at A level in thesubject concerned.NUMBER OF UNITS/STRUCTURE:One unit.<strong>UK</strong> QUALIFICATIONS 23
<strong>Qualifications</strong> currently offeredASCENTISAscentis is the new name for OCNW. It is an Ofqual accreditedawarding organisation and is also a licensed Access ValidatingAgency for Access to Higher Education. Information on Ascentisand its qualifications is available on the Ascentis website atwww.ascentis.co.uk and on the Register of Regulated<strong>Qualifications</strong> at http://register.ofqual.gov.uk.ASCENTIS Level 3 Certificatein Understanding SubstanceMisuseQCF LEVEL:Level 3BACKGROUND:This qualification aims to develop knowledge and understandingwithin the area of substance misuse. In particular, thequalification focuses on a variety of drugs, their uses and effects.It also looks at relevant government legislation and advises onmethods that can be used in responding to substance misuse.DATE OF FIRST TEACHING:2009NUMBER OF UNITS/STRUCTURE:This is a three-unit qualification. All three units are mandatory inorder to achieve this qualification. A minimum of 13 credits isrequired overall.ASSESSMENT METHOD:Coursework and portfolio of evidenceGRADING SYSTEM:Pass/FailPROGRESSION/ARTICULATION:This qualification prepares the learner for more detailed study ofrelated issues at the same level or above. It prepares the learnerfor dealing with related issues within their employment, thusimproving their employability.ASCENTIS Level 3 Certificatein Learning SupportQCF LEVEL:Level 3BACKGROUND:The aim of the certificate is to provide those who want to belearning support practitioners with the underpinning knowledge,understanding and skills in order to effectively fulfil the generalistlearning support practitioner role.The main purpose of this qualification is:ggggto provide a sound educational basis for supporting learningin a wide range of learning institutions within the lifelonglearning sectorto develop the necessary knowledge, skills and attributes forsupporting learning in a wide range of learning institutionswithin the lifelong learning sectorto promote personal and professional developmentto promote evaluation and reflection on personal and learningsupport practice.DATE OF FIRST TEACHING:2009NUMBER OF UNITS/STRUCTURE:6 credits must be obtained from group 1. This can be achieved atlevel 2 or 3.18 credits must be obtained from group 2. All credits within thisgroup must be achieved at level 3.A minimum of 6 credits must be obtained from group 3. This canbe achieved at level 2 or 3. Learners can opt to take anadditional 6 credits from group 3 if they wish.A minimum of 30 credits is required to achieve this qualification.ASSESSMENT METHOD:Portfolio of evidence and practical demonstration/assignment.GRADING SYSTEM:Pass/FailPROGRESSION/ARTICULATION:Completion of this qualification can lead to employment as alearning support assistant.ASCENTIS Level 3 Certificatein Teaching in the LifelongLearning SectorQCF LEVEL:Level 3BACKGROUND:The aim of the certificate is to provide teachers, trainers andtutors in an associate teaching role with the underpinningknowledge, understanding and skills in order to effectively fulfilthe associate teacher role.ObjectivesggggTo provide a sound educational basis for teaching in a widerange of learning institutions.To develop the necessary knowledge, skills and attributes forteaching in a wide range of learning institutions.To encourage personal and professional development.To encourage evaluation and reflection on personal andprofessional practice.DATE OF FIRST TEACHING:2009NUMBER OF UNITS/STRUCTURE:This is a 24 credit qualification made up of three units fromGroup 1 totalling 18 credits, and optional units from Group 2totalling at least 6 credits. To complete the qualification all threemandatory units in Group 1 must be achieved. A candidate mustalso complete 6 credits from Group 2.ASSESSMENT METHOD:Portfolio of evidence. 30 hours of teaching practice needs to becompleted, of which there must be at least three observationstotalling a minimum of three hours.GRADING SYSTEM:Pass/FailPROGRESSION/ARTICULATION:Students wishing to progress to a full teaching role, and seekingQualified Teacher Learning and Skills Status, will need toprogress to the Level 5 Diploma in Teaching in the LifelongLearning Sector. Some of the achievement from this certificatecan count towards achievement of the diploma qualification.<strong>UK</strong> QUALIFICATIONS 25
<strong>Qualifications</strong> currently offeredBedales Assessed CoursesBACKGROUND:Bedales Assessed Courses (BACs) are exclusive to BedalesSchool, and were devised and introduced in 2006. They replacedthe school’s previous GCSE provision in 10 subject areas, andwere a response to the perception of staff, students and parentsthat GCSEs in these subjects were too restrictive, insufficientlystimulating, and too narrowly assessed. They are designed to bebetter preparation for A level, incorporate a wider range ofassessment methods, encourage more independent learning, andstimulate cross-curricular thinking.DATE OF FIRST TEACHING:September 2006DATE OF FIRST AWARD:August 2008PREREQUISITES:These courses are only undertaken by students in years 10-11 ofBedales School, an independent secondary school in Hampshire.NUMBER OF UNITS/STRUCTURE:There are Bedales Assessed Courses in Ancient Civilisations, Art,Classical Music, Dance, Design, English Literature, Geography,Outdoor Work, ‘Philosophy, Religion and Ethics’, and Theatre Arts.Each student takes 2-5 BAC courses alongside a core of 5-8GCSEs. BACs are given the same timetable and homework timeas GCSEs. Most Bedales students thus study and are assessed ineither nine or 10 subjects.ASSESSMENT METHOD:A range of assessment methods is employed, includingcoursework, terminal exams, oral assessment, performance andcontinuous assessmentEXAMINATION TIMING:There are assessment points throughout the two year courses.DATE OF RESULT PUBLICATION:Bedales School publishes the BAC results to coincide with GCSEresults in August.GRADING SYSTEM:A*-G grades are awarded, in line with the GCSE scheme. Urepresents unclassified, ie of insufficient standard to be recorded.It is intended that a grade in a BAC is at least as difficult toachieve as the equivalent GCSE grade, though precisecomparison is not possible, since assessment objectives in BACsare tailored to the demands of each subject and are often morefocused on creativity, independence of thought and crosscurricularawareness as well as the more traditional areas ofknowledge, understanding and evaluation.QUALITY ASSURANCE:Each course is internally assessed and moderated, but finalmoderation is undertaken by an independent external specialist inthe subject area.PROGRESSION/ARTICULATION:Bedales Assessed Courses are intended to be rigorous andstimulating preparation for sixth form study.The British Horse Society<strong>Qualifications</strong>The British Horse Society (BHS) is Britain's leading equestriancharity. It is also the governing body for professional qualificationsfor those wishing to work in the horse industry. The specific aimsof the Society centre on equine welfare. The BHS achieves theseby constantly striving towards improved knowledge througheducation, training and advice. It lobbies government on issuesconcerning equestrian-related issues.Equestrian <strong>Qualifications</strong> GB Limited (EQL) is a subsidiarycompany of the British Horse Society and is the Awarding Bodyfor Equestrian Activity. EQL awards vocational qualifications onbehalf of the BHS and awards the government-backed ScottishVocational <strong>Qualifications</strong> and Work Based Diplomas. EQL alsoawards the <strong>UK</strong>CC Endorsed Certificates in Coaching on behalf ofthe British Equestrian Federation.The British Horse Society has restructured its qualifications in linewith QCF requirements and now offers “bite-sized” awards andcertificates as well as the “traditional” qualifications.EQL Level 3 Diploma in BHSHorse Knowledge and CareHolders will have demonstrated their ability to look after up tofour horses in stables and at grass. During the examination, theywill have shown competent use of time and will have givenpractical demonstrations, as well as showing knowledge andunderstanding to the level required as outlined in the examinationsyllabus.GRADING SYSTEM:Pass/Fail.Grade UCAS Tariff pointsPass 35EQL Level 3 Certificate in HorseCareHolders will be able to fit tack and equipment to horses forcompetition and to analyse the consequences of ill-fitting tack.They will know procedures for travelling horses to and fromcompetition and understand the aftercare and welfare of thecompetition horse. Holders will be able to evaluate a horse’sconfirmation and how it may affect its way of going. They will alsobe able to lunge a fit horse for exercise.GRADING SYSTEM:Pass/FailEQL Level 3 Award in thePrinciples of Horse CareHolders will understand the value of a balanced diet for horsesand how to manage stock control, ordering, storage and wastedisposal of feed stuffs. They will understand how to get horses fitfor medium work. In addition, holders will know and understandhorse behaviour, care and welfare of horses when stabled orturned out. They will know about stable yard design andconstruction and about the management of grassland pasture forhorses.GRADING SYSTEM:Pass/FailEQL Level 3 Diploma in BHSRiding HorsesHolders will have demonstrated their ability to ride a variety ofhorses under a variety of circumstances on the flat and over acourse of show jumps up to 1m/3’3” and a cross country course26 <strong>UK</strong> QUALIFICATIONS
<strong>Qualifications</strong> currently offeredup to 90cm. They will have shown they are tactful yet effectiveriders, to the level required as outlined in the examinationsyllabus.GRADING SYSTEM:Pass/Fail.Grade UCAS Tariff pointsPass 35EQL Level 3 Certificate in RidingHorses on the FlatHolders will have demonstrated their ability to ride a variety ofhorses under a variety of circumstances on the flat to “NoviceDressage” level, showing a secure, supple, independent andbalanced position.GRADING SYSTEM:Pass/FailEQL Level 3 Certificate in BHSPreliminary Teaching of HorseRidingHolders will have demonstrated their ability to apply the basicprinciples of teaching and will have shown that they are able toimprove their pupil's horsemanship progressively. They will haveshown that they understand the safety procedures and principlesin the organisation of a lesson or hack, and have the ability togive a class lesson, lunge or lead rein lesson. They will havediscussed and answered questions on various topics to the levelas outlined in the examination syllabus.GRADING SYSTEM:Pass/FailGrade UCAS Tariff pointsPass 35EQL Level 2 Award in thePrinciples of Coaching SportHolders will understand the fundamentals of coaching sport. Theywill know and understand how to develop participants throughcoaching sport and will know how to support participants’ lifestylethrough coaching sport. They will understand the principles ofsafe and equitable coaching practice.GRADING SYSTEM:Pass/FailThe above certificates are government recognised and areaccredited onto the <strong>Qualifications</strong> and Credit Framework.EQL level 3 Diploma in Riding Horses, EQL level 3 Diploma inBHS Horse Knowledge and Care and EQL level 3 Certificate inBHS Preliminary Teaching of Riding Horses have each beenawarded UCAS Tariff points with effect from 2008 entry to highereducation.Holders of the level 3 Certificate in Preliminary Teaching of RidingHorses may convert this qualification to the <strong>UK</strong>CC Endorsed EQLlevel 2 Certificate in Coaching (Equine).Council for Awards in Care,Health and EducationThe Council for Awards in Care, Health and Education (CACHE) isan internationally recognised, specialist awarding organisation forEarly Years, Health and Social Care, Education, Playwork andChildren’s Services.CACHE offers qualifications from Entry level to level 5. Informationon some of CACHE’s level 3, 4 and 5 qualifications is listed inthis publication. Further information on the full range ofqualifications is available on the CACHE website ww.cache.org.ukor by contacting CACHE’s head office as listed in Appendix A.CACHE Level 3 Diploma for theChildren and Young People’sWorkforce (QCF)QCF LEVEL:Level 3BACKGROUND:This qualification has been developed to guide and assessdevelopment of knowledge and skills relating to early years andchildcare, social care and the learning development and supportservices workforces. This qualification confirms competence inthese areas where appropriate and serves as the requiredqualification (for all new practitioners) for registration andregulatory requirements in the childcare sector.DATE OF FIRST TEACHING:2010DATE OF FIRST AWARD:2011PREREQUISITIES:There are no formal entry requirements for this qualification butlearners will need to be at least 16 years of age.NUMBER OF UNITS/STRUCTURE:Learners must gain a minimum of 65 credits to achieve thediploma. To do this they must achieve 27 credits from mandatoryGroup A. Learners must select one mandatory pathway fromGroups C, D or E.Learners selecting Group C (Early Learning and Childcare) mustachieve 22 credits.Learners selecting Group D (Social Care) must achieve 13 credits.Learners selecting Group E (Learning, Development and SupportServices) must achieve 13 credits.The remaing credits must be achieved from Group F.ASSESSMENT METHOD:Coursework, portfolio of evidence and practical demonstration/assignment.GRADING SYSTEM:PassQUALITY ASSURANCE:Customer Quality Advisers check a sample of assessment plans,assessor feedback to learners and a sample of marked andinternally verified assignments. They also talk to a number oflearners.PROGRESSION/ARTICULATION:It is anticipated that learners selecting Group C (Early Learningand Childcare) will progress to a relevant Foundation/HonoursDegree.<strong>UK</strong> QUALIFICATIONS 27
<strong>Qualifications</strong> currently offeredIt is anticipated that learners selecting Group D (Social Care) willprogress to the Level 4/5 Diploma in Health and Social Care orLevel 4/5 Diploma for Leadership and Management for CareServices or a relevant Foundation/Honours Degree.It is anticipated that learners selecting Group E (Learning,Development and Support Services) will progress to the Level 4/5Diploma in Learning, Development and Support Services or arelevant Foundation/Honours Degree.Learners can also progress to the CACHE Level 3 ExtendedDiploma for the Children and Young People’s Workforce (QCF) andthe CACHE Level 5 Diploma in Leadership for Health and SocialCare and Children and Young People's Services (England) (QCF)Dependent on the pathway chosen, learners can also progress tothe following job roles:gggggggggggggPre-school workerPre-school managersNursery managersCrèche assistants and managersPractitioner in a children’s centrePractitioner in day nurseries, nursery schools or receptionclasses in primary schoolsRegistered childminders and nanniesEducation support workers who visit families of pre-schoolchildren in their homesFoster carersRegistered managers of children’s homes, plus deputy andassistant managersResidential childcare workersYouth workersLearning mentors.CACHE Level 3 ExtendedDiploma for the Children andYoung People’s Workforce (QCF)QCF LEVEL:Level 3BACKGROUND:This qualification allows learners to work with children aged frombirth to 19 years. The aim and purpose of this qualification is toprovide a full-time, level 3, two year qualification primarily tomeet the needs of learners between the ages of 16-19 wishingto proceed to full-time higher education. This qualificationprovides an alternative to A levels.DATE OF FIRST TEACHING:2011DATE OF FIRST AWARD:End 2012PREREQUISITIES:Learners must be aged at least 16 years of age. It isrecommended that learners have achieved GCSE in English andMathematics.NUMBER OF UNITS/STRUCTURE:Stage 1: Learners must achieve the Level 3 Diploma for theChildren and Young People’s Workforce (QCF).Stage 2: Learners must achieve Extended Diploma MandatoryUnits – 65 credits, Extended Diploma Optional Units – 20 credits.On achievement of appropriate mandatory and optional units, thequalification grade will be grade E.Stage 3: Learners must achieve the three Extended Assessments.On achievement of all three Extended Assessment, thequalification grade will be grade A*-D.ASSESSMENT METHOD:Level 3 Children and Young People’s Workforce Units will beinternally assessed by coursework, portfolio of evidence andpractical demonstration/assignment.Level 3 Extended Diploma mandatory and optional units will beinternally assessed using a range of methods which includedirect observation within the workplace, a portfolio of evidence,written assignments. All Assessment and Tasks are set byCACHE.The Assessment Tasks set for the Extended Units are mandatory.The three Extended Assignments will need to be completed toachieve grades A*-D.All units are assessed in line with the Skills for Care andDevelopment Assessment Strategy.GRADING SYSTEM:A* - ELearners achieving the Level 3 Diploma for the Children andYoung People’s Workforce (QCF) will receive a Pass grade.Learners achieving the Extended Units using the AssessmentTasks provided in this qualification will achieve a grade E.Learners completing the three Extended Assessments canachieve a grade from A*-D.The following UCAS Tariff points are awarded on completion ofthis qualification:A* 420A 340B 290C 240D 140E 80QUALITY ASSURANCE:Quality Assurance is undertaken by CACHE’s Customer QualityAdvisers either during a site visit or via a remote monitoringactivity and always includes the sampling of learner work.Centre Advisers check a sample of assessment plans, assessorfeedback to learners and a sample of marked and internallyverified assignments. They also talk to a number of learners.PROGRESSION/ARTICULATION:Learners can progress to higher education.Dependent on the pathway chosen with the Level 3 ExtendedDiploma for the Children and Young People’s Workforce (QCF),learners can also progress to the following job roles:gggggggggggggPre-school workerPre-school managersNursery managersCrèche assistants and managersPractitioner in a children’s centrePractitioner in day nurseries, nursery schools or receptionclasses in primary schoolsRegistered childminders and nannies.Education support workers who visit families of pre-schoolchildren in their homesFoster carersWorkers in children’s homesResidential childcare workersYouth workersLearning mentors.28 <strong>UK</strong> QUALIFICATIONS
<strong>Qualifications</strong> currently offeredCACHE Level 3 Diploma forChildren’s Care, Learning andDevelopment (Wales andNorthern Ireland) (QCF)QCF LEVELLevel 3BACKGROUND:This qualification is designed to help learners build the knowledgeand skills needed when working with children and young peoplefrom birth to 19 years of age. It covers a diverse range of jobroles and occupational areas working in children’s settingsincluding early years.DATE OF FIRST TEACHING:2011DATE OF FIRST AWARD:2012PREREQUISITES:There are no formal entry requirements for this qualification butlearners will need to be at least 16 years of age.NUMBER OF UNITS/STRUCTURE:Learners must gain a minimum of 65 credits to achieve the level3 Diploma for Children's Care, Learning and Development. To dothis they must achieve 49 credits from Mandatory Group A. Theremaining credits must be achieved from Optional Group B.ASSESSMENT METHOD:Coursework, Portfolio of Evidence, PracticalDemonstration/Assignment.Units must be assessed in line with the Skills for Care andDevelopment or LL<strong>UK</strong> Assessment Strategies. This is dependenton the units taken by the learner.GRADING SYSTEM:PassQUALITY ASSURANCE:Customer Quality Advisers check a sample of assessment plans,assessor feedback to learners and a sample of marked andinternally verified assignments. They also talk to a number oflearners.PROGRESSION/ARTICULATION:Learners can progress to Foundation Degrees.Learners can also progress to the following job roles:ggggggggggggggPre-school workerPre-school managersNursery managersCrèche assistants and managersPractitioner in a children’s centrePractitioner in day nurseries, nursery schools or receptionclasses in primary schoolsRegistered childminders and nannies.Education support workers who visit families of pre-schoolchildren in their homesFoster carersWorkers in children’s homesResidential childcare workersYouth workersLearning mentorsCylch Meithrin worker.CACHE Level 3 Diploma inPlaywork (NVQ) (QCF)QCF LEVELLevel 3BACKGROUND:This qualification provides in depth information about the role ofthe level 3 Playworker when working with children and youngpeople between the ages of 4 to 16. It allows learners to gainunderstanding of the management of play environments and theline management of other staff.The Diploma covers the knowledge and skills needed whenworking unsupervised and requires the learner to demonstratethese in the workplace. It is aimed at experienced playworkerswho have a wide knowledge and understanding of children andyoung people and a deep appreciation of playwork principles andpractice.DATE OF FIRST TEACHING:2010DATE OF FIRST AWARD:2011PREREQUISITES:There are no formal entry requirements for this qualification butlearners will need to be at least 18 years of age.NUMBER OF UNITS/STRUCTURE:The learner must achieve a total of 65 credits from 13 mandatoryunits, including the 9 Award and Certificate units, plus aminimum of 19 credits from the optional units.ASSESSMENT METHOD:Coursework, Portfolio of Evidence, PracticalDemonstration/Assignment.All units must be assessed in line with the SkillsActiveAssessment Strategy.GRADING SYSTEM:PassQUALITY ASSURANCE:Customer Quality Advisers check a sample of assessment plans,assessor feedback to learners and a sample of marked andinternally verified assignments. They also talk to a number oflearners.PROGRESSION/ARTICULATION:On completing this qualification, learners could work in roles suchas:ggggggPlayworkerWorker in a holiday clubPlaywork development officerAdventure centre supervisorHospital playworkerManager of any playwork provisionsLearners can also progress to a Foundation Degree.CACHE Level 3 Diploma inSpecialist Support for SupportingTeaching and Learning inSchools (QCF)QCF LEVELLevel 3<strong>UK</strong> QUALIFICATIONS 29
<strong>Qualifications</strong> currently offeredBACKGROUND:This qualification provides learners with an in-depthunderstanding of the knowledge and skills needed when workingdirectly with children and young people in school environments. Itcovers all aspects of specialist support including planning,delivering and reviewing assessment strategies to supportlearning alongside the teacher, bilingual and special needssupport and personal development and reflective practice.DATE OF FIRST TEACHING:2010DATE OF FIRST AWARD:2011PREREQUISITES:There are no formal entry requirements for this qualification butlearners will need to be at least 16 years of age.NUMBER OF UNITS/STRUCTURE:The learner must achieve all 11 mandatory units, totalling 32credits, plus 12 credits from a group of 38 optional units, toachieve the diploma. Of the 44 credits required to achieve thediploma, 40 of them must be at or above the level of thequalification (level 3). There are required combinations, a barredcombination and an exemption within the optional units.ASSESSMENT METHOD:Coursework, Portfolio of Evidence, PracticalDemonstration/Assignment.All units must be assessed in line with the TDA AssessmentPrinciples.GRADING SYSTEM:PassQUALITY ASSURANCE:Customer Quality Advisers check a sample of assessment plans,assessor feedback to learners and a sample of marked andinternally verified assignments. They also talk to a number oflearners.PROGRESSION/ARTICULATION:Foundation Degree or into the education workforceCACHE Level 3 Certificate inLearning Support (QCF)QCF LEVELLevel 3BACKGROUND:This qualification covers the key issues relating to learningsupport practice when working with young people and adults,including; approaches and principles to learning and learningsupport in lifelong learning contexts.DATE OF FIRST TEACHING:2009DATE OF FIRST AWARD:2010PREREQUISITES:There are no formal entry requirements for this qualification butlearners will need to be at least 18 years of age.NUMBER OF UNITS/STRUCTURE:Learners must complete one unit from group A (6 credits), threeunits from group B (18 credits) and at least 6 credits (maximum12 credits) from Group C. Learners must complete a total of 30credits to achieve the Certificate in Learning Support.ASSESSMENT METHOD:Practical demonstration/assignment.All units must be assessed in line with the LL<strong>UK</strong> AssessmentStrategy.GRADING SYSTEM:PassQUALITY ASSURANCE:Customer Quality Advisers check a sample of assessment plans,assessor feedback to learners and a sample of marked and internallyverified assignments. They also talk to a number of learners.PROGRESSION/ARTICULATION:Specialist or management qualifications at level 4 or into theeducation workforce.CACHE Level 3 Diploma inHealth and Social Care (Adults)for England (QCF)QCF LEVELLevel 3BACKGROUND:This qualification develops the knowledge and skills needed whenworking in a senior role with adults in health and social careenvironments. It covers a wide range of areas includingsupporting individuals with their physical and emotional care,daily living needs and health care procedures.It has three pathways:gggGeneric Health and Social CareDementiaLearning DisabilityDATE OF FIRST TEACHING:2011DATE OF FIRST AWARD:2012PREREQUISITES:There are no formal entry requirements for this qualification butlearners will need to be at least 16 years of age.NUMBER OF UNITS/STRUCTURE:Learners must achieve a minimum of 58 credits to gain the level3 Diploma in Health and Social Care (Adults) for England (QCF).To do this they must achieve: - 28 credits from Mandatory groupA - 30 credits from Pathway Group P1, P2 or P3. - learners canclaim an endorsed pathway (P2) (Dementia) if their achievementincludes Unit DEM 301 plus unit DEM 304 or DEM 312 or DEM313 - learners can claim an endorsed pathway (P3) (Adults withLearning Disabilities) if their achievement includes Unit LD 201plus unit LD 302 or LD 303.ASSESSMENT METHOD:Portfolio of evidenceAll units must be assessed in line with the Skills for Care andDevelopment and Skills for Health Assessment Strategy.GRADING SYSTEM:PassQUALITY ASSURANCE:Customer Quality Advisers check a sample of assessment plans,assessor feedback to learners and a sample of marked and30 <strong>UK</strong> QUALIFICATIONS
<strong>Qualifications</strong> currently offeredinternally verified assignments. They also talk to a number oflearners.PROGRESSION/ARTICULATION:It is anticipated that learners will join the social care workforceworking in domiciliary care or in residential care homes, progressto level 5 QCF qualifications for management or seniorpractitioner roles in health and social care, or to specialistqualifications reflecting the context in which they work.CACHE Level 3 Diploma inHealth and Social Care (Adults)for Wales and Northern Ireland(QCF)QCF LEVELLevel 3BACKGROUND:This qualification develops the knowledge and skills needed whenworking in a senior role with adults in health and social careenvironments. It covers a wide range of areas includingsupporting individuals with their physical and emotional care,daily living needs and health care procedures.Learners wishing to work as social workers in Wales are requiredto take the specialist unit ‘Understand sensory loss’.DATE OF FIRST TEACHING:2011DATE OF FIRST AWARD:2012PREREQUISITES:There are no formal entry requirements for this qualification butlearners will need to be at least 16 years of age.NUMBER OF UNITS/STRUCTURE:Learners must achieve a minimum of 58 credits to gain the level3 Diploma in Health and Social Care (Adults) for Wales andNorthern Ireland (QCF).To do this they must achieve: - 28 credits from the mandatoryunits in Group A - a minimum of 2 credits and a maximum of 7credits from the optional units in Group B (Note: UnitM/601/3467, SS MU 3.1: 'Understand sensory loss' is requiredfor social care workers in Wales) - at least 23 credits from theoptional units in Group C.ASSESSMENT METHOD:Portfolio of evidence.All units must be assessed in line with the Skills for Care andDevelopment Assessment Strategy.GRADING SYSTEM:PassQUALITY ASSURANCE:Customer Quality Advisers check a sample of assessment plans,assessor feedback to learners and a sample of marked andinternally verified assignments. They also talk to a number oflearners.PROGRESSION/ARTICULATION:It is anticipated that learners will join the social care workforceworking in domiciliary care or in residential care homes, progressto level 4 and level 5 QCF qualifications for management orsenior practitioner roles in health and social care, or to specialistqualifications reflecting the context in which they work.CACHE Level 3 Diploma inHealth and Social Care (Childrenand Young People) for Wales andNorthern Ireland (QCF)QCF LEVELLevel 3BACKGROUND:This qualification develops the knowledge and skills needed whenworking with children and young people in health and social careenvironments. It covers a wide range of areas such as supportingchildren and young people with their physical or emotional care,daily living needs and behaviour management.DATE OF FIRST TEACHING:2011DATE OF FIRST AWARD:2012PREREQUISITES:There are no formal entry requirements for this qualification butlearners will need to be at least 16 years of age.NUMBER OF UNITS/STRUCTURE:Learners must achieve a minimum of 58 credits to gain the level3 Diploma in Health and Social Care (Children and Young People)for Wales and Northern Ireland (QCF).To do this they must achieve: - 40 credits from the mandatoryunits in Group A - at least 18 credits from the optional units inGroup B.ASSESSMENT METHOD:Portfolio of evidence.All units must be assessed in line with the Skills for Care andDevelopment Assessment Strategy.GRADING SYSTEM:PassQUALITY ASSURANCE:Customer Quality Advisers check a sample of assessment plans,assessor feedback to learners and a sample of marked andinternally verified assignments. They also talk to a number oflearners.PROGRESSION/ARTICULATION:It is anticipated that learners will join the social care workforceworking in domiciliary care or in residential care homes, progressto level 4 and level 5 QCF qualifications for management orsenior practitioner roles in health and social care, or to specialistqualifications reflecting the context in which they work.CACHE Level 5 Diploma inLeadership for Health and SocialCare and Children and YoungPeople's Services (England)(QCF)QCF LEVELLevel 5BACKGROUND:This qualification provides learners with the skills and knowledgeneeded to manage practice and lead others in adult health andsocial care provision or in children and young people’s services. Ithas six pathways - three for those working with adults and three<strong>UK</strong> QUALIFICATIONS 31
<strong>Qualifications</strong> currently offeredfor those working with children and young people - and covers awide range of topics including:ggggggggSafeguarding and protectionManaging care servicesSupporting development and partnership workingContributing to broader activities such as changeprogrammes and recruitmentComplying with quality systems and continuously improvingqualityDeveloping and carrying out policyPromoting and developing best practiceCare management.The Management pathways are most suitable for AssistantManagers and Deputy Managers working in day or domiciliaryservices who are looking to progress their career. It is alsoappropriate for Managers who have not yet achieved a vocationalqualification at this level.The Residential Services pathways are aimed at learners insimilar job roles as those taking the Management pathways butthe focus is on management and care in residential settings.The Advanced Practice pathways are geared towards seniorpractitioners who would like to develop their career but wish toremain active practitioners within the management framework.DATE OF FIRST TEACHING:2011DATE OF FIRST AWARD:2012PREREQUISITES:There are no formal entry requirements for this qualification butlearners will need to be at least 19 years of age.NUMBER OF UNITS/STRUCTURE:All learners must achieve the 5 units from mandatory group A.They must then select one of the 6 pathways and complete allunits in the Core unit group (Groups C1, D1, E1, F1, G1 or H1).Learners taking groups C, D, F or G must take a minimum of 12credits from the Optional Management Group (C2, D2, F2 or G2)and make up the remainder of credits up to the 80 required toachieve the Diploma from the remaining Optional Unit Groups (C3& 4, D3 & 4, F3 & 4 or G3 & 4). Of these remaining credits, amaximum of 6 credits can be taken from the Optional KnowledgeGroup (C3, D3, F3 or G3). Learners taking Pathways E or H mustmake up the remainder of credits up to the 80 required to achievethe Diploma from the Optional Unit Groups (E2, E3 & E4 or H2, H3& H4). Of these remaining credits, a maximum of 6 credits can betaken from the Optional Knowledge Group (E3 or H3).ASSESSMENT METHOD:Coursework, Portfolio of Evidence, PracticalDemonstration/Assignment.All units must be assessed in line with the Skills for Care andDevelopment Assessment Strategy.GRADING SYSTEM:PassQUALITY ASSURANCE:Customer Quality Advisers check a sample of assessment plans,assessor feedback to learners and a sample of marked andinternally verified assignments. They also talk to a number oflearners.PROGRESSION/ARTICULATION:It is anticipated that learners will be able to progress fromadvanced practitioner to manager status via this qualification. It isalso anticipated that it will provide access to higher educationopportunities.CACHE Level 4 Certificate inLeading the Internal QualityAssurance of AssessmentProcesses and Practice (QCF)QCF LEVELLevel 4BACKGROUND:This qualification covers understanding and internally assuringthe quality of assessment, as well as planning, allocating andmonitoring work in the learner’s own area of responsibility.DATE OF FIRST TEACHING:2010DATE OF FIRST AWARD:2011PREREQUISITES:There are no formal entry requirements for this qualification butlearners will need to be at least 19 years of age.NUMBER OF UNITS/STRUCTURE:Learners must complete all the units within Group A to gain 17credits and achieve the Certificate.ASSESSMENT METHOD:Portfolio of evidence.This qualification must be assessed in line with the LL<strong>UK</strong>Assessment Strategy.GRADING SYSTEM:PassQUALITY ASSURANCE:Customer Quality Advisers check a sample of assessment plans,assessor feedback to learners and a sample of marked and internallyverified assignments. They also talk to a number of learners.PROGRESSION/ARTICULATION:Other level 4 qualifications for External Quality Assurance.CACHE Level 3 Award,Certificate and Diploma inChildcare and EducationNATIONAL QUALIFICATIONS FRAMEWORK LEVEL:Level 3BACKGROUND:This qualification prepares learners to work unsupervised, or in asupervisory capacity, with children and their families in a variety ofsettings and environments within the sector of Children’s Services. Itcovers many of the National Occupation Standards for Children’sCare, Learning and Development. The qualification is split into theAward, Certificate and Diploma, with the Award and Certificatebuilding towards the Level 3 Diploma. It is expected that mostlearners will progress through the Award and Certificate to completethe Diploma in order to be able to work as an early years practitioner.Throughout the Diploma level of the qualification, learners areexpected to complete recommended hours of professionalpractice in a variety of settings and specified age ranges in orderto apply theoretical knowledge in a practical environment. Thiswill be assessed through Practice Evidence Records, ProfessionalEvidence Record Diaries and Professional Development Profiles.It is recommended that some practical training be undertakenduring study for the Award and Certificate.32 <strong>UK</strong> QUALIFICATIONS
<strong>Qualifications</strong> currently offeredDATE OF FIRST TEACHING:2007DATE OF FIRST AWARD:2008DATE OF LAST AWARD:2016PREREQUISITES:CACHE does not recommend any formal qualifications butlearners should be able to show that they can cope with thedemands of the programme.NUMBER OF UNITS/STRUCTURE:Award – 2 units (units 1-2)Certificate – 5 units (units 1-5)Diploma – 12 units (units 1-9 are mandatory, and 3 optionalunits are chosen from optional units 10-21)ASSESSMENT METHOD:Assessment TasksPractice Evidence RecordsProfessional Development ProfilesPractice Evidence DiariesShort Answer Test Paper-Certificate levelResearch Task - Diploma levelGRADING SYSTEM:The overall grade for the CACHE Level 3 Award/Certificate/Diploma in Child Care and Education is awarded at Grades A – E.Each unit assessment and external assessment is graded from Ato E using grading criteria. To gain the Award a learner mustachieve units 1 and 2. To gain the Certificate a learner mustachieve the Award, units 3-5 and achieve the Certificate ShortAnswer Test. To gain the Diploma the learner must achieve boththe Award and the Certificate, units 7-9, three Optional Units andachieve the Research Task.Those learners taking the Diploma must achieve unit 9 to achievethe qualification. This unit involves assessment of skills in theworkplace using a competence based approach.These qualifications have been awarded UCAS Tariff points asfollowsAwardUCASTariffpointsCertificateUCASTariffpointsDiplomaUCASTariffpointsA 30 A 110 A 360B 25 B 90 B 300C 20 C 70 C 240D 15 D 55 D 180E 10 E 35 E 120QUALITY ASSURANCE:The Certificate Short Answer Tests and the Research Task areexternally marked by CACHE and standardised and awardedusing authorised marking guidelines and indicative content,following CACHE standardisation and awarding processes.Customer Quality Advisers check a sample of internalassessments, assessor feedback to learners and a sample ofPractical Assessment Records. They also talk to a number oflearners.PROGRESSION/ARTICULATION:Learners can progress to higher education to study a degree in arelated area. They can also progress to the CACHE Level 5Diploma in Leadership for Health and Social Care and Childrenand Young People's Services (England) (QCF).Dependent on the pathway chosen, learners can also progress tothe following job roles:gggggggggggggPre-school workerPre-school managersNursery managersCrèche assistants and managersPractitioner in a children’s centrePractitioner in day nurseries, nursery schools or receptionclasses in primary schoolsRegistered childminders and nanniesEducation support workers who visit families of pre-schoolchildren in their homesFoster carersRegistered managers of children’s homes, plus deputy andassistant managersResidential childcare workersYouth workersLearning mentors.OCR Level 3 CambridgeTechnical Certificates,Introductory Diplomas,Subsidiary Diplomas, Diplomas,Extended Diplomas (QCF)ABBREVIATION:OCR Cambridge TECQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 3BACKGROUND:These qualifications are part of a suite available at levels 2 and 3which cover a range of sectors, eg business, IT, and health andsocial care. They provide a theoretical background to the sectorand relevant practical skills that will prepare learners for entryinto employment or progression and continuation of study in thevocational area through FE or HE. They are unit-basedqualifications. Units are 10 credits and qualifications are 30, 60,90, 120 or 180 credits.OCR Cambridge Technical qualifications are suitable for 16-19-year-olds or more mature learners considering a career changeor return to work, or those wishing to find a vocational route intofurther study.DATE OF FIRST TEACHING:2012NUMBER OF UNITS/STRUCTURE:<strong>Qualifications</strong> are achieved through achieving a specified amountof credit from mandatory and optional units.OCR Level 3 Cambridge Technical Certificates are 30 credits(180 guided learning hours)OCR Level 3 Cambridge Technical Introductory Diplomas are60 credits (360 guided learning hours)OCR Level 3 Cambridge Technical Subsidiary Diplomas are90 credits (540 guided learning hours)OCR Level 3 Cambridge Technical Diplomas are 120 credits(720 guided learning hours)OCR Level 3 Cambridge Technical Extended Diplomas are180 credits (1080 guided learning hours)<strong>UK</strong> QUALIFICATIONS 33
<strong>Qualifications</strong> currently offeredASSESSMENT METHOD:All units are internally assessed and externally moderated byOCR. Internal assessment involves candidates producing aportfolio of evidence which shows they have met specifiedoutcomes.Portfolios of work must be produced independently. They willneed to be available, together with any witness statements andother supporting documentation, to the OCR visiting moderatorwhen required. Centres are able to enter candidates’ work forexternal moderation at any time during the year.DATE OF RESULT PUBLICATION:On demand.GRADING SYSTEM:Each unit is graded Pass, Merit or Distinction.Each qualification will have an overall grade consisting of Pass,Merit, Distinction or Distinction* grades, as below:OCR level 3 Cambridge Technical Certificates, 30 creditsGrade UCAS pointsD* 70D 60M 40P 20OCR level 3 Cambridge Technical Introductory Diplomas, 60creditsGrade UCAS pointsD* 140D 120M 80P 40OCR level 3 Cambridge Technical Subsidiary Diplomas, 90 creditsGrade UCAS pointsD*D* 210D*D 200DD 180DM 160MM 120MP 100PP 60OCR level 3 Cambridge Technical Diplomas, 120 creditsGrade UCAS pointsD*D* 280D*D 260DD 240DM 200MM 160MP 120PP 80OCR level 3 Cambridge Technical Extended Diplomas, 180 creditsGrade UCAS pointsD*D*D* 420D*D*D 400D*DD 380DDD 360DDM 320DMM 280MMM 240MMP 200MPP 160PPP 120QUALITY ASSURANCE:Quality assurance and control is implemented through:gggqualification specifications which define requirements andprovide additional guidancecentre approval process that ensures centres meet specifiedquality criteriaexternal moderation of internally assessed units to ensurenational standards are maintained.PROGRESSION/ARTICULATION:Candidates can progress through the Cambridge Technicalqualifications, topping up from one size of qualification to the nextif that suits their needs. Or they can progress to further study inFE or HE at level 4, or into employment and further careerprogression by undertaking other vocational qualifications at thelevel appropriate to their job role.CACHE Level 3 Diploma inChildcare and EducationQUALIFICATION ABBREVIATION:DCE-L3NATIONAL QUALIFICATIONS FRAMEWORK LEVEL:Level 3BACKGROUND:The DCE-L3 programme prepares candidates to workcompetently, safely and effectively with children aged 0-7 years11 months whilst taking into account the fact that children live infamilies and communities. It also helps candidates who work witholder children, especially those with special needs, and preparecandidates to work in a wide range of settings with differentprofessionals and volunteers.DATE OF FIRST TEACHING:2000DATE OF FIRST AWARD:2001DATE OF LAST AWARD:2010PREREQUISITES:CACHE did not prescribe any formal entry qualifications in orderto start a programme of study for the DCE-L3. Candidates wereat least 16 years old at the date of registration for thequalification and had an adequate level of general education tocope with the demands of the programme.34 <strong>UK</strong> QUALIFICATIONS
<strong>Qualifications</strong> currently offeredNUMBER OF UNITS/STRUCTURE:The full DCE-L3 12 units:Units 1, 2 – 120 hours each unitUnits 3, 4, 5, 6 – 90 hours each unitUnits 9, 10 – 30 hours each unitUnit 12 required approximately 125 days of practical training.An additional 90-hour personal and subject tutorial wasrecommended.Excluding Unit 12, each individual unit could stand alone, wasindividually assessed and could be separately certificated.ASSESSMENT METHOD:PortfoliosUnit assignmentsPractice evidence recordsProfessional development profilesAn Extended Examination.The whole qualification was achieved through successfulcompletion of all the required units, a Diploma Final TestExamination and satisfactory Professional Development Profilesand Practice Evidence Records.GRADING SYSTEM:Theory Grade UCAS Tariff pointsAA 240BB 200CC 160DD 120EE 80Practical Grade UCAS Tariff pointsA 120B 100C 80D 60E 40QUALITY ASSURANCE:The examinations were externally marked by approved CACHEmarkers and standardised using common grading criteria. Thegrade boundaries were set at an award meeting attended by theChief Examiner and the lead examiners for the qualification.CACHE External verifiers checked a sample of marked andinternally verified assignments. They also talked to a numberof learners.PROGRESSION/ARTICULATION:Learners can progress to higher education to study a degree in arelated area. They can also progress to the CACHE Level 3Extended Diploma for the Children and Young People’s Workforce(QCF) and the CACHE Level 5 Diploma in Leadership for Healthand Social Care and Children and Young People's Services(England) (QCF).Dependent on the pathway chosen, learners can also progress tothe following job roles:gggggggggPre-school workerPre-school managersNursery managersCrèche assistants and managersPractitioner in a children’s centrePractitioner in day nurseries, nursery schools or receptionclasses in primary schoolsRegistered childminders and nanniesEducation support workers who visit families of pre-schoolchildren in their homesFoster carersggggRegistered managers of children’s homes, plus deputy andassistant managersResidential childcare workersYouth workersLearning mentors.CACHE Level 3 Certificate inChildren’s Care, Learningand DevelopmentQUALIFICATION ABBREVIATION:CCCLD-L3NATIONAL QUALIFICATIONS FRAMEWORK LEVEL:Level 3BACKGROUND:The aim of the CCCLD-L3 is to support the NVQ at level 3 inChildren’s Care, Learning and Development, and facilitate goodpractice and high standards for supervisory roles, competently,safely and effectively with children aged 0-16 years.DATE OF FIRST TEACHING:2005DATE OF FIRST AWARD:2006DATE OF LAST AWARD:2014PREREQUISITES:Candidates should be a minimum of 16 years of age and beworking on a paid, voluntary or placement basis in the Children’sCare, Learning and Development sector. They must also be ableto show that they have an adequate level of general education tocope with the demands of the programme.NUMBER OF UNITS/STRUCTURE:Five units (each consisting of 60 hours)All units are mandatory. Each unit can stand alone, be individuallyassessed and separately certificated.ASSESSMENT METHOD:Unit 2 is assessed through an MCQ test marked by CACHE.Units 1 and 3–5 are assessed through unit assignments providedby CACHE and internally marked and moderated.EXAMINATION TIMING:September, October, November, December, February, March, April,May, June, July.DATE OF RESULT PUBLICATION:September, October, November, December, February, March, April,May, June, July.GRADING SYSTEM:MCQ Test: Pass/ReferUnit Asignments: A-EOverall: A-EQUALITY ASSURANCE:Customer Quality Advisers check a sample of assessment plans,assessor feedback to learners and a sample of marked andinternally verified assignments. They also talk to a number oflearners.PROGRESSION/ARTICULATION:The CCCLD-L3 provides the underpinning knowledge and skillsfor the NVQ level 3 in Children’s Care, Learning andDevelopment. Therefore, if the award is achieved alongside theNVQ, thus making part of the Apprenticeship Framework,<strong>UK</strong> QUALIFICATIONS 35
<strong>Qualifications</strong> currently offeredcandidates can consider progression to a related FoundationDegree or other higher level qualification.CACHE Level 3 Diploma in EarlyYears Care and Education (WelshMedium)QUALIFICATION ABBREVIATION:W-DEYCE-L3NATIONAL QUALIFICATIONS FRAMEWORK LEVEL:Level 3BACKGROUND:This W-DEYCE-L3 is offered in the medium of Welsh orbilingually. It is designed for group leaders or those with someexperience in Children’s Care, Learning and Development. It willfacilitate good practice and high standards with CylchoeddMeithrin and all other pre-school provision. It is useful for workersacross a range of early years settings in a Welsh context as itcontains an emphasis on Welsh initiatives and culture.DATE OF FIRST TEACHING:2000DATE OF FIRST AWARD:2002DATE OF LAST AWARD:<strong>2013</strong>PREREQUISITES:CACHE does not prescribe any formal requirements in order tostart a programme of study for the W-DEYCE-L3. Candidatesshould be at least 16 years of age at the date of registration forthe award, show that they have an adequate level of generaleducation to cope with the demands of the programme and havesome day-to-day contact with children in a group setting.NUMBER OF UNITS/STRUCTURE:Four mandatory units (three of 60 hours and one of 30 hours).Each unit can stand alone, be individually assessed andseparately certificated.ASSESSMENT METHOD:Unit assignments: Unit 2 is externally assessed by CACHE. Allother units are marked and internally moderated within thecentres.EXAMINATION TIMING:September, January, JuneDATE OF RESULT PUBLICATION:November, March, JulyGRADING SYSTEM:A – EQUALITY ASSURANCE:The assignment for one unit for every candidate is externallymarked by CACHE and standardised using common gradingcriteria.Customer Quality Advisers check a sample of assessment plans,assessor feedback to learners and a sample of marked andinternally verified assignments. They also talk to a number oflearners.PROGRESSION/ARTICULATION:Level 3 provides the underpinning knowledge and skills for theNVQ Level 3 in Children’s Care, Learning and Development.Therefore, if the award is achieved alongside the NVQ, thusmaking part of the Apprenticeship Framework, candidates canconsider progression to a related Foundation Degree or otherhigher level qualification. They can also progress to the CACHELevel 3 Extended Diploma for the Children and Young People’sWorkforce (QCF) and the CACHE Level 5 Diploma in Leadershipfor Health and Social Care and Children and Young People'sServices (England) (QCF).Dependent on the pathway chosen, learners can also progress tothe following job roles:gggggggggggggPre-school workerPre-school managersNursery managersCrèche assistants and managersPractitioner in a children’s centrePractitioner in day nurseries, nursery schools or receptionclasses in primary schoolsRegistered childminders and nanniesEducation support workers who visit families of pre-schoolchildren in their homesFoster carersRegistered managers of children’s homes, plus deputy andassistant managersResidential childcare workersYouth workersLearning mentors.CACHE Level 3 Diploma inHome-Based ChildcareQUALIFICATION ABBREVIATION:DHC-L3NATIONAL QUALIFICATIONS FRAMEWORK LEVEL:Level 3BACKGROUND:The aim of the DHC-L3 is to raise the professional skills and thequality of childcare, offered in a home-based setting, includinginformation about the legislation and regulations governinghome-based childcare.DATE OF FIRST TEACHING:2005DATE OF FIRST AWARD:2006DATE OF LAST AWARD:2015PREREQUISITES:No formal entry requirements. However, candidates must be aged16 or over at the time of registering for the award.NUMBER OF UNITS/STRUCTURE:One unit of 12 hours and four units of 30 hours each.Individual units are free-standing and can be separatelycertificated.ASSESSMENT METHOD:Unit 1 is assessed by a multiple-choice question paper markedby CACHE. Units 2–5 are assessed through an assignment that isset by CACHE and marked by the centre.EXAMINATION TIMING:September, October, November, December, February, March, April,May, June, July, or as required electronically.DATE OF RESULT PUBLICATION:September, October, November, January, February, March, April,May, June, July.36 <strong>UK</strong> QUALIFICATIONS
<strong>Qualifications</strong> currently offeredGRADING SYSTEM:Unit 1 MCQ Test: Pass/ReferUnits 2-5: A-EQUALITY ASSURANCE:Customer Quality Advisers check a sample of assessment plans,and a sample of marked and internally verified assignments. Theyalso talk to a number of learners.PROGRESSION/ARTICULATION:Most learners will become registered childminders. Candidatesmay also seek to progress to higher level qualifications asappropriate, for example a Foundation Degree.CACHE Level 3 Diploma inPre-School PracticeQUALIFICATION ABBREVIATION:DPP-L3NATIONAL QUALIFICATIONS FRAMEWORK LEVEL:Level 3BACKGROUND:The qualification is designed primarily to prepare candidates towork at supervisory level with pre-school groups and playgroupswhilst taking into account the fact that children live in familiesand communities. Its main focus is on the needs of children agedfrom 1 to 5 years, who may be in sessional or, increasingly,extended full-day care.DATE OF FIRST TEACHING:2006DATE OF FIRST AWARD:2007DATE OF LAST AWARD:2016PREREQUISITES:CACHE does not prescribe any formal requirements in order to starta programme of study for the DPP-L3. Candidates must be 16years of age at the date of registration for the qualification, showthat they have an adequate level of general education to cope withthe demands of the programme and be working with children in apre-school setting either as a volunteer or in paid employment.NUMBER OF UNITS/STRUCTURE:Two mandatory units of 60 hours and one mandatory unit of 30hours, plus a further optional unit of 30 hours (choice of threeoption units). Each unit can stand alone, be individually assessedand separately certificated.ASSESSMENT METHOD:Unit assignments: Unit 3 is externally assessed by CACHE. Allother units are marked and internally moderated within thecentres.EXAMINATION TIMING:September, January, JuneDATE OF RESULT PUBLICATION:November, March, JulyGRADING SYSTEM:A – EQUALITY ASSURANCE:The assignment for one unit for every candidate is externallymarked by CACHE and standardised using common gradingcriteria. The grade boundaries are set at an award meetingattended by the Chief Examiner and the principal Examiners forthe qualification. Scripts from previous years are kept to ensurestandards are maintained year-on-year.Customer Quality Advisers check a sample of assessment plans,assessor feedback to learners and a sample of marked andinternally verified assignments. They also talk to a number oflearners.PROGRESSION/ARTICULATION:Most learners will become playgroup assistants, supervisors ormanagers. Candidates may also seek to progress to higher levelqualifications as appropriate, for example a Foundation Degree.CACHE Level 3 Diploma inPlaygroup Practice in WalesQUALIFICATION ABBREVIATION:DPPW-L3NATIONAL QUALIFICATIONS FRAMEWORK LEVEL:Level 3BACKGROUND:The DPPW-L3 is offered in the medium of English and isspecifically designed for work in playgroups in Wales, for groupleaders or those with some experience in Children’s Care,Learning and Development, to facilitate good practice and highstandards within pre-school provision in Wales. The qualificationsupports the Welsh heritage and culture of Wales, the CurriculumCymreig and the Desirable Outcomes for Children’s Learningbefore compulsory school age, with appropriate references toPersonal and Social Education for Wales.DATE OF FIRST TEACHING:2001DATE OF FIRST AWARD:2003DATE OF LAST AWARD:<strong>2013</strong>PREREQUISITES:CACHE does not prescribe any formal entry qualifications in orderto start a programme of study for the DPPW-L3, but candidatesshould be at least 16 years of age at the date of registration.Candidates’ literacy and numeracy is expected to be at GCSElevel or equivalent.NUMBER OF UNITS/STRUCTURE:Three mandatory units of 60 hoursEach unit can stand alone, be individually assessed andseparately certificated.ASSESSMENT METHOD:Unit assignments: Unit 1 is externally assessed by CACHE. Allother units are marked and internally moderated within thecentres.EXAMINATION TIMING:September, January, JuneDATE OF RESULT PUBLICATION:November, March, JulyGRADING SYSTEM:A – EQUALITY ASSURANCE:The assignment for one unit for every candidate is externallymarked by CACHE and standardised using common gradingcriteria. The grade boundaries are set at an award meetingattended by the Chief Examiner and the Principal Examiners for<strong>UK</strong> QUALIFICATIONS 37
<strong>Qualifications</strong> currently offeredthe award. Scripts from previous years are kept to ensurestandards are maintained year-on-year.Customer Quality Advisers check a sample of assessment plans,assessor feedback to learners and a sample of marked andinternally verified assignments. They also talk to a number oflearners.PROGRESSION/ARTICULATION:Most learners will become playgroup assistant supervisors ormanagers. Candidates may also seek to progress to higher levelqualifications as appropriate, for example a Foundation DegreeCACHE Level 3 Diploma inPlayworkQUALIFICATION ABBREVIATION:DP-L3NATIONAL QUALIFICATIONS FRAMEWORK LEVEL:Level 3BACKGROUND:The aims of the DP-L3 are to explore different techniques ofobservation as well as extend the candidate’s theoretical skillsenabling them to manage play settings.DATE OF FIRST TEACHING:2006DATE OF FIRST AWARD:2007DATE OF LAST AWARD:<strong>2013</strong>PREREQUISITES:CACHE does not prescribe any formal entry qualifications in orderto start a programme of study for the DP-L3, however candidatesmust be at least 16 years old at the date of registration. CACHErecommends that candidates have a related study of a course atlevel 2, an adequate level of general education to cope with thedemands of the programme, a minimum of 50 hours ofexperience in a playwork setting and have day-to-day contactwith children in a playwork setting.NUMBER OF UNITS/STRUCTURE:Six mandatory units of 60 recommended learning hours.ASSESSMENT METHOD:Unit assignments: Unit 1 is an MCQ Test marked by CACHE. Allother units are assessed by internally marked unit assignments.EXAMINATION TIMING:September, January, JuneDATE OF RESULT PUBLICATION:November, March, JulyGRADING SYSTEM:MCQ Test: Pass/ReferUnit 2-5: A-EOverall: A-EQUALITY ASSURANCE:Customer Quality Advisers check a sample of marked andinternally verified assignments. They also talk to a number oflearners.PROGRESSION/ARTICULATION:This diploma will enable candidates to progress towards aFoundation Degree in Playwork or BA Honours in Playwork.CACHE Level 3 Certificate inSupporting Teaching andLearning in SchoolsQUALIFICATION ABBREVIATION:STLS-L3NATIONAL QUALIFICATIONS FRAMEWORK LEVEL:Level 3BACKGROUND:This qualification is aimed at people who are working with pupilson an individual basis or with groups under the supervision of agroup leader in education and learning support. It is also forpeople who wish to work in this field.DATE OF FIRST TEACHING:2009DATE OF FIRST AWARD:2010DATE OF LAST AWARD:2015PREREQUISITES:Learners must be at least 16 years of age and it is recommendedthat they have a GCSE or equivalent at grade C or above.NUMBER OF UNITS/STRUCTURE:The CACHE Level 3 Certificate in Supporting Teaching andLearning in Schools consists of two mandatory units, with a totalof 120 GLH.CACHE recommends that you should be working in a school atFoundation Stage, or Key stages 1-4, for a minimum 60 hoursper unit. This can be as a paid employee, volunteer or yourCentre could have placed you there.ASSESSMENT METHOD:CourseworkGRADING SYSTEM:A-EQUALITY ASSURANCE:Customer Quality Advisers check a sample of assessment plans,assessor feedback to learners and a sample of marked andinternally verified assignments. They also talk to a number oflearners.PROGRESSION/ARTICULATION:Most learners will seek employment in the schools’ workforce butsome will progress to a relevant Foundation DegreeCACHE Level 3 Diploma inSupport Work in SchoolsQUALIFICATION ABBREVIATION:DSWiS-L3NATIONAL QUALIFICATIONS FRAMEWORK LEVEL:Level 3BACKGROUND:This qualification is aimed at people working in an unsupervisedrole with children and young people. For example, schooladministrator, receptionist, library assistant, IT support worker,learning support assistant, caretaker or lunch-time assistant.DATE OF FIRST TEACHING:200938 <strong>UK</strong> QUALIFICATIONS
<strong>Qualifications</strong> currently offeredDATE OF FIRST AWARD:2010DATE OF LAST AWARD:2016PREREQUISITES:Learners must be at least 18 years of age.NUMBER OF UNITS/STRUCTURE:Learners taking the CACHE Level 3 Diploma in Support Work inSchools must complete six units in total; both units from group Aplus four optional units from group B1, B2, C4 or C5.Learners taking the Parent Support pathway must complete sixunits in total; both units from Group A, the mandatory endorsedunit from Group C4 and then three additional units from GroupB2 or C5, at least one of which must be taken from Group C5. Itis possible to take both units from Group C5, in which case onlyone unit must be taken from Group B2.ASSESSMENT METHOD:Portfolio of Evidence, Practical Demonstration/AssignmentGRADING SYSTEM:Pass/referQUALITY ASSURANCE:Customer Quality Advisers check a sample of assessment plans,assessor feedback to learners and a sample of marked andinternally verified assignments. They also talk to a number oflearners.PROGRESSION/ARTICULATION:Most learners will seek employment in the schools’ workforce butsome will progress to a relevant Foundation Degree.CACHE Level 3 Certificate forTeaching AssistantsQUALIFICATION ABBREVIATION:CTA-L3NATIONAL QUALIFICATIONS FRAMEWORK LEVEL:Level 3BACKGROUND:The aim of the CTA-L3 is to support the NVQ at level 3 forTeaching Assistants, facilitate good practice and high standards inthe role of Teaching Assistants, and increase skills and knowledge.DATE OF FIRST TEACHING:2001DATE OF FIRST AWARD2002DATE OF LAST AWARD:2011.PREREQUISITES:CACHE did not prescribe any formal requirements in order tostart a programme of study for the CTA-L3. Candidates were atleast 16 years of age at the date of registration for thequalification, had an adequate level of general education to copewith the demands of the programme and were working in aschool at a Key Stage, on either a paid, voluntary or placementbasis.NUMBER OF UNITS/STRUCTURE:One mandatory unit of 60 hours and one optional unit of 60hours (choice of two options). Units could be stand-alone,individually assessed and separately certificated.ASSESSMENT METHOD:Units assignments: Unit 1 is marked and internally moderatedwithin the centres. Unit 2 was externally assessed by CACHE.EXAMINATION TIMING:September, January, JuneDATE OF RESULT PUBLICATION:November, March, JulyGRADING SYSTEM:A – EQUALITY ASSURANCE:The assignment for one unit for every candidate was externallymarked by CACHE and standardised using common gradingcriteria. The grade boundaries are set at an award meetingattended by the Chief Examiner and the Principal Examiners forthe award. Scripts from previous years were kept to ensurestandards were maintained year-on-year.DATE OF FIRST TEACHING:Customer Quality Advisers checked a sample of assessmentplans, assessor feedback to learners and a sample of markedand internally verified assignments. They also talked to a numberof learners.PROGRESSION/ARTICULATION:Most learners will seek employment in the schools’ workforce butsome will progress to a relevant Foundation Degree.CACHE Level 3 Certificate ofProfessional Development inWork with Children and YoungPeopleQUALIFICATION ABBREVIATION:CPD-L3NATIONAL QUALIFICATIONS FRAMEWORK LEVEL:Level 3BACKGROUND:The CPD aims to provide opportunities for candidates to developspecialist knowledge; extend specialist knowledge; progress tomore senior roles in their selected area; combine units to achievea qualification that may allow transfer to related areas; and gainnational standardised underpinning knowledge to progress tohigher level qualifications.DATE OF FIRST TEACHING:2000DATE OF FIRST AWARD:2001DATE OF LAST AWARD:<strong>2013</strong>PREREQUISITES:It is expected that candidates will already have a Children’s Care,Learning and Development qualification or equivalent at level 3that includes evidence of underpinning knowledge andunderstanding in the areas of child development and education.NUMBER OF UNITS/STRUCTURE:One mandatory unit and two optional units, all 70 hours (choicefrom 19 optional units). Units are free-standing and can beseparately certificated.<strong>UK</strong> QUALIFICATIONS 39
<strong>Qualifications</strong> currently offeredASSESSMENT METHOD:Unit assignments: Unit 1 is externally assessed by CACHE. Allother units are marked and internally moderated within thecentres.EXAMINATION TIMING:September, January, JuneDATE OF RESULT PUBLICATION:November, March, JulyGRADING SYSTEM:A – EQUALITY ASSURANCE:The assignment for one unit for every candidate is externallyassessed by CACHE and standardised using common gradingcriteria. The grade boundaries are set at an award meetingattended by the Chief Examiner and the Principal Examiners forthe award. Scripts from previous years are kept to ensurestandards are maintained year-on-year.Customer Quality Advisers check a sample of marked andinternally verified assignments. They also talk to a number oflearners.PROGRESSION/ARTICULATION:The award can assist those who are experienced/qualified in thearea to specialise and/or progress/transfer into related/regulatoryareas or higher levels of education or training.CACHE Level 3 NVQ in PlayworkQUALIFICATION ABBREVIATION:NVQP-L3NATIONAL QUALIFICATIONS FRAMEWORK LEVEL:Level 3BACKGROUND:This qualification is aimed at playworkers who are supervisingother members of staff within playwork settings.DATE OF FIRST TEACHING:2008DATE OF FIRST AWARD:2009DATE OF LAST AWARD:2014PREREQUISITES:Learners must be at least 16 years old with either a level 2playwork qualification or have significant experience in a playworksetting.NUMBER OF UNITS/STRUCTURE:Learners must complete all 5 units from Group A plus four unitsfrom Group BASSESSMENT METHOD:Portfolio of evidenceGRADING SYSTEM:Pass/referQUALITY ASSURANCE:CACHE ensures the quality and integrity of all qualifications, at alllevels, through the implementation of external quality assuranceprocesses which audit the Centre’s internal quality assurance andassessment procedures within all CACHE approved Centres.<strong>Qualifications</strong> are also quality assured through externalexamination.All CACHE approved Centres are required, in accordance withregulatory requirements, to complete internal quality assurance.This is a process of auditing the assessment judgments made byassessors about learners’ knowledge and competence to ensurethat any judgment made is valid, fair and authentic.CACHE has a robust approval system that ensures the Centre hasthe correct resources to undertake delivery of the qualifications atall levels, and that there are procedures implemented that maintainthe integrity of the qualifications delivered, in line with CACHErequirements and sector skills councils. It includes:ggthe checking of assessor and internal quality assurorcompetency to deliver the qualification, ie that they areoccupationally competent and knowledgeable to deliver thequalification area and level, in accordance with regulatoryrequirements.reviewing Centre documents in relation to the internal qualityassurance and assessment strategy, ie internal qualityassurance plans, evidence of internal quality assurance takingplace, evidence of planned and completed assessment oflearners and evidence of learner achievement.This rigorous process is undertaken by the Customer QualityAdviser, Subject Specialist and External Examiner and ensures thatthe high value of CACHE qualifications are maintained, whichCACHE view as crucial.External quality assurance audits are undertaken in response to theCentres’ ability to deliver and maintain integrity of the qualificationeffectively. These may be more frequent in some cases where it isidentified that a Centre needs extra support in order to achievegood practice in their organisation. In others, it may be lessfrequent where the Centre is delivering high quality assessmentand internal quality assurance services to their learners.PROGRESSION/ARTICULATIONOn completing this qualification, learners could work in roles suchas:ggggggPlayworkerWorker in a holiday clubPlaywork development officerAdventure centre supervisorHospital playworkerManager of any playwork provisionsLearners can also progress to a Foundation Degree.CACHE Level 3 NVQ inSupporting Teaching andLearning in SchoolsQUALIFICATION ABBREVIATION:NVQSTLS-L3NATIONAL QUALIFICATIONS FRAMEWORK LEVEL:Level 3BACKGROUND:This qualification is aimed at people whose working role calls forknowledge and understanding and skills in planning and supportingteaching and learning in schools or those wanting to work in thisarea.DATE OF FIRST TEACHING:2008DATE OF FIRST AWARD:200940 <strong>UK</strong> QUALIFICATIONS
<strong>Qualifications</strong> currently offeredDATE OF LAST AWARD:2014PREREQUISITES:Learners must be at least 16 years of age.NUMBER OF UNITS/STRUCTURE:Learners must complete all 6 units in Group 1, plus four units fromGroups A - E (10 units in total). No more than two units may betaken from Group E (B5 and B6 leadership units may not both betaken).ASSESSMENT METHOD:Direct observation within the workplace combined with a portfolioof additional evidence such as professional discussion and witnesstestimonies.GRADING SYSTEM:Pass/referQUALITY ASSURANCE:CACHE ensures the quality and integrity of all qualifications, at alllevels, through the implementation of external quality assuranceprocesses which audit the Centre’s internal quality assurance andassessment procedures within all CACHE approved Centres.<strong>Qualifications</strong> also are quality assured through externalexamination.All CACHE approved Centres are required, in accordance withregulatory requirements, to complete internal quality assurance.This is a process of auditing the assessment judgments made byassessors about learners’ knowledge and competence to ensurethat any judgment made is valid, fair and authentic.CACHE has a robust approval system that ensures the Centre hasthe correct resources to undertake delivery of the qualifications atall levels, and that there are procedures implemented that maintainthe integrity of the qualifications delivered, in line with CACHErequirements and sector skills councils. It includes:ggthe checking of assessor and internal quality assurorcompetency to deliver the qualification, ie that they areoccupationally competent and knowledgeable to deliver thequalification area and level, in accordance with regulatoryrequirements.reviewing Centre documents in relation to the internal qualityassurance and assessment strategy, ie internal qualityassurance plans, evidence of internal quality assurance takingplace, evidence of planned and completed assessment oflearners and evidence of learner achievement.This rigorous process is undertaken by the Customer QualityAdviser, Subject Specialist and External Examiner and ensures thatthe high value of CACHE qualifications are maintained, whichCACHE view as crucial.External quality assurance audits are undertaken in response to theCentres’ ability to deliver and maintain integrity of the qualificationeffectively. These may be more frequent in some cases where it isidentified that a Centre needs extra support in order to achievegood practice in their organisation. In others, it may be lessfrequent where the Centre is delivering high quality assessmentand internal quality assurance services to their learners.PROGRESSION/ARTICULATION:Most learners will seek employment in the school’s workforce butsome will progress to a relevant Foundation Degree.CACHE Level 3 NVQ in Healthand Social CareQUALIFICATION ABBREVIATION:HSC-L3NATIONAL QUALIFICATIONS FRAMEWORK LEVEL:Level 3BACKGROUND:The aim of the HSC-L3 is to provide a mixture of units in Care,Early Years and Management for people working with childrenand young people up to 18 years old.DATE OF FIRST TEACHING:2005DATE OF FIRST AWARD:2006DATE OF LAST AWARD:<strong>2013</strong>PREREQUISITES:CACHE does not prescribe any formal requirements in order tostudy the HSC-L3. Candidates should be at least 16 years of age,show an adequate level of general education to cope with theprogramme and either have experience of day or domiciliary caresettings or be registered as a foster carer.NUMBER OF UNITS/STRUCTURE:The qualification is made up of four mandatory units and fouroptional units. All eight units must be finished in order to gainthe qualification.ASSESSMENT METHOD:An approved assessor will visit the candidate in their workplaceto assess their practical competence, knowledge andunderstanding. The candidate will need to submit a portfolio toshow their competence in all areas of the qualification.GRADING SYSTEM:PassQUALITY ASSURANCE:CACHE ensures the quality and integrity of all qualifications, at alllevels, through the implementation of external quality assuranceprocesses which audit the Centre’s internal quality assurance andassessment procedures within all CACHE approved Centres.<strong>Qualifications</strong> are also quality assured through externalexamination.All CACHE approved Centres are required, in accordance withregulatory requirements, to complete internal quality assurance.This is a process of auditing the assessment judgments made byassessors about learners’ knowledge and competence to ensurethat any judgment made is valid, fair and authentic.CACHE has a robust approval system that ensures the Centre hasthe correct resources to undertake delivery of the qualifications atall levels, and that there are procedures implemented thatmaintain the integrity of the qualifications delivered, in line withCACHE requirements and sector skills councils. It includes:ggthe checking of assessor and internal quality assurorcompetency to deliver the qualification, ie that they areoccupationally competent and knowledgeable to deliver thequalification area and level, in accordance with regulatoryrequirements.reviewing Centre documents in relation to the internal qualityassurance and assessment strategy, ie internal qualityassurance plans, evidence of internal quality assurance<strong>UK</strong> QUALIFICATIONS 41
<strong>Qualifications</strong> currently offeredtaking place, evidence of planned and completed assessmentof learners and evidence of learner achievement.This rigorous process is undertaken by the Customer QualityAdviser, Subject Specialist and External Examiner and ensuresthat the high value of CACHE qualifications are maintained, whichCACHE view as crucial.External quality assurance audits are undertaken in response tothe Centres’ ability to deliver and maintain integrity of thequalification effectively. These may be more frequent in somecases where it is identified that a Centre needs extra support inorder to achieve good practice in their organisation. In others, itmay be less frequent where the Centre is delivering high qualityassessment and internal quality assurance services to theirlearners.PROGRESSION/ARTICULATION:It is anticipated that learners will join the social care workforceworking in domiciliary care or in residential care homes, progressto level 5 QCF qualifications for management or seniorpractitioner roles in health and social care, or to specialistqualifications reflecting the context in which they work.CACHE Level 3 NVQ inChildren’s Care, Learning andDevelopmentQUALIFICATION ABBREVIATION:CCLD-L3NATIONAL QUALIFICATIONS FRAMEWORK LEVEL:Level 3BACKGROUND:This qualification is aimed at people who work in settings orservices whose main purpose is Children’s Care, Learning andDevelopment.DATE OF FIRST TEACHING:2005DATE OF LAST AWARD:2006DATE OF LAST AWARD:2014PREREQUISITES:There are no formal entry requirements but learners must be atleast 16 years of age with either a level 2 early years qualificationor have significant experience in a childcare setting.NUMBER OF UNITS/STRUCTURE:The learner is required to complete all 5 units from Group A plustwo units from Group B and two units from Group B or C.ASSESSMENT METHOD:Direct observation within the workplace combined with a portfolioof additional evidence such as professional discussions andwitness testimonies.GRADING SYSTEM:Pass/referQUALITY ASSURANCE:CACHE ensures the quality and integrity of all qualifications, at alllevels, through the implementation of external quality assuranceprocesses which audit the Centre’s internal quality assurance andassessment procedures within all CACHE approved Centres.<strong>Qualifications</strong> are also quality assured through externalexamination.All CACHE approved Centres are required, in accordance withregulatory requirements, to complete internal quality assurance.This is a process of auditing the assessment judgments made byassessors about learners’ knowledge and competence to ensurethat any judgment made is valid, fair and authentic.CACHE has a robust approval system that ensures the Centre hasthe correct resources to undertake delivery of the qualifications atall levels, and that there are procedures implemented that maintainthe integrity of the qualifications delivered, in line with CACHErequirements and sector skills councils. It includes:ggthe checking of assessor and internal quality assurorcompetency to deliver the qualification, ie that they areoccupationally competent and knowledgeable to deliver thequalification area and level, in accordance with regulatoryrequirements.reviewing Centre documents in relation to the internal qualityassurance and assessment strategy, ie internal qualityassurance plans, evidence of internal quality assurance takingplace, evidence of planned and completed assessment oflearners and evidence of learner achievement.This rigorous process is undertaken by the Customer QualityAdviser, Subject Specialist and External Examiner and ensures thatthe high value of CACHE qualifications are maintained, whichCACHE view as crucial.External quality assurance audits are undertaken in response to theCentres’ ability to deliver and maintain integrity of the qualificationeffectively. These may be more frequent in some cases where it isidentified that a Centre needs extra support in order to achievegood practice in their organisation. In others, it may be lessfrequent where the Centre is delivering high quality assessmentand internal quality assurance services to their learners.PROGRESSION/ARTICULATION:Learners can progress to higher education to study a degree in arelated area. They can also progress to the CACHE Level 5 Diplomain Leadership for Health and Social Care and Children and YoungPeople's Services (England) (QCF)Dependent on the pathway chosen, learners can also progress tothe following job roles:gggggggggggggPre-school workerPre-school managersNursery managersCrèche assistants and managersPractitioner in a children’s centrePractitioner in day nurseries, nursery schools or receptionclasses in primary schoolsRegistered childminders and nanniesEducation support workers who visit families of pre-schoolchildren in their homesFoster carersRegistered managers of children’s homes, plus deputy andassistant managersResidential childcare workersYouth workersLearning mentors.CACHE Level 4 NVQ in Children’sCare, Learning and DevelopmentQUALIFICATION ABBREVIATION:CCLD-L442 <strong>UK</strong> QUALIFICATIONS
<strong>Qualifications</strong> currently offeredNATIONAL QUALIFICATIONS FRAMEWORK LEVEL:Level 4BACKGROUND:The aim of the CCLD-L4 is to provide a National VocationalQualification for candidates who work or wish to work withchildren aged 0-16 years. The award helps to recognisecandidates’ specialist learning and helps develop their career.DATE OF FIRST TEACHING:2005DATE OF FIRST AWARD:2006DATE OF LAST AWARD:2014PREREQUISITES:It is expected that candidates will be working in settings orservices at a senior level in face-to-face roles with children,young people and families.NUMBER OF UNITS/STRUCTURE:The qualification is made up of four mandatory units and fiveoptional units. All nine units must be finished in order to gainthe qualification.ASSESSMENT METHOD:An approved assessor will visit candidates’ workplaces toassess their work. Candidates will meet their assessor ona regular basis.GRADING SYSTEM:PassQUALITY ASSURANCE:CACHE ensures the quality and integrity of all qualifications, at alllevels, through the implementation of external quality assuranceprocesses which audit the Centre’s internal quality assurance andassessment procedures within all CACHE approved Centres.<strong>Qualifications</strong> are also quality assured through externalexamination.All CACHE approved Centres are required, in accordance withregulatory requirements, to complete internal quality assurance.This is a process of auditing the assessment judgments made byassessors about learners’ knowledge and competence to ensurethat any judgment made is valid, fair and authentic.CACHE has a robust approval system that ensures the Centre hasthe correct resources to undertake delivery of the qualifications atall levels, and that there are procedures implemented thatmaintain the integrity of the qualifications delivered, in line withCACHE requirements and sector skills councils. It includes:ggthe checking of assessor and internal quality assurorcompetency to deliver the qualification, ie that they areoccupationally competent and knowledgeable to deliver thequalification area and level, in accordance with regulatoryrequirements.reviewing Centre documents in relation to the internal qualityassurance and assessment strategy, ie internal qualityassurance plans, evidence of internal quality assurancetaking place, evidence of planned and completed assessmentof learners and evidence of learner achievement.This rigorous process is undertaken by the Customer QualityAdviser, Subject Specialist and External Examiner and ensuresthat the high value of CACHE qualifications are maintained, whichCACHE view as crucial.External quality assurance audits are undertaken in response to theCentres’ ability to effectively deliver and maintain integrity of thequalification. These may be more frequent in some cases where it isidentified that a Centre needs extra support in order to achieve goodpractice in their organisation. In others, it may be less frequentwhere the Centre is delivering high quality assessment and internalquality assurance services to their learners.PROGRESSION/ARTICULATION:The qualification will allow candidates to go on and take a higherlevel qualification such as a Foundation Degree. The qualificationcan also be used to work as a child-minding network coordinatoror a centre/playgroup/nursery manager.CACHE Level 4 Certificate inQuality Standards in Children’sManagement ServicesQUALIFICATION ABBREVIATION:CMQS-L4NATIONAL QUALIFICATIONS FRAMEWORK LEVEL:Level 4BACKGROUND:This qualification is aimed at people who would like to work as aqualified practitioner involved in preparing their setting foraccredited quality assurance schemes or statutory inspections.DATE OF FIRST TEACHING:2004DATE OF FIRST AWARD:2005DATE OF LAST AWARD:2015PREREQUISITES:Learners must be at least 18 years of age and be an experiencedor qualified practitioner.NUMBER OF UNITS/STRUCTURE:Learners must successfully complete both units at Pass grade toachieve the Certificate.ASSESSMENT METHOD:CourseworkGRADING SYSTEM:Pass/referQUALITY ASSURANCE:The assignment for one unit for every candidate is externallymarked by CACHE and standardised using common gradingcriteria. Scripts from previous years are kept to ensure standardsare maintained year-on-year.Customer Quality Advisers check a sample of marked and internallyverified assignments. They also talk to a number of learners.PROGRESSION/ARTICULATION:The qualification will allow candidates to go on to take a higherlevel qualification such as a Foundation Degree or the CACHELevel 5 Diploma in Leadership for Health and Social Care andChildren and Young People’s Services (England) (QCF).The qualification can also be used to work as a child-mindingnetwork coordinator or a centre/playgroup/nursery manager.<strong>UK</strong> QUALIFICATIONS 43
<strong>Qualifications</strong> currently offeredCambridge InternationalExaminationsCambridge International Examinations is the world's largestprovider of international education programmes and qualificationsfor 5-19 year-olds. As a not-for-profit organisation, CambridgeInternational Examinations is committed to making high qualityeducation available all around the world. Cambridge qualificationsare available in over 165 countries. It is part of CambridgeAssessment, formerly the University of Cambridge LocalExaminations Syndicate (UCLES). Cambridge InternationalExaminations operates alongside OCR, which providesexamination and assessment services in the <strong>UK</strong>, and CambridgeESOL (English for Speakers of Other Languages) which delivers aportfolio of qualifications for people learning English.Cambridge International Level 3Pre-U Certificate (PrincipalSubject)NATIONAL QUALIFICATIONS FRAMEWORK LEVEL:Level 3BACKGROUND:The Cambridge Pre-U Certificate, developed by CambridgeInternational Examinations, aims to prepare young people forsuccess in their undergraduate studies. The qualification isdifferent from A level in several respects. The certificates areavailable from a range of 28 subject syllabuses that will provideopportunities for students to go deeper into their chosenspecialisms, and assessment will be more stretching at the topend. The Certificate (Principal Subject) is accredited by Ofqual ashaving 380 Guided Learning Hours. Students may choose tocombine subjects to form part of the Cambridge Pre-U Diploma(see section on Cambridge Pre-U Diploma).DATE OF FIRST TEACHING:2008DATE OF FIRST AWARD:2010ASSESSMENT METHOD:The assessment is linear, with all examinations being taken at theend of the two-year study period.GRADING SYSTEM:GradeUCAS Tariff pointsD1To be confirmedD2 145D3 130M1 115M2 101M3 87P1 73P2 59P3 46Ofqual regulates the qualifications and ensures that the standardof D3 is aligned to the standard of grade A at A level and thestandard of the P3 is aligned to the standard of a grade E atA level.Further information on Cambridge Pre-U, including syllabuses,may be found by going to the website atwww.cie.org.uk/cambridgepreu. If you have questions, would likemore information, or wish to discuss Cambridge Pre-U, pleasecontact the awarding body at international@cie.org.ukCambridge International Level 3Pre-U Certificate (Short Course)NATIONAL QUALIFICATIONS FRAMEWORK LEVEL:Level 3BACKGROUND:The Cambridge Pre-U Short Course is available in ModernForeign Languages, Mathematics, Further Mathematics andGlobal Perspectives and can be taken in the first or second yearof study. They are offered in order to encourage students todevelop a broad subject portfolio. The Certificate (Short Course) isaccredited by Ofqual as having 180 Guided Learning Hours.DATE OF FIRST TEACHING:2008DATE OF FIRST AWARD:2009ASSESSMENT METHOD:The assessment is linear, with all examinations being taken at theend of the one-year study period.GRADING SYSTEM:GradeUCAS Tariff pointsD1To be confirmedD2To be confirmedD3 60M1 53M2 46M3 39P1 32P2 26P3 20Ofqual regulates the qualifications and ensures that the standardof D3 is aligned to the standard of grade A at AS level and thestandard of the P3 is aligned to the standard of a grade E at AS.Further information on Cambridge Pre-U, including syllabuses,may be found by going to the website atwww.cie.org.uk/cambridgepreu. If you have questions, would likemore information, or wish to discuss Cambridge Pre-U, pleasecontact the awarding body at international@cie.org.uk.Cambridge Pre-U DiplomaBACKGROUND:Cambridge International Examinations has developed a newqualification called the Cambridge Pre-U Diploma, which aims toprepare young people for success in their undergraduate studies.The qualification is different from A level in several respects. TheCambridge Pre-U Diploma includes subject syllabuses that willprovide opportunities for students to go deeper into their chosenspecialisms, assessment will be more stretching at the top end,and there is greater scope for independent research. Theassessment is linear, with all examinations for Principal Subjectsbeing taken at the end of the two-year study period.DATE OF FIRST TEACHING:2008DATE OF FIRST AWARD:2010NUMBER OF UNITS/STRUCTURE:Students will have the opportunity to qualify for the overarchingDiploma by taking the core component (comprised of CambridgePre-U Global Perspectives and the Research Report) plus threePrincipal Subjects. This will provide a holistic, challenging and44 <strong>UK</strong> QUALIFICATIONS
<strong>Qualifications</strong> currently offeredrigorous preparation for university study. The core (GlobalPerspectives and Research) is also available as a stand-alonequalification. A Principal Subject at Cambridge Pre-U will amountto 380 guided learning hours, and a Short Course (only availablein Modern Foreign Languages, Mathematics, FurtherMathematics and Global Perspectives) will amount to 180 guidedlearning hours.ASSESSMENT METHOD AND GRADING SYSTEM:The Cambridge Pre-U Diploma is scored separately, byaggregation of results in three Principal Subjects and the corecomponent (the two components of the core each having half theweight of a Principal Subject). Principal Subjects will be given amaximum of 24 marks and Global Perspectives and Research amaximum of 12 each with the Diploma as a whole a mark out of96.UCAS TARIFF POINTSGrade Principal Subject Global Short CoursePerspectivesand ResearchD1 To be confirmed To be confirmed To be confirmedD2 145 140 To be confirmedD3 130 126 60M1 115 112 53M2 101 98 46M3 87 84 39P1 73 70 32P2 59 56 26P3 46 42 20Ofqual regulates the qualifications and ensures that the standardof D3 is aligned to the standard of grade A at AS and thestandard of the P3 is aligned to the standard of a grade E at AS.Further information on Cambridge Pre-U, including syllabuses,may be found by going to the website at www.cie.org.uk. If youhave questions, would like more information or wish to discussCambridge Pre-U, please contact the awarding body atinternational@cie.org.ukCambridge AdvancedInternational Certificate ofEducation (AICE) DiplomaQUALIFICATION ABBREVIATION:Cambridge AICEBACKGROUND:Cambridge AICE offers an international pre-university curriculumand examination system which emphasises the value of broadand balanced study for academically able students.It is a group award that requires the study of subjects drawn fromthree curriculum areas (mathematics and science; languages;and arts and humanities). Cambridge AICE draws upon the fullportfolio of Cambridge’s post-16 provision (A level and AS). Theindividual choice of subjects within these areas is intended toprovide a flexible, comprehensive and integrated curriculumprogramme.ASSESSMENT METHOD:A candidate needs to take and pass subjects equivalent to aminimum of six credits to obtain the Cambridge AICE Diploma.The credit rating of counting qualifications is A level = 2 creditsand AS = 1 credit.GRADING SYSTEM:The Cambridge AICE Diploma is awarded on the basis of a pointssystem, as shown in the following table:Grade A level Points AS PointsA* 140 n/aA 120 60B 100 50C 80 40D 60 30E 40 20A* was introduced for A level from 2010. The existing A/AS levelgrades have been retained and the new A* is available inaddition. There is no grade A* at AS.Cambridge AICE has accommodated the introduction of A* in thefollowing way:140 points will be awarded for an A*, but the number of AICEpoints will be capped at 360.Three levels of the Cambridge AICE Diploma are awarded:Distinction, Merit and Pass. Candidates scoring 320 points andabove will be awarded a Distinction, 220-319 points a Merit and120-219 points a Pass. Where a student takes more than theminimum number of subjects for the Cambridge AICE Diploma,the best results which satisfy the subject group requirements willcount towards the award.Cambridge International GCEAdvanced Subsidiary andAdvanced Level (AS and ALevel)/Cambridge Higher SchoolCertificate (HSC)QUALIFICATION ABBREVIATION:Cambridge International A and AS level/Cambridge HSCBACKGROUND:Acceptable at grades A* – E in lieu of <strong>UK</strong> GCE A level and AS ona subject-for-subject and grade-for-grade basis.It should be noted that the Cambridge International A levels aredifferent in structure from the <strong>UK</strong> A levels. Whereas <strong>UK</strong> A levelsare modular and students can retake individual components, theCambridge International A levels have a linear structure whichencourages an integrated study of the entire subject. Mostcandidates take all their Cambridge International A level papers inone session. Candidates who take Cambridge International ASfirst and then want to retake it, must generally retake the wholeof the Cambridge International AS. HEIs may feel it appropriate totake the structure of the international A levels into account whenmaking an offer.Cambridge Higher School Certificate (HSC) is a group awardcomprised of principal subjects (AL) and subsidiary subjects (AS).Subsidiary subjects usually include a General Paper and a locallanguage.Cambridge International GeneralCertificate of SecondaryEducationQUALIFICATION ABBREVIATION:Cambridge IGCSE<strong>UK</strong> QUALIFICATIONS 45
<strong>Qualifications</strong> currently offeredBACKGROUND:Cambridge IGCSE was developed by Cambridge InternationalExaminations and introduced in 1988 primarily as a qualificationfor overseas candidates that aims to prepare students for furtheracademic success, including progression to A level and AS study.The qualification is equivalent in standard to GCSE and may beconsidered acceptable at grades A*, A, B or C in lieu of GCSE ona subject for subject basis.Many Cambridge IGCSE syllabuses have been approved byOfqual and are funded for teaching in state schools in Englandand Northern Ireland. When a Cambridge IGCSE is approved byOfqual, it appears on the Register of Regulated <strong>Qualifications</strong> as aCambridge International Level 1/Level 2 Certificate. This is theofficial title for all Cambridge IGCSEs approved by Ofqual.ASSESSMENT METHOD:Cambridge IGCSE is assessed on an eight-point scale of grades:A* – G with A* being highest.Cambridge International Level 1/Level 2 Certificates are assessedin the same way as Cambridge IGCSEs, using an eight-pointscale of grades: A*-G with A* being highest.Full information is available from Cambridge InternationalExaminations.Cambridge InternationalDiplomasBACKGROUND:The Cambridge International Diploma in Business (formerlyCambridge Skills and Career Award) assesses the practicalapplication of career-based knowledge across a range ofbusiness-focused areas. The Cambridge International Diploma atAdvanced level is equivalent to A level, and the CambridgeInternational Diploma at Standard level is equivalent to GCSE. TheCambridge International Diploma in Business (Advanced level)satisfies university matriculation requirements in lieu of A level.NUMBER OF UNITS/STRUCTURE:The Diploma is modular in structure, and to achieve a full Diplomaat a given level, candidates need to pass both the compulsory coremodules and the requisite number of optional modules.ASSESSMENT METHOD:The assessment methods include written examinations andassignments, all externally assessed by Cambridge.GRADING SYSTEM:Successful Diploma candidates are awarded Distinction, Merit orPass, where at Advanced Level, Distinction may be taken asperformance equivalent to the award of A level grade B, Merit tograde C and Pass to grade D. Three types of certification can beawarded – Full Diploma, Core Module and Optional Module.Institutions are advised to accept only those applicants presentinga Full Diploma.CISI Level 3 Certificate forIntroduction to Securities andInvestmentQCF LEVEL:Level 3BACKGROUND:The Chartered Institute for Securities & Investment (CISI) is thelargest professional body for those who work in the securities andinvestment industry in the <strong>UK</strong> and in a growing number of majorfinancial centres around the world. Formed in 1992 by LondonStock Exchange practitioners, it now has more than 40,000members in 89 countries. In 2010 it set over 42,000 examinationsin 75 countries, covering a range of vocational qualifications.The CISI certificate programme is a wide-ranging group ofqualifications designed specifically to meet the requirements ofindividuals working in the securities and derivatives markets whoneed to obtain Financial Services Authority (FSA) Approved Personstatus. The breadth of FSA activities is matched by the CISI’scertificates programme. Candidates must, however, ensure thatthey take the certificate pathway that is appropriate to the activitythey are to undertake.The CISI Level 3 Certificate for Introduction to Securities andInvestment aims to provide individuals with knowledge andunderstanding of the key characteristics, mechanisms andinfluences on financial markets and institutions; to equip themeither to progress to further study in higher education, or to applytheir learning in the field of investment operations.DATE OF FIRST TEACHING:2010DATE OF FIRST AWARD:2011PREREQUISITES:NoneNUMBER OF UNITS/STRUCTURE:This is a two-unit qualification developed specifically for schoolsand further education institutes. Candidates must achieve a passgrade in each of the two units in order to be awarded thecertificate. The minimum number of QCF credits required toachieve the overall qualification is 20.ASSESSMENT METHOD:Coursework and multiple choice examination.GRADING SYSTEM:Pass/Merit/DistinctionThis qualification carries UCAS Tariff points for entry to highereducation from 2011 as follows:GradeUCAS Tariff pointsPass with Distinction 60Pass with Merit 40Pass 20QUALITY ASSURANCE:Supported by the Financial Skills Partnership (formerly theFinancial Services Skills Council) and accredited by Ofqual.PROGRESSION/ARTICULATION:Candidates can elect to study for this qualification to provide anindication of their ability to pursue a course of higher educationwith a view to gaining employment, post university, in thefinancial services industry.City & GuildsCity & Guilds offers qualifications at eight levels, as follows:8 Fellowship (FCGI)7 Membership (MCGI)/Master Professional Diploma/Level 5 NVQ/SVQ6 Graduateship (GCGI)/Associateship (ACGI)5 IVQ Advanced Technician Diploma/Full Technological Diploma4 Licentiateship (LCGI)/Higher Certificate/Higher Level Study Skills3 Level 3 NVQ/SVQ/Vocational/General Education/IVQ Technician Diploma/IVQ Advanced Diploma2 Level 2 NVQ/SVQ/Diploma of Vocational Education (Foundation)/GeneralEducation Technician Certificate/IVQ Diploma/IVQ Technician Certificate1 Level 1 NVQ/SVQ / Vocational Award/ IVQ Certificate.46 <strong>UK</strong> QUALIFICATIONS
<strong>Qualifications</strong> currently offeredInternational Vocational <strong>Qualifications</strong> (IVQs)International Vocational <strong>Qualifications</strong> (IVQs) measure candidates’underpinning knowledge of a subject and their ability to apply thisknowledge in a work context within the chosen occupationalarea. IVQs offer a progressive structure and are available at NQFlevels 1-5.City & Guilds Level 5 IVQAdvanced Technician DiplomaQUALIFICATION ABBREVIATION:IVQ ATDNATIONAL QUALIFICATIONS FRAMEWORK LEVEL:Level 5BACKGROUND:The QCDA definition of level 5 is competence that involves theapplication of skills and a significant range of fundamentalprinciples across a wide and often unpredictable variety ofcontexts. Very substantial personal autonomy and often significantresponsibility for the work of others and for the allocation ofsubstantial resources feature strongly, as do personalaccountabilities for analysis and diagnosis, design, planning,execution and evaluation.Available in a range of subjects. Candidates will be able todemonstrate high levels of knowledge, a high level of workexpertise in job roles and competence in managing and trainingothers. <strong>Qualifications</strong> at this level are appropriate for peopleworking as higher grade technicians, professionals or managers.ASSESSMENT METHOD:Written examinations: set and marked by City & GuildsWritten/ practical assignments: set by City & Guilds, marked bythe centre, externally verified by City & Guilds.GRADING SYSTEM:Written examinations: Distinction, Merit, PassWritten assignments: Distinction, Merit, PassPractical assignments: PassQUALITY ASSURANCE:Internal and external verification.PROGRESSION/ARTICULATION:Degrees/employment.City & Guilds Level 3 IVQAdvanced DiplomaQUALIFICATION ABBREVIATION:IVQ ADNATIONAL QUALIFICATIONS FRAMEWORK LEVEL:Level 3BACKGROUND:The QCDA definition of level 3 is competence in a broad range ofvaried work activities performed in a wide variety of contexts,most of which are complex and non-routine. There isconsiderable responsibility and autonomy, and control orguidance of others is often required. level 3 represents anadvance or specialisation within a given occupation beyond theusual accepted minimum standard and sometimes attractsfurther formal industrial recognition.Available in a range of subjects. Candidates will have acquired awell-developed ability to absorb and communicate technicalinformation about the target subject, including a mastery of someof the advanced mathematical and scientific principles involved.Success at this level denotes skilled work of a complex natureand the ability to undertake a supervisory role.ASSESSMENT METHOD:Written examinations: set and marked by City & GuildsWritten/ practical assignments: set by City & Guilds, marked bythe centre, externally verified by City & Guilds.GRADING SYSTEM:Written examinations: Distinction, Merit, PassWritten assignments: Distinction, Merit, PassPractical assignments: PassQUALITY ASSURANCE:Internal and external verification.PROGRESSION/ARTICULATION:Degrees/employment.City & Guilds Level 3 IVQTechnician DiplomaQUALIFICATION ABBREVIATION:IVQ TDNATIONAL QUALIFICATIONS FRAMEWORK LEVEL:Level 3BACKGROUND:The QCDA definition of level 3 is competence in a broad range ofvaried work activities performed in a wide variety of contexts,most of which are complex and non-routine. There isconsiderable responsibility and autonomy, and control orguidance of others is often required. level 3 represents anadvance or specialisation within a given occupation beyond theusual accepted minimum standard and sometimes attractsfurther formal industrial recognition.Available in a range of subjects. Candidates will have acquired awell-developed ability to absorb and communicate technicalinformation about the target subject, including a mastery of someof the advanced mathematical and scientific principles involved.Success at this level denotes skilled work of a complex natureand the ability to undertake a supervisory role.ASSESSMENT METHOD:Written examinations: set and marked by City & GuildsWritten/ practical assignments: set by City & Guilds, marked bythe centre, externally verified by City & Guilds.GRADING SYSTEM:Written examinations: Distinction, Merit, PassWritten assignments: Distinction, Merit, PassPractical assignments: PassQUALITY ASSURANCE:Internal and external verification.PROGRESSION/ARTICULATION:Degrees/employment/ATD.City & Guilds Level 2 IVQDiplomaQUALIFICATION ABBREVIATION:IVQ DNATIONAL QUALIFICATIONS FRAMEWORK LEVEL:Level 2<strong>UK</strong> QUALIFICATIONS 47
<strong>Qualifications</strong> currently offeredBACKGROUND:The QCDA definition of level 2 is competence in a significantrange of varied work activities, performed in a variety of contexts.Some of the activities are complex or non-routine, and there issome individual responsibility or autonomy. Collaboration withothers, perhaps through membership of a work group or team,may often be a requirement.Available in a range of subjects. Candidates will have acquired anability to understand and communicate more advanced technicalinformation than needed for the Technician Certificate about thetarget subjects and to describe the principles of the subjects’complex systems. Success at this level recognises competence ina more demanding range of activities which require a degree ofindividual responsibility.ASSESSMENT METHOD:Written examinations: set and marked by City & GuildsWritten/ practical assignments: set by City & Guilds, marked bythe centre, externally verified by City & Guilds.GRADING SYSTEM:Written examinations: Distinction, Merit, PassWritten assignments: Distinction, Merit, PassPractical assignments: PassQUALITY ASSURANCE:Internal and external verification.PROGRESSION/ARTICULATION:Level 3 qualifications/employment.City & Guilds Level 2 IVQTechnician CertificateQUALIFICATION ABBREVIATION:IVQ TCNATIONAL QUALIFICATIONS FRAMEWORK LEVEL:Level 2BACKGROUND:The QCDA definition of level 2 is competence in a significantrange of varied work activities, performed in a variety of contexts.Some of the activities are complex or non-routine, and there issome individual responsibility or autonomy. Collaboration withothers, perhaps through membership of a work group or team,may often be a requirement.Available in a range of subjects. Candidates will have acquired anability to understand and communicate more advanced technicalinformation than needed for the Technician Certificate about thetarget subjects and to describe the principles of the subjects’complex systems. Success at this level recognises competence ina more demanding range of activities which require a degree ofindividual responsibility.ASSESSMENT METHOD:Written examinations: set and marked by City & GuildsWritten/ practical assignments: set by City & Guilds, marked bythe centre, externally verified by City & Guilds.GRADING SYSTEM:Written examinations: Distinction, Merit, PassWritten assignments: Distinction, Merit, PassPractical assignments: PassQUALITY ASSURANCE:Internal and external verification.PROGRESSION/ARTICULATION:Level 3 qualifications/employment.City & Guilds Level 1 IVQCertificateQUALIFICATION ABBREVIATION:IVQ CNATIONAL QUALIFICATIONS FRAMEWORK LEVEL:Level 1BACKGROUND:The QCDA definition of level 1 is competence in the performanceof a range of varied work activities, most of which may be routineand predictable.Available in a range of subjects. Candidates will have acquired anability to understand and communicate basic information aboutthe target subjects in spoken, written and computer form and bymeans of diagrams, charts and statistics. Success at this levelindicates the ability to perform basic or routine activities whichprovide the broad foundation for progression.ASSESSMENT METHOD:Written examinations: set and marked by City & GuildsWritten/ practical assignments: set by City & Guilds, marked bythe centre, externally verified by City & Guilds.GRADING SYSTEM:Written examinations: Distinction, Merit, PassWritten assignments: Distinction, Merit, PassPractical assignments: PassQUALITY ASSURANCE:Internal and external verification.PROGRESSION/ARTICULATION:Level 2 qualifications/employment.City & Guilds Full TechnologicalCertificateQUALIFICATION ABBREVIATION:FTCNATIONAL QUALIFICATIONS FRAMEWORK LEVEL:Level 5BACKGROUND:The QCDA definition of level 5 is competence that involves theapplication of skills and a significant range of fundamentalprinciples across a wide and often unpredictable variety ofcontexts. Very substantial personal autonomy and often significantresponsibility for the work of others and for the allocation ofsubstantial resources feature strongly, as do personalaccountabilities for analysis and diagnosis, design, planning,execution and evaluation.The Full Technological Certificate has been replaced by the FullTechnological Diploma.City & Guilds Full TechnologicalDiplomaQUALIFICATION ABBREVIATION:FTDNATIONAL QUALIFICATIONS FRAMEWORK LEVEL:Level 5BACKGROUND:The QCDA definition of level 5 is competence that involves theapplication of skills and a significant range of fundamental48 <strong>UK</strong> QUALIFICATIONS
<strong>Qualifications</strong> currently offeredprinciples across a wide and often unpredictable variety ofcontexts. Very substantial personal autonomy and often significantresponsibility for the work of others and for the allocation ofsubstantial resources feature strongly, as do personalaccountabilities for analysis and diagnosis, design, planning,execution and evaluation.Candidates will be able to demonstrate high levels of knowledge,a high level of work expertise in job roles and competence inmanaging and training others. <strong>Qualifications</strong> at this level areappropriate for people working as higher grade technicians,professionals or managers.The Full Technological Diploma is available for the followingqualifications:gIVQs in Engineering (2565)gIVQs in Telecommunication Systems (2730)gIVQs in Motor Vehicle Engineering (3905)gTechnician IVQs in the Construction Industry (6165)gIVQs in Applied Information Technology (7235)gIVQs in Electrical and Electronic Engineering (8030-2000).PREREQUISITES:In order to obtain an FTD, the candidate must hold both an IVQTechnician Diploma and an IVQ Advanced Technician Diploma inthe relevant subject, have a job role of a supervisory nature andprovide a portfolio of evidence which documents at least twoyears’ appropriate work experience.Holders of the FTC who wish to obtain an FTD must sit and besuccessful in the relevant IVQ Technician Diploma and IVQAdvanced Technician Diploma assessments and also satisfy thepractical portfolio element.City & Guilds AdvancedProfessional CertificateQUALIFICATION ABBREVIATION:APCNATIONAL QUALIFICATIONS FRAMEWORK LEVEL:Level 3BACKGROUND:This is a bridging qualification to facilitate access to level 4qualifications. It is aimed at people in work or with access towork placement.PREREQUISITES:Level 2 qualificationNUMBER OF UNITS/STRUCTURE:Six units are required to complete the full qualification. Individualunits can be certificated separately.ASSESSMENT METHOD:Centre-devised assignments assessed by City & Guilds externalmoderators.GRADING SYSTEM:Distinction, Merit, PassQUALITY ASSURANCE:External moderationPROGRESSION/ARTICULATION:Higher Professional Diploma or other sub-degree programme/employment.Higher Level <strong>Qualifications</strong>City & Guilds Higher ProfessionalDiplomaQUALIFICATION ABBREVIATION:HPDNATIONAL QUALIFICATIONS FRAMEWORK LEVEL:Level 4BACKGROUND:Equivalent to first year of a degree and available through parttimeor full-time delivery.<strong>Qualifications</strong> provide the opportunity for candidates to select bothhigher level technical units and those focusing on management.The target audience is candidates in work or with access to workplacement who:gggrequire the vocational knowledge and skills within ourqualifications to enable them to work effectively at amanagerial level in their sectorrequire a qualification which validates, confirms andconsolidates their professional expertiseare seeking a progression route which will facilitate entry toa related degree programme.PREREQUISITES:Level 3 qualificationNUMBER OF UNITS/STRUCTURE:Twelve units are required to complete the full qualification.Individual units can be certificated separately.ASSESSMENT METHOD:Centre-devised assignments which are externally moderated byCity & Guilds.EXAMINATION TIMING:No external examination.GRADING SYSTEM:Distinction, Merit, Pass.QUALITY ASSURANCE:External moderation.PROGRESSION/ARTICULATION:Foundation Degrees/Degrees/Employment.Senior AwardsCity & Guilds’ Senior Awards (levels 4 to 8) have been specificallydesigned to provide an employment-based route to higher levelqualifications. They provide formal recognition of professional andtechnical achievements in the public services, industry andcommerce.Senior Awards are not appropriate for accreditation on the NQF,so City & Guilds has allocated the nearest comparable level onthe NQFFellowship (FCGI)The highest award conferred by City & Guilds. It recognizesoutstanding professional achievement in demandingappointments.Membership (MCGI)At the level comparable to a master’s degree, professional orsenior managerial status.<strong>UK</strong> QUALIFICATIONS 49
<strong>Qualifications</strong> currently offeredGraduateship (GCGI)/Associateship (ACGI)At the level comparable to a first degree. The ACGI is a parallelaward exclusively for students of the City & Guilds College, whohave graduated with an engineering or computing degree of theImperial College of Science, Technology and Medicine.Licentiateship (LCGI)At the level comparable to HNC or the first level of a degreeprogramme, and at a supervisory management level.Professional Recognition Awards(PRAs)The City & Guilds Senior Awards have been revised and rebrandedas the Professional Recognition Awards. The ProfessionalRecognition Awards (PRAs) are competence-based awardsrecognising the practical application of professional skills,knowledge and understanding in employment.They offer an employment-based route to higher levelqualifications and were launched in January 2012.The Professional Recognition Awards have been developed in linewith Ofqual’s regulatory arrangements for developing qualifications.Successful achievement of an award will attest to the candidate’sability to operate at the following levels:gLicentiateship (LCGI) comparable to Level 4gAffiliateship (AfCGI) comparable to Level 5gGraduateship (GCGI) comparable to Level 6gMembership (MCGI) comparable to Level 7.To achieve an award candidates must provide evidence that theyhave met the six standards, which are based around the followingtopics:ggggggCommitment to Professional StandardsCommunication and Information ManagementLeadershipProfessional DevelopmentWorking with OthersManaging Customer RelationshipsDiplomaNATIONAL QUALIFICATIONS FRAMEWORK LEVELS:Foundation Diploma – level 1Higher Diploma – level 2Progression Award – level 3Advanced Diploma – level 3Following the Wolf review and regulatory changes to place theDiploma on the same terms as other qualifications, awardingorganisations have decided that they will not be offering the fullDiploma from September 2012. However, the main componentsof the Diploma will continue to exist as qualifications in their ownright, and schools and colleges will be able to continue offeringall of the learning that they do currently - albeit no longer underthe Diploma brand. It is for schools and colleges to decide whichqualifications are right for their students. Edexcel, OCR and VCTChave said that they will continue to offer Principal Learningqualifications. Students who are currently on a Diploma coursewill be able to complete it under current arrangements.BACKGROUND:Diplomas are applied qualifications, which combine both theacademic and vocational and are contextualized to a range ofindustry sectors through work-related learning. They were firsttaught in 2008 – with all 14 subjects or Lines of Learningavailable from 2010. 14-19 Diplomas are designed to provideprogression routes into both employment and HE.Diplomas are designed to promote diversity, opportunity andinclusion by offering high-quality, credible, industry-relevantapplied learning, alongside general learning, with realopportunities to practise skills. The applied nature of Diplomasrequires learning through the experience of applying knowledgeand skills to tasks or contexts that have many of thecharacteristics of real work. Critical to applied learning andsuccessful attainment are processes, particularly planning andreviewing, that support experiential learning and give learners theopportunity to reflect on their work-related experiences, to drawout and articulate lessons learnt (both generalised and specific),and then to apply that learning to new situations or activities. Theeffective engagement of learners in activity, review andapplication is intended to provide depth and meaning to learning,and enhance employability.The Diploma subjects/Lines of Learning are: BusinessAdministration and Finance; Construction and the BuiltEnvironment; Creative and Media; Engineering; Environment andLand Based Studies; Hair and Beauty Studies; Hospitality; IT;Manufacturing and Product Development; Public Services; RetailServices; Society, Health and Development; Sports and ActiveLeisure; and, Travel and Tourism.STRUCTURE OF DIPLOMASThe Diploma is a composite qualification made up of:gggPrincipal learningGeneric learning- functional skills- personal learning and thinking skills (PLTS)- work experience- extended projectAdditional and specialist learning (ASL) (not ProgressionDiploma).PRINCIPAL LEARNINGPrincipal learning is specific to the Line of Learning that a learnerchooses, for example Creative and Media. It comprises a numberof units covering different aspects of the Line of Learning andcarries a mandatory 50 per cent applied learning requirement –learning by doing, and set in a work-related context. Students willacquire an awareness of a broad employment sector in additionto work-relevant knowledge, skills and understanding.The principal learning is consistent in size for each Diploma at agiven level - 240 guided learning hours (GLH) at Level 1, 420 GLHat Level 2 and 540 GLH at Level 3. It is assessed by a mixture ofinternal and external assessment. For the Level 3 Diploma theproportion of external assessment will be up to a third.GENERIC LEARNINGGeneric learning is common across all Diploma Lines of Learning.It includes a core of skills required by employers and HE –personal, learning and thinking skills, functional skills in English,mathematics and ICT, as well as work experience and anextended project.PERSONAL LEARNING AND THINKING SKILLS (PLTS)The PLTS framework includes skills which require learners to be:independent enquirers; creative thinkers; reflective learners; teamworkers; self-managers; and effective participators.Learners will develop and apply all these skills through theprincipal learning. The skills will be assessed as they appear ineach Diploma, rather than separately. The project and workexperience will provide further opportunities to apply these skills.50 <strong>UK</strong> QUALIFICATIONS
<strong>Qualifications</strong> currently offeredFUNCTIONAL SKILLSStudents develop their ability to apply their English, maths andICT skills in situations relevant to work and life.The specifications require learners to:abachieve the functional skills units in English, mathematicsand ICT at Level 1 for the Level 1 Diploma, and at Level 2 forthe Level 2 Diploma. The achievement of the Diploma atLevel 3 requires achievement of Level 2 functional skills,although this may be done alongside, or prior to, the level 3Diploma; and,develop and apply functional skills within sector-relevantcontexts.WORK EXPERIENCELearners undertake a minimum of 10 days’ structured workexperience, where possible in the relevant sector.EXTENDED PROJECTThe extended project is related to the principal learning and willenable the learner to explore a topic of interest in greater depthor breadth.At level 3 the project specifications require learners to:abcdeselect either individually or as part of a group, a sectorrelevanttopic/area of interest for an in-depth study, whichprovides opportunities to develop skills, knowledge andunderstanding, and negotiate with their mentor the scopingof that project.identify and draft objectives for their project and provide arationale for their choice.plan, research and complete independently, or take anidentified and individual role in, a project.provide evidence of planning, organisation, research,evaluation and outcomes of the project.produce a presentation on the completed project in anappropriate medium and designed for a specific audience.ADDITIONAL AND SPECIALIST LEARNING (ASL)Additional and specialist learning gives learners the opportunity todeepen or broaden their learning. Within ASL, learners canchoose qualifications that lead them in a particular direction. Forexample, by taking a mathematics qualification within theengineering Diploma, they will develop a learning programme thatcould lead to a degree-level course in engineering. Or learnerscan pursue interests that broaden their learning experience, forexample by choosing a language qualification.Students will select from qualifications at the same level as theDiploma that they are taking, or one higher, e.g. the FoundationDiploma can have ASL at Level 1 or 2. Lists of approved ASLcomponents for each subject/Line of Learning are published onthe Diploma website athttp://register.ofqual.gov/DiplomaStructure - select search criteriafor the Diploma type and level, and then select ‘view Additionaland Specialist Learning’ to see the list of valid ASL.Students are advised to check university entry requirements forcourses they are interested in prior to selecting their ASL.DIPLOMA LEVELSDiplomas are available at levels 1, 2 and 3.The Foundation Diploma (level 1) attainment is at the level ofGCSE grades D-G: in terms of guided learning hours it is aroundfive GCSEs in size.The Higher Diploma (level 2) attainment is at the level of GCSEgrades A*-C: in terms of guided learning hours it is around sevenGCSEs in size.The Advanced Diploma (level 3) attainment is equivalent to threeand a half A levels and includes principal learning, genericlearning (which includes personal learning and thinking skills(PLTS) and functional skills), a project, work experience and achoice of additional and specialist learning (ASL).The Progression Award (level 3) is a smaller level 3 award andattainment is equivalent in size to two and a half A levels. Itincludes the principal learning and generic learning sections ofthe full Advanced Diploma, but excludes the additional/specialistlearning.ASSESSMENT METHOD:Principal learning unit assessment – mix of course workassessment, portfolio and written examinationFunctional skills – task-based controlled assessmentProject – internal with external verification – see section onExtended Project aboveAdditional and Specialist Learning – will depend on thequalification(s) takenDATE OF RESULT PUBLICATION:Most Diplomas are awarded in August at the time the majority oflearners receive the results of the component qualifications thatmake up the Diploma. However, Diplomas are awardedthroughout the year as learners complete the requirements of theDiploma qualification.GRADING SYSTEM:The Diploma is graded at all levels. To achieve the overallDiploma qualification, learners will need to pass all componentswithin the Diploma, including functional skills and additional andspecialist learning.The Diploma grade is derived from the aggregate score ofprincipal learning and the project.The grading of the Diploma will be reported in the following way:gggFoundation Diploma: A*, A, B or ungraded (U)Higher Diploma: A*, A, B, C or ungraded (U)Advanced Diploma: A*, A, B, C, D, E or ungraded (U).A Diploma transcript will record and report a learner'sachievements in units and qualifications within the Diplomaprogramme. It will contain grades at unit level and record theachievement of personal, learning and thinking skills, as well asthe completion of work experience.The Tariff score for the Principal Learning and Extended Project ofthe Advanced Diploma (effectively the same as a ProgressionDiploma) with effect from 2010 entry to HE is as follows:GradeUCAS Tariff pointsA* 350A 300B 250C 200D 150E 100The Tariff score for Principal Learning with effect from 2010 entryto HE is as follows:GradeUCAS Tariff pointsA* 210A 180B 150C 120D 90E 60<strong>UK</strong> QUALIFICATIONS 51
<strong>Qualifications</strong> currently offeredThe total score for the Advanced Diploma can be obtained byadding the score for Additional and Specialist Learning (ASL) tothe score for Principal Learning and the Extended Project(Progression Diploma). The points for ASL will depend upon theTariff for the qualification concerned.QUALITY ASSURANCE:The regulatory framework for the Diploma is underpinned bysupporting arrangements for the operation of the Diploma,including Ofqual agreed procedures for awarding and grading.These arrangements are available at:http://www.ofqual.gov.uk/for-awarding-organisations/96-articles/306-regulatory-arrangements-for-component-anddiploma-awarding-bodiesDiploma in Digital Applications/Certificate in DigitalApplications/Extended Certificatein Digital Applications/ Award inDigital ApplicationsQUALIFICATION ABBREVIATION:DIDACIDAECIDA/CIDA+AIDANATIONAL QUALIFICATIONS FRAMEWORK LEVEL:Levels 1 and 2BACKGROUND:gSuccessor to GNVQ ICT (Foundation and Intermediate)gMapped against the e-Skills National Occupational Standardsfor IT Users and the National Curriculum Programme of Studyin ICTgPractical approach used to develop a body of skills andknowledgegPromotes creative use of digital applicationsgWork submitted for moderation in an e-portfolio.Edexcel <strong>Qualifications</strong> in Digital Applications for IT Users arepart of the levels 1 and 2 provision of the National <strong>Qualifications</strong>Framework (NQF).They are designed to:gdevelop students’ ability to select and use digital applicationsappropriately and produce high quality outcomesgenable students to demonstrate their knowledge and skillsthrough purposeful application.Their broad objectives are to:ggive students the technical knowledge, skills andunderstanding they need to use digital applicationscompetentlygequip students with some of the skills they will need in theworkplace or in further education or traininggpromote learning through work-related contextsguse e-portfolios as tools for learning and assessmentgdevelop an awareness of ethical, social, economic andpolitical consequences of the use of and access to digitalapplications for individuals, organisations and society.DATE OF FIRST TEACHING:September 2005, following pilot 2004DATE OF FIRST AWARD:2006 (one-year programmes)NUMBER OF UNITS/STRUCTURE:Award in Digital Applications is equivalent to one GCSE and isavailable at levels 1 and 2. The Award consists of onecompulsory unit (Using ICT).Certificate in Digital Applications is equivalent to two GCSEs andis available at levels 1 and 2. The Certificate consists of onecompulsory unit (Using ICT) and a further unit chosen from a listof four.Extended Certificate in Digital Applications is equivalent to threeGCSEs and is available at levels 1 and 2. The Extended Certificateconsists of one compulsory unit (Using ICT) and two optional unitschosen from a list of four.Diploma in Digital Applications is equivalent to four GCSEs and isavailable at levels 1 and 2. The Diploma consists of one compulsoryunit (Using ICT) and three optional units chosen from a list of four.GRADING SYSTEM:Distinction, Merit, Credit and PassDiploma in Foundation Studies(Art and Design) (NQF)Note: These qualifications are being replaced by versions in the<strong>Qualifications</strong> and Credit Framework (QCF). For more informationon the new Diploma in Foundation Studies qualifications, pleasesee below.Individual awarding bodies’ titles are as follows –ABC Awards:Edexcel:UAL:WJEC:Diploma in Foundation Studies in Art, Designand MediaBTEC Foundation Diploma in Art and DesignFoundation Diploma in Art and DesignDiploma in Foundation Studies (Art, Design andMedia)QUALIFICATION ABBREVIATION:FAD (not used by WJEC)NATIONAL QUALIFICATIONS FRAMEWORK LEVEL:Level 3BACKGROUND:The FAD programme was created in the 1960s to preparestudents for degree-level study in art and design. It hastraditionally been viewed as a post-school qualification that isnormally taken in sixth form colleges, FE colleges and HEIs. Thequalification was redesigned in 2000, and from September 2000has been accredited by QCDA and offered as a progressionqualification for HE and/or employment. It has consistently been amost successful route for entry to degree-level studies in studiobasedart and design.Four awarding bodies offer the level 3 FAD: ABC Awards (ABC),Edexcel, the Welsh Joint Education Committee (WJEC) andUniversity of the Arts, London (UAL).A high proportion of FADs are located in FE colleges, although itis also available in some HEIs and a small number of schools andsixth form colleges.The programme is normally offered as a one-year full-timeprogramme, or as a two-year part-time programme.It is designed to:ggenhance students’ capacity to learn and develop thosefaculties and skills which lead to self-reliant learningdevelop students’ critical awareness of the contemporary52 <strong>UK</strong> QUALIFICATIONS
<strong>Qualifications</strong> currently offeredgggggvisual world and related contexts and the relationship ofcontemporary practice to historical, cultural, environmentaland social influencesdevelop students’ intellectual curiosity through criticalunderstanding and advanced learning using appropriatemethods such as a reflective journal and interaction betweenself and othersdevelop students’ ability in methods of creative production bymaintaining an open mind towards the exploration of newideas through risk takingconnect to the workplace and employers through theencouragement of participation in ‘live projects’ whereverrelevant to the specificationprovide a context in which students are able to identify andinterpret their strengths and direction through a continuousdiagnostic and progressive exploration of skills and conceptscentral to art, design, craft and communication practicedevelop students’ understanding and awareness of theopportunities and demands of study in art, design, craft andcommunication in order to translate potential and ability intorealisable goals within higher education, chosen employmentor industry liaison opportunity.DATE OF FIRST TEACHING:2000DATE OF FIRST AWARD:2001DATE OF LAST AWARD (FOR NQF VERSIONS):<strong>2013</strong>PREREQUISITES:Although not mandatory, the majority of students have at leasttwo A levels. This requirement does not apply to mature studentswho are assessed according to individual circumstances.NUMBER OF UNITS/STRUCTURE:ABC: 8 units including at least one at level 4Edexcel: 9 units including two at level 4UAL: 7 units including one at level 4WJEC: 3 units including one at level 4.ASSESSMENT METHOD:All FAD programmes are externally assessed. ABC and Edexceloperate an external assessment model hosted through theconfirmatory stage, WJEC operates through the FMP (Final MajorProject). Throughout the programme, a student’s progress isbenchmarked through internal assessment.EXAMINATION TIMING:Summer termDATE OF RESULT PUBLICATION:Certificates can be released from mid-July.GRADING SYSTEM:Distinction, Merit and PassFinal stage only is graded in the ABC and Edexcel specifications.WJEC weights each unit at 25%, with clear assessment strandsand descriptors for each unit culminating in a final assessment,weighted 50%.The following points for FAD came into effect for entry to HE from2006.GradeUCAS Tariff pointsDistinction 285Merit 225Pass 165QUALITY ASSURANCE:ABC AwardsAll centres offering the qualification receive up to two visits by anABC Moderator. Reports written by Moderators are forwarded tothe National Lead Moderator who reports findings and key issuesto ABC.EdexcelEdexcel external examiners review the statements of intent eightweeks prior to the examination visit and provide the centre with afeedback report. Examination visits to review the final majorprojects take place by negotiation with the centres.WJECWJEC external assessment takes place in June each year.Moderator-examiner reports are returned to centres and theissues are carried forward to annual Boards of Study attendedby all centres.PROGRESSION/ARTICULATION:Progression is largely into higher education and employment.VARIANTS:ABC can offer a Certificate of Unit Credit to students whocomplete units 1 to 7.Edexcel can offer a Certificate of Unit Credit for any of thecompleted units 1 to 7.Diploma in Foundation Studies(Art and Design) (QCF)Note: individual awarding organisations’ titles are as follows –ABC Awards:Edexcel:UAL:WJEC:Level 3 Foundation Diploma in Art, Designand Media (QCF)Level 4 Foundation Diploma in Art, Designand Media (QCF)BTEC Level 3 Foundation Diploma in Artand Design (QCF)BTEC Level 4 Foundation Diploma in Artand Design (QCF)Level 3 Foundation Diploma in Art andDesign (QCF)Level 4 Foundation Diploma in Art andDesign (QCF)Level 3 Diploma in Foundation Studies Artand Design (QCF)Level 4 Diploma in Foundation Studies Artand Design (QCF)QUALIFICATION ABBREVIATION:FAD (not used by WJEC)QUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 3 and level 4BACKGROUND:This diploma is designed as a successor to the NQF qualification ofthe same name. Its main aim is to help learners make informeddecisions to facilitate progression to higher education in the areas ofart, design and media, or into related employment. The diplomabuilds on learners’ prior experience. It links skills already acquiredwith ideas and challenges, extending learners’ critical independenceand providing them with a full understanding of the careeropportunities in art, design and the media.<strong>UK</strong> QUALIFICATIONS 53
<strong>Qualifications</strong> currently offeredDATE OF FIRST TEACHING:2010DATE OF FIRST AWARD:2011NUMBER OF UNITS/STRUCTURE:Learners must achieve a minimum of 120 credits. The number ofunits in the qualification varies between awarding organisations,as indicated below. Learners take mandatory units from group A,and optional units from groups B1 and group B2. Group B2consists of units at level 4. Units from one awarding organisationcan be used to provide exemption for another awardingorganisation’s qualification.ABC Awards: Level 3 FAD: 120 credits required including amaximum of 12 credits at level 4.Level 4 FAD: 120 credits required, including44 at level 3.Edexcel:UAL:WJEC:ASSESSMENT METHOD:Portfolio of evidenceGRADING SYSTEM:Pass/Merit/DistinctionLevel 3 FAD: 120 credits required, including amaximum of 10 at level 4.Level 4 FAD: 120 credits required, including50 at level 3.Level 3 FAD: 120 credits required, including40 at level 4Level 4 FAD: 120 credits required, including40 at level 3.Level 3 FAD: 120 credits required including50 at level 4.Level 4 FAD: 120 credits required including40 at level 3.PROGRESSION/ARTICULATION:Degree-level study, or employment in the relevant sector.EDEXCEL (PEARSONEDUCATION LTD)BTEC qualifications were certificated by BTEC (Business andTechnician Education Council) from 1984, then by Edexcel from1996. Since 2003 Edexcel has been part of Pearson.Prior to 2002 BTEC qualifications were on BTEC’s ownframework. The subsequent frameworks were set up andcontrolled by the regulator. Originally the regulator was NCVQ (theNational Council for Vocational <strong>Qualifications</strong>), then it was QCA(the <strong>Qualifications</strong> and Curriculum Authority), and currently it isOfqual (the Office of <strong>Qualifications</strong> and Examinations Regulation).The first framework to be set up by the regulator was the NQF(National <strong>Qualifications</strong> Framework). An additional framework, theQCF (<strong>Qualifications</strong> and Credit Framework), was introduced in 2009,primarily for vocational qualifications. Edexcel re-developed someBTECs so that they were QCF-compliant for delivery from 2010.New sizes of qualification within the suites were introduced toincrease flexibility. These developments enabled BTECs to be usedas components within Diplomas, Apprenticeships and FoundationLearning provision and therefore to continue to be eligible for publicfunding. The broader range of sizes of BTECs at Level 3 facilitatesthem being taken by students alongside AS and A levels.The timetable for the revision of the accreditation of the varioussuites of BTEC qualifications on the relevant frameworks is asfollows:BTEC FIRSTS (LEVEL 2)2002 NQF (version 1)2006 NQF (version 2)2010 QCF2012 NQF (BTEC Firsts Next Generation)BTEC NATIONALS (LEVEL 3)2002 NQF (version 1)2007 NQF (version 2)2010 QCFBTEC HIGHER NATIONALS (LEVELS 4/5)2003 NQF2010 QCFBTEC SPECIALIST AND PROFESSIONAL QUALIFICATIONS(PREVIOUSLY BTEC SHORT COURSE QUALIFICATIONS)2002 NQF (version 1)2006-7 NQF (version 2)2007 QCF and NQF2009 QCFThe following table summarises the qualifications, past andpresent, accredited to the various frameworks at all levels.KEYSKILLSNVQSNATIONAL QUALIFICATIONS FRAMEWORK (NQF), QUALIFICATIONS ANDCREDIT FRAMEWORK (QCF) AND THE BTEC CUSTOMISED FRAMEWORKORIGINAL LEVELSREVISED LEVELSFRAMEWORK FORHIGHER EDUCATIONQUALIFICATIONLEVELS (FHEQ)Level 5NVQsLevel 5BTEC AdvancedProfessional Diplomas,Certificates and Awards(NQF and Customised)BTEC ProfessionalDevelopment DiplomaLevel 8BTEC Level 8 Advanced Professional Diplomas,Certificates and Awards (QCF)BTEC Advanced Professional Diplomas, Certificates andAwards (NQF and Customised)Level 7BTEC Level 7 Advanced Professional Diplomas,Certificates and Awards (QCF)BTEC Advanced Professional Diplomas, Certificates andAwards (NQF and Customised)D (Doctoral)M (Masters)54 <strong>UK</strong> QUALIFICATIONS
<strong>Qualifications</strong> currently offeredKEYSKILLSNVQSNATIONAL QUALIFICATIONS FRAMEWORK (NQF), QUALIFICATIONS ANDCREDIT FRAMEWORK (QCF) AND THE BTEC CUSTOMISED FRAMEWORKORIGINAL LEVELSREVISED LEVELSFRAMEWORK FORHIGHER EDUCATIONQUALIFICATIONLEVELS (FHEQ)Level 4Key SkillsLevel 4NVQsLevel 4BTEC HNDs and HNCs(NQF and Customised)BTEC ProfessionalDiplomas, Certificatesand Awards (NQF andCustomised)Level 6BTEC Level 6 Professional Diplomas, Certificates andAwards (QCF)BTEC Professional Diplomas, Certificates and Awards(NQF and Customised)Level 5BTEC Level 5 HND Diplomas (QCF)BTEC HNDs (NQF and Customised)BTEC Level 5 Professional Diplomas, Certificates andAwards (QCF)BTEC Professional Diplomas, Certificates and Awards(NQF and Customised)BTEC Professional Development DiplomasH (Honours)I (Intermediate)foundation degreesBTEC Level 5 HNDDiplomas (QCF)Higher National Diplomas(NQF and Customised)Level 4BTEC Level 4 HNC Diplomas (QCF)BTEC HNCs (NQF and Customised)BTEC Level 4 Professional Diplomas, Certificates andAwards (QCF)BTEC Professional Diplomas, Certificates and Awards(NQF and Customised)BTEC Professional Development CertificatesC (Certificate)Level 3Key SkillsLevel 3NVQsLevel 3BTEC Level 3 Certificates, Level 3 Subsidiary Diplomas, BTEC Level 3 Diplomasand BTEC Level 3 Extended Diplomas (QCF)BTEC National Diplomas, Certificates and Awards (NQF and Customised)BTEC Diplomas, Certificates and Awards (NQF and QCF)BTEC Advanced Diplomas, Certificates and Awards (Customised)BTEC Professional Development AwardBTEC Diploma in Foundation Studies (Art and Design) (NQF and QCF)BTEC Professional Development AwardsAdvanced Extension AwardGCE A and AS LevelsLevel 2Key SkillsLiteracyNumeracyESOLLevel 2NVQsLevel 2BTEC Level 2 Certificates, Level 3 Extended Certificates and Level 2 Diplomas(QCF)BTEC First Diplomas and Certificates (NQF and Customised)BTEC Diplomas, Certificates and Awards (NQF and QCF)BTEC Intermediate Diplomas, Certificates and Awards (Customised)Certificate of Pre-Vocational EducationGCSEs grades A*-CLevel 1Key SkillsLevel 1NVQsLevel 1BTEC Level 1 Diplomas, Certificates and Awards (QCF)LiteracyNumeracyESOLBTEC Introductory Diplomas and Certificates (NQF and Customised)BTEC Diplomas, Certificates and Awards (NQF)BTEC Foundation Diplomas, Certificates and Awards (Customised)GCSEs grades D-GEntry LevelLiteracyNumeracyESOLEntry LevelBTEC Entry Level Diplomas, Certificates and Awards (QCF)BTEC Entry Diplomas and Certificates (NQF and Customised)BTEC Certificates in Life Skills (NQF)BTEC Certificates in Skills for Working Life (NQF)Entry Level Certificates<strong>UK</strong> QUALIFICATIONS 55
<strong>Qualifications</strong> currently offeredThe QCF has strict rules on titling and so the names of each size of qualification had to be changed when they were accredited to the newframework. The following table matches the old with the new titles for the level 3 BTEC Nationals:NQF LEVEL 3 BTEC NATIONALS QCF LEVEL 3 BTEC NATIONALS A LEVEL EQUIVALENCE IN SIZENo equivalent qualification Edexcel BTEC Level 3 Certificate 0.5 x A levelEdexcel Level 3 BTEC National Award Edexcel BTEC Level 3 Subsidiary Diploma 1 x A levelNo equivalent qualification Edexcel BTEC Level 3 90-credit Diploma 1.5 x A levelsEdexcel Level 3 BTEC National Certificate Edexcel BTEC Level 3 Diploma 2 x A levelsEdexcel Level 3 BTEC National Diploma Edexcel BTEC Level 3 Extended Diploma 3 x A levelsThe following table matches the old with the new titles for the level 2 BTEC Firsts:NQF LEVEL 2 BTEC FIRSTS QCF LEVEL 2 BTEC FIRSTS GCSE LEVEL EQUIVALENCE IN SIZENo equivalent qualification Edexcel BTEC Level 2 Certificate 1 x GCSEEdexcel Level 2 BTEC First Certificate Edexcel BTEC Level 2 Extended Certificate 2 x GCSEsEdexcel Level 2 BTEC First Diploma Edexcel BTEC Level 2 Diploma 4 x GCSEsIt should be noted the QCF titling regulations do not allow the inclusion of the words ‘First’ or ‘National’ in the actual titles of thequalifications but the suites are still referred to as BTEC Firsts and BTEC Nationals.Some subjects remained on the NQF, for example the BTEC Nationals in Children’s Care, Learning and Development, and so two sets oftitling convention are currently in use.The Edexcel website (www.edexcel.com) and the Register of Regulated <strong>Qualifications</strong> (http://register.ofqual.gov.uk) give full details of BTECqualifications.Edexcel level 2 BTECFirst Certificate (NQF)NATIONAL QUALIFICATIONS FRAMEWORK LEVEL:Level 2BACKGROUND:The Edexcel level 2 BTEC First Certificates are designed toprovide specialist work-related qualifications in a range ofsectors. They are unit-based qualifications that focus onparticular aspects of employment within a vocational sector. Thelevel 2 BTEC First Certificate offers a qualification that can extendthe study and provide vocational emphasis for learners followinga GCSE or Applied GCSE (Double Award) route or a combinationof both in their main programme of study. Equally the Edexcellevel 2 BTEC First Certificate offers a focused qualification forlearners, particularly more mature learners, who wish to follow ashorter programme of study that is directly related to their workexperience, or to an aspect of employment that they wish tomove into in due course.There are key aspects within the Edexcel level 2 BTECFirst <strong>Qualifications</strong>.gggggThe qualifications all have a specialist focusAll units are internally assessed and verifiedThe BTEC First Certificates have the equivalence on theSchool and College Achievement and Attainment Tables totwo GCSEs (A* – C)There is an overall qualification grade for certificationSome of the qualifications have been approved asTechnical CertificatesDATE OF FIRST TEACHING:2004DATE OF FIRST AWARD:2005NUMBER OF UNITS/STRUCTURE:gThree 60 GLH (guided learning hours) units, includingmandatory and specialist units, with a qualification size of180 GLH.ASSESSMENT METHOD:All units are internally assessed and externally verified.The assessment is criterion-referenced, based on theachievement of specified outcomes.GRADING SYSTEM:The grading of units is at Pass, Merit or Distinction. These aredetailed as part of the documents for certification.Each qualification will have an overall grade of Pass, Merit orDistinction, and since September 2006 a Distinction* grade hasbeen available.QUALITY ASSURANCE:External verification and National Standards Sampling qualityassurance is undertaken as follows.gGuidance and unit specificationTo promote consistency, the awarding body issues standardsfor programme/unit outcomes, content, assessment andguidance on teaching and learning methods, programmedesign and assessment.56 <strong>UK</strong> QUALIFICATIONS
<strong>Qualifications</strong> currently offeredggApprovalAny centre (college, school or company) wishing to offer thequalification has to gain approval for that qualification bydemonstrating that specified resourcesand quality criteria are met, both for the centre and thequalification.External verificationThe awarding body appoints an external verifier toevery sector programme that it approves. These areexperienced practitioners, normally with occupationalcompetence, from education and industry who are carefullyselected and suitably qualified. They have a responsibility forensuring that:gggcentres assess student performance using strategiesthat are valid and reliablenational standards of the qualifications are maintainedthe consistency of the qualifications nationally ismonitored using national comparisons.Before any awards are issued, an external verifier must confirmthat national standards are being applied consistently andcertification is valid. Verification is undertaken using a range ofmethods, including visits and remote sampling. Sampling ofstudents’ work is undertaken for all programmes.PROGRESSION/ARTICULATION:The qualifications have been developed to provide learners witha preparation for employment, to provide career developmentopportunities for those already in work and to enable progressionand continuation of study in the vocational area (to any associatedlevel 3 vocationally-related qualification or to a level 2 or 3occupational competence qualification such as an NVQ).Edexcel level 2BTEC First Diploma (NQF)NATIONAL QUALIFICATIONS FRAMEWORK LEVEL:Level 2BACKGROUND:The Edexcel level 2 BTEC First Diplomas are designed to providespecialist work-related qualifications in a range of sectors. They areunit-based qualifications that focus on particular aspects ofemployment within a vocational sector. The level 2 BTEC FirstDiploma offers a qualification which can extend the study andprovide vocational emphasis for learners following a GCSE orApplied GCSE (Double Award) route or a combination of both intheir main programme of study. Equally the Edexcel level 2 BTECFirst Diploma offers a focused qualification for learners, particularlymore mature learners, who wish to follow a shorter programme ofstudy that is directly related to their work experience or to anaspect of employment that they wish to move into in due course.There are key aspects within the Edexcel level 2 BTECFirst qualifications.gggggThe qualifications all have a specialist focus.All units are internally assessed and verified.The BTEC First Diplomas have the equivalence on the Schooland College Achievement and Attainment Tables to fourGCSEs (A* – C).There is an overall qualification grade for certification.Some of the qualifications have been approved as TechnicalCertificates.DATE OF FIRST TEACHING:2002DATE OF FIRST AWARD:2003NUMBER OF UNITS/STRUCTURE:Six 60-GLH (guided learning hours) units, including mandatorycore units with the remainder being specialist units, with aqualification size of 360 GLH.ASSESSMENT METHOD:All units are internally assessed and externally verified.The assessment is criterion-referenced, based on theachievement of specified outcomes.GRADING SYSTEM:The grading of units is at Pass, Merit and Distinction, which aredetailed as part of the documents for certification.Each qualification will have an overall grade awarded at Pass,Merit or Distinction and since September 2006 a Distinction*grade has been available.QUALITY ASSURANCE:External verification and National Standards quality assurance isundertaken as follows:gGuidance and unit specificationTo promote consistency, the awarding body issues standardsfor programme/unit outcome, content, assessment andguidance on teaching and learning methods, programmedesign and assessment.gApprovalAny centre (college, school or company) wishing to offer thequalification has to gain approval for that qualification bydemonstrating that specified resources and quality criteriaare met, both for the centre and the qualification.gExternal verificationThe awarding body appoints an external verifier to everysector programme which it approves. These are experiencedpractitioners, normally with occupational competence, fromeducation and industry who are carefully selected andsuitably qualified. They have a responsibility for ensuringthat:gcentres assess student performance using strategiesthat are valid and reliablegnational standards of the qualifications are maintainedgthe consistency of the qualifications nationally ismonitored using national comparisons.Before any awards are issued, an external verifier must confirmthat national standards are being applied consistently andcertification is valid.Verification is undertaken using a range of methods, includingvisits and remote sampling. Sampling of students’ work isundertaken for all programmes.PROGRESSION/ARTICULATION:The qualifications have been developed to provide learners witha preparation for employment, to provide career developmentopportunities for those already in work and to enable progressionand continuation of study in the vocational area (to any associatedlevel 3 vocationally-related qualification or to a level 2 or 3occupational competence qualification such as an NVQ).<strong>UK</strong> QUALIFICATIONS 57
<strong>Qualifications</strong> currently offeredEdexcel BTEC Short Courses(NQF)NATIONAL QUALIFICATIONS FRAMEWORK LEVEL:Levels 1–7BACKGROUND:The BTEC short course framework is flexible, supporting andenabling a range of different progression purposes. Theframework was designed to:gsupport lifelong learning and achievementgprovide access to qualification pathwaysgprovide the means of approving programmes that assessknowledge, understanding and skills developmentgprovide flexibility in terms of target audience, modes ofdelivery and assessment regimesgfacilitate career progression and updating.A number of BTEC short course qualifications have been devisedwhich are included within the NQF. For each qualification:gthere is a very specialist focusgthe structure normally comprises core and specialist unitsgunits are normally 30 or 60 guided learning hoursgsizes across levels 1–7 are normally: Award up to 90 hours,Certificate up to 180 hours, and Diploma up to 300 hoursglevel is indicated by 1, 2, 3, 4, 5, 6 or 7gassessment is internal or external, or a combination,depending on individual structures.ASSESSMENT METHOD:<strong>Qualifications</strong> within the short course framework are assessed,externally verified and recognised through national certification.This is supported by a credit transcript, which records andexplains achievement at each of the levels of units undertaken.QUALITY ASSURANCE:External verification and National Standards Sampling qualityassurance is undertaken as follows:gggGuidance and unit specificationTo promote consistency, the awarding body issues standardsfor programme/unit outcomes, content, assessment andguidance on teaching and learning methods, programmedesign and assessment.ApprovalAny centre (college, university, school or company) wishingto offer the qualification has to gain approval for thatqualification by demonstrating that specified quality criteriaare met, both for the centre and the qualification.External verificationThe awarding body appoints an external verifier (pre-HEprovision) or subject examiner (HE provision) to every sectorprogramme that it approves. These are experiencedpractitioners, normally with occupational competence, fromeducation and industry who are carefully selected and suitablyqualified. They have a responsibility for ensuring that:gcentres assess student performance using strategiesthat are valid and reliablegnational standards of the qualifications are maintainedgthe consistency of the qualifications nationally ismonitored using national comparisons.Before any awards are issued, an external verifier must confirmthat national standards are being applied consistently andcertification is valid. Verification is undertaken using a range ofmethods, including visits and remote sampling. Sampling ofstudents’ work is undertaken for all programmes. Someprogrammes are permitted to report on their own sampling activityrather than be subject to a second central sample in each year.PROGRESSION /ARTICULATIONThe framework is designed to be compatible with the NQF andallows the learner to access and progress through further andhigher qualifications or training.Edexcel level 3 BTEC NationalAward (NQF)NATIONAL QUALIFICATIONS FRAMEWORK LEVEL:Level 3BACKGROUND:The Edexcel level 3 BTEC National Award is a 360-guidedlearning hours unit-based specialist qualification that focuses onparticular aspects of employment within the vocational sector. Assuch, the BTEC National Award offers a qualification which canextend study and provide vocational emphasis for learnersfollowing an Applied GCE or GCE route or a combination of bothin their main programme of study. Equally, the Edexcel level 3BTEC National Award offers a focused qualification for learners,particularly more mature learners, who wish to follow a shorterprogramme of study that is directly related to their workexperience or to an aspect of employment that they wish to moveinto. It is broadly equivalent to one GCE A level.The Edexcel level 3 BTEC National qualifications are designed toprovide specialist work-related qualifications in a range ofsectors. The qualifications have been developed to providelearners with a preparation for employment, to provide careerdevelopment opportunities for those already in work and toenable progression and continuation of study in the vocationalarea, through further or higher education. The Edexcel level 3BTEC National qualifications link to the Occupational Standardsfor the sector where these are appropriate and are supported bythe relevant Sector Skills Council (SSC).DATE OF FIRST TEACHING:2002DATE OF FIRST AWARD:2003NUMBER OF UNITS/STRUCTURE:Six 60-GLH (guided learning hours) units to include mandatorycore units and the remainder being specialist units, with aqualification size of 360 GLH.ASSESSMENT METHOD:All units are internally assessed and externally verified.The assessment is criterion-referenced, based on theachievement of specified outcomes.GRADING SYSTEM:Each unit is assessed and graded at Distinction, Merit or Pass.The qualification will have an overall grade awarded atDistinction, Merit or Pass.GradeUCAS Tariff pointsDistinction 120Merit 80Pass 40QUALITY ASSURANCE:External verification and National Standards Sampling qualityassurance is undertaken as follows:gGuidance and unit specificationTo promote consistency, the awarding body issues standardsfor programme/unit outcome, content, assessment andguidance on teaching and learning methods, programmedesign and assessment.58 <strong>UK</strong> QUALIFICATIONS
<strong>Qualifications</strong> currently offeredggApprovalAny centre (college, university, school or company) wishing tooffer the qualification has to gain approval for thatqualification by demonstrating that specified resources andquality criteria are met, both for the centre and thequalification.External verificationThe awarding body appoints an external verifier to everysector programme which it approves. These are experiencedpractitioners, normally with occupational competence, fromeducation and industry who are carefully selected andsuitably qualified. They have a responsibility for ensuringthat:gcentres assess student performance using strategiesthat are valid and reliablegnational standards of the qualifications are maintainedgthe consistency of the qualifications nationally ismonitored using national comparisons.Before any awards are issued, an external verifier must confirmthat national standards are being applied consistently andcertification is valid.Verification is undertaken using a range of methods, includingvisits and remote sampling. Sampling of students’ work isundertaken for all programmes.PROGRESSION/ARTICULATION:The qualifications have been developed to provide learners with apreparation for employment, to provide career developmentopportunities for those already in work and to enable progressionand continuation of study in the vocational area (to anyassociated level 4 or 5 vocationally-related qualification, includingdegrees, or to a level 3 or 4 vocationally-related qualification oroccupational competence qualification such as an NVQ).Edexcel level 3 BTEC NationalCertificate (NQF)NATIONAL QUALIFICATIONS FRAMEWORK LEVEL:Level 3BACKGROUND:The Edexcel level 3 BTEC National Certificate is a 720-guidedlearning hours unit-based specialist work-related qualificationthat covers the key knowledge and practical skills required in thevocational sector and also offers different emphasis through thechoice of specialist units. It is broadly equivalent to two GCE Alevels or the 12-unit AVCE. The qualification offers an engagingprogramme for 16-19-year-olds who are clear about the area ofemployment they wish to enter. Such learners may wish to extendtheir programme through the study of a related GCE or otherqualification. Alternatively, their access to suitable work situationsmay allow learners to achieve an NVQ qualification or individualNVQ units in the vocational sector. For adult learners the Edexcellevel 3 BTEC National Certificate offers a specialist work-relatedqualification to confirm and extend their work experience if theyare or have been employed in the sector. It also provides asuitable qualification for those wishing to change career or moveinto a particular area of employment following a career break.This qualification provides opportunities which enable progressionand continuation of study in the vocational area through further orhigher education.NUMBER OF UNITS/STRUCTURE:Twelve 60-GLH (guided learning hours) units to includemandatory core units and the remainder being specialist units,with a qualification size of 720 guided learning hours.ASSESSMENT METHOD:All units are internally assessed and externally verified.The assessment is criterion-referenced, based on theachievement of specified outcomes.GRADING SYSTEM:Each unit is assessed and graded at Distinction, Merit or Pass.The qualification will have one of five overall grades awarded, asbelow.GradeUCAS Tariff pointsDD 240DM 200MM 160MP 120PP 80QUALITY ASSURANCE:External verification and National Standards Sampling qualityassurance is undertaken as follows:gggGuidance and unit specificationTo promote consistency, the awarding body issues standardsfor programme/unit outcome, content, assessment andguidance on teaching and learning methods, programmedesign and assessment.ApprovalAny centre (college, university, school or company) wishing tooffer the qualification has to gain approval for thatqualification by demonstrating that specified resources andquality criteria are met, both for the centre and thequalification.External verificationThe awarding body appoints an external verifier to every sectorprogramme which it approves. These are experiencedpractitioners, normally with occupational competence, fromeducation and industry who are carefully selected and suitablyqualified. They have a responsibility for ensuring that:gcentres assess student performance using strategiesthat are valid and reliablegnational standards of the qualifications are maintainedgthe consistency of the qualifications nationally ismonitored using national comparisons.Before any awards are issued, an external verifier must confirmthat national standards are being applied consistently andcertification is valid.Verification is undertaken using a range of methods, includingvisits and remote sampling. Sampling of students’ work isundertaken for all programmes.PROGRESSION/ARTICULATION:The qualifications have been developed to provide learners with apreparation for employment, to provide career developmentopportunities for those already in work and to enable progressionand continuation of study in the vocational area (to anyassociated level 4 or 5 vocationally-related qualification, includingdegrees, or to a level 3 or 4 vocationally-related qualification oroccupational competence qualification such as an NVQ).DATE OF FIRST TEACHING:2002DATE OF FIRST AWARD:2003<strong>UK</strong> QUALIFICATIONS 59
<strong>Qualifications</strong> currently offeredEdexcel level 3 BTEC NationalDiploma (NQF)NATIONAL QUALIFICATIONS FRAMEWORK LEVEL:Level 3BACKGROUND:The Edexcel level 3 BTEC National Diploma is a 1080-guidedlearning hours unit-based qualification designed to extend anddeepen the specialist focus available in the Certificate. It isbroadly equivalent to three GCE A levels. The qualificationprepares learners for employment in the sector and will besuitable for 16-19-year-olds who have already decided that theywish to enter a specific area of work. Some adult learners maywish to make the commitment required by this qualification inorder to enter a specialist area of employment or progress intohigher education. Other learners may want to extend thespecialism that they followed on the Edexcel level 3 BTECNational Certificate. Progression from this qualification could beinto employment where learners may progress to professionalbody examinations. Alternatively, learners may progress to degreeor other higher education studies in the vocational sector or arelated one.DATE OF FIRST TEACHING:2002DATE OF FIRST AWARD:2003NUMBER OF UNITS/STRUCTURE:Eighteen 60-GLH (guided learning hours) units to includemandatory core units and the remainder being specialist units,with a qualification size of 1080 guided learning hours.ASSESSMENT METHOD:All units are internally assessed and externally verified.The assessment is criterion-referenced, based on theachievement of specified outcomes.GRADING SYSTEM:Each unit is assessed and graded at Distinction, Merit or Pass.The qualification will have one of seven overall grades awarded,as below.Grade UCAS Tariff pointsDDD 360DDM 320DMM 280MMM 240MMP 200MPP 160PPP 120QUALITY ASSURANCE:External verification and National Standards Sampling qualityassurance is undertaken as follows:ggGuidance and unit specificationTo promote consistency, the awarding body issues standardsfor programme/unit outcome, content, assessment andguidance on teaching and learning methods, programmedesign and assessment.ApprovalAny centre (college, university, school or company) wishing tooffer the qualification has to gain approval for thatqualification by demonstrating that specified resources andquality criteria are met, both for the centre and thequalification.gExternal verificationThe awarding body appoints an external verifier to everysector programme which it approves. These are experiencedpractitioners, normally with occupational competence, fromeducation and industry who are carefully selected andsuitably qualified. They have a responsibility for ensuringthat:gggcentres assess student performance using strategiesthat are valid and reliablenational standards of the qualifications are maintainedthe consistency of the qualifications nationally ismonitored using national comparisons.Before any awards are issued, an external verifier must confirmthat national standards are being applied consistently andcertification is valid.Verification is undertaken using a range of methods, includingvisits and remote sampling. Sampling of students’ work isundertaken for all programmes.PROGRESSION/ARTICULATION:The qualifications have been developed to provide learners with apreparation for employment, to provide career developmentopportunities for those already in work and to enable progressionand continuation of study in the vocational area (to anyassociated level 4 or 5 vocationally-related qualification, includingdegrees, or to a level 3 or 4 vocationally-related qualification oroccupational competence qualification such as an NVQ).Edexcel level 5 BTEC HigherNational Certificate (NQF)QUALIFICATION ABBREVIATION:BTEC HNCNATIONAL QUALIFICATIONS FRAMEWORK LEVEL:Level 5BACKGROUND:BTEC HNCs are currently designed to equip students with theknowledge, understanding and skills required for success incurrent and future employment or for progression to anundergraduate degree, NVQs and/or professional bodyqualifications. These vocationally related qualifications will enablestudents to meet changing circumstances, whether these arisefrom a shift in their own sphere of employment, promotion tosupervisory or management roles or from general changes inbusiness/professional practices, technological advances or thework environment.Many major professional bodies recognise Edexcel’s BTECqualifications for exemption from professional examinationsand/or entry to full corporate membership. In some professions,the Edexcel BTEC qualification is the main route to professionalqualifications. Because employers and professional bodies areheavily involved in the design of Edexcel’s BTEC qualifications,they are recognised in industry and commerce. Someprogrammes have been approved to run in-company at trainingcentres to meet particular company needs.DATE OF FIRST TEACHING:The first BTEC NQF HNCs were introduced in 2003.60 <strong>UK</strong> QUALIFICATIONS
<strong>Qualifications</strong> currently offeredDATE OF FIRST AWARD:2004PREREQUISITES:Learners should have a profile of qualifications and/or experiencethat shows an ability to progress to a level 5 qualification. Forlearners who have recently been in education, the entry profile islikely to include one of the following:gggggga BTEC National Certificate or Diplomaan AVCE/Advanced GNVQ in an appropriate vocational areaa GCE Advanced level profile that demonstrates strongperformance in a relevant subject or an adequateperformance in more than one GCE subject. This profile islikely to be supported by GCSE grades at A* – Cother related level 3 qualificationsan Access to Higher Education Certificate awarded by anapproved further education institutionrelated work experience.Mature learners may present a more varied profile ofachievement that is likely to include extensive work experience(paid and/or unpaid) and/or achievement of a range ofprofessional qualifications in their work sector.NUMBER OF UNITS/STRUCTURE:An HNC consists of 10 units, all of which have to be achieved atPass or above.Units in the HNC are at one of two notional levels H1 and H2 (H1= level 4, H2 = level 5) and are used to designate the relativeintellectual demand, complexity, depth of study and learnerautonomy for the unit. In these HNCs, at least 50% of the unitsmust be at H2 level. H2 level places the emphasis, for example,on the application and evaluation of contrasting ideas, principles,theories and practices, greater specialisation in the field of study,and an increasing independence in systematic enquiry andanalysis. H2 units are, generally speaking, studied in the finalyear, building on prior knowledge or H1 units.ASSESSMENT METHOD:Assessment instruments are constructed by centres. Assessmentinstruments should collectively ensure coverage of all assessmentcriteria within each unit and should provide opportunities for theevidencing of all the grade descriptors. It is advised thatassessment criteria and contextualised grade descriptors areclearly indicated on each assessment instrument to provide afocus for learners (for transparency and to ensure that feedbackis specific to the criteria) and to assist with internal standardisationprocesses. Tasks/activities should enable learners to produceevidence that relates directly to the assessment criteria andgrade descriptors.GRADING SYSTEM:Each unit is graded Pass, Merit or Distinction using gradingdescriptors provided for the Higher Nationals. All NQF BTECHigher National qualifications are awarded at Pass or Fail.HEIs often specify the number of H2 units and/or the number ofMerit or Distinction unit grades (sometimes specifying these)when framing their offers for degree programmes etc.QUALITY ASSURANCE:Independent assessment via external examiners.PROGRESSION/ARTICULATION:Into level 5 or 6 qualifications, such as degrees and/orprofessional body qualifications, often allowing exemption fromthe first year and/or second year of a degree or a specified partof a professional qualification.Edexcel level 5 BTEC HigherNational Diploma (NQF)QUALIFICATION ABBREVIATION:BTEC HNDNATIONAL QUALIFICATIONS FRAMEWORK LEVEL:Level 5BACKGROUND:BTEC HNDs are currently designed to equip students with theknowledge, understanding and skills required for success incurrent and future employment or for progression to anundergraduate degree, NVQs and/or professional bodyqualifications. These vocationally-related qualifications will enablestudents to meet changing circumstances, whether these arisefrom a shift in their own sphere of employment, promotion tosupervisory or management roles or from general changes inbusiness/professional practices, technological advances or thework environment. The BTEC HND provides a wider breadth ofstudy than the BTEC HNC.Many major professional bodies recognise Edexcel’s BTECqualifications for exemption from professional examinationsand/or entry to full corporate membership. In some professions,the Edexcel BTEC qualification is the main route to professionalqualifications. Because employers and professional bodies areheavily involved in the design of Edexcel’s BTEC qualifications,they are recognised in industry and commerce. Someprogrammes have been approved to run in-company at trainingcentres to meet particular company needs.DATE OF FIRST TEACHING:The BTEC NQF HNDs were first introduced in 2003.DATE OF FIRST AWARD:2004PREREQUISITES:Learners should have a profile of qualifications and/or experiencethat shows an ability to progress to a level 5 qualification. Forlearners who have recently been in education, the entry profile islikely to include one of the following:gggggga BTEC National Certificate or Diplomaan AVCE/Advanced GNVQ in an appropriate vocational areaa GCE Advanced level profile that demonstrates strongperformance in a relevant subject or an adequateperformance in more than one GCE subject. This profile islikely to be supported by GCSE grades at A* – Cother related level 3 qualificationsan Access to Higher Education Certificate awarded by anapproved further education institutionrelated work experience.Mature learners may present a more varied profile ofachievement that is likely to include extensive work experience(paid and/or unpaid) and/or achievement of a range ofprofessional qualifications in their work sector.NUMBER OF UNITS/STRUCTURE:HNDs consist of 16 units, all of which have to be achieved atPass or above.H1 and H2 are notional level indicators, which show the relativeintellectual demand, complexity, depth of study and learnerautonomy. In all versions of HNDs and HNCs at least 50% of theunits must be at H2 level. H2 level places the emphasis, forexample, on the application and evaluation of contrasting ideas,principles, theories and practices, greater specialisation in thefield of study, and an increasing independence in systematic<strong>UK</strong> QUALIFICATIONS 61
<strong>Qualifications</strong> currently offeredenquiry and analysis. H2 units are, generally speaking, studied inthe final year, building on prior knowledge or H1 units.ASSESSMENT METHOD:Assessment instruments are constructed by centres. Assessmentinstruments should collectively ensure coverage of all assessmentcriteria within each unit and should provide opportunities for theevidencing of all the grade descriptors. It is advised thatassessment criteria and contextualised grade descriptors areclearly indicated on each assessment instrument to provide afocus for learners (for transparency and to ensure that feedbackis specific to the criteria) and to assist with internalstandardisation processes. Tasks/activities should enable learnersto produce evidence that relates directly to the assessmentcriteria and grade descriptors.All units are internally assessed.GRADING SYSTEM:Each unit is graded Pass, Merit or Distinction using gradingdescriptors provided for the Higher Nationals. All NQF BTECHigher National qualifications are graded pass or fail.HEIs often specify the number of H2 units and/or the number ofMerit or Distinction unit grades (sometimes specifying these)when framing their offers for degree programmes etc.QUALITY ASSURANCE:Independent assessment via external examiners.PROGRESSION/ARTICULATION:Into level 5 or 6 qualifications, such as degrees and/orprofessional body qualifications, often allowing exemption fromthe first year and/or second year of a degree or a specified partof a professional qualification.Edexcel BTEC level 2 Certificate(QCF)QCF LEVEL:Level 2BACKGROUND:The new Edexcel BTEC level 2 Certificates are designed toprovide specialist work-related qualifications in a range ofsectors. They give learners the knowledge, understanding andskills that they need to prepare for employment or for educationprogression. They also provide career development opportunitiesfor those already in work.DATE OF FIRST TEACHING:2010DATE OF FIRST AWARD:2011NUMBER OF UNITS/STRUCTURE:Specified mandatory units and a choice of optional units to total15 creditsASSESSMENT METHOD:All units are internally assessed and externally verified.The assessment is criterion-referenced, based on theachievement of specified outcomes.GRADING SYSTEM:The grading of units is at Pass, Merit and Distinction, which aredetailed as part of the documents for certification.Each qualification will have an overall grade awarded at Pass,Merit, Distinction or Distinction*.QUALITY ASSURANCE:External verification and National Standards quality assurance isundertaken as follows:gggGuidance and unit specificationTo promote consistency, the awarding body issues standardsfor programme/unit outcome, content, assessment andguidance on teaching and learning methods, programmedesign and assessment.ApprovalAny centre (college, school or company) wishing to offer thequalification has to gain approval for that qualification bydemonstrating that specified resources and quality criteriaare met, both for the centre and the qualification.Standards verificationThe awarding body appoints a standards verifier to everysector programme which it approves. These are experiencedpractitioners, normally with occupational competence, fromeducation and industry who are carefully selected andsuitably qualified. They have a responsibility for ensuringthat:gggcentres assess student performance using strategiesthat are valid and reliablenational standards of the qualifications are maintainedthe consistency and standards are verified by the LeadInternal Verifiergthe consistency of the qualifications nationally ismonitored using national comparisons.Before any awards are issued, standards verification mustconfirm that national standards are being applied consistentlyand certification is valid.Verification is undertaken using a range of methods, includingvisits and remote sampling. Sampling of students’ work isundertaken for all programmes.PROGRESSION/ARTICULATION:The qualifications have been developed to provide learners with apreparation for employment, to provide career developmentopportunities for those already in work and to enable progressionand continuation of study in the vocational area (to anyassociated level 3 vocationally-related qualification or to a level 2or 3 occupational competence qualification such as an NVQ).Edexcel BTEC level 2 ExtendedCertificate (QCF)QCF LEVEL:Level 2BACKGROUND:These new QCF BTEC level 2 Extended Certificates replace thelevel 2 BTEC First Certificates which were accredited on the NQF.They are designed to provide specialist work-related qualificationsin a range of sectors. They give learners the knowledge,understanding and skills that they need to prepare foremployment or for education progression. They also providecareer development opportunities for those already in work.DATE OF FIRST TEACHING:2010DATE OF FIRST AWARD:201162 <strong>UK</strong> QUALIFICATIONS
<strong>Qualifications</strong> currently offeredNUMBER OF UNITS/STRUCTURE:Specified mandatory units and a choice of optional units to total30 creditsASSESSMENT METHOD:All units are internally assessed and externally verified.The assessment is criterion-referenced, based on theachievement of specified outcomes.GRADING SYSTEM:The grading of units is at Pass, Merit and Distinction, which aredetailed as part of the documents for certification.Each qualification will have an overall grade awarded at Pass,Merit, Distinction or Distinction*.QUALITY ASSURANCE:External verification and National Standards quality assurance isundertaken as follows:gggGuidance and unit specificationTo promote consistency, the awarding body issues standardsfor programme/unit outcome, content, assessment andguidance on teaching and learning methods, programmedesign and assessment.ApprovalAny centre (college, school or company) wishing to offer thequalification has to gain approval for that qualification bydemonstrating that specified resources and quality criteriaare met, both for the centre and the qualification.Standards verificationThe awarding body appoints a standards verifier to everysector programme which it approves. These are experiencedpractitioners, normally with occupational competence, fromeducation and industry who are carefully selected andsuitably qualified. They have a responsibility for ensuringthat:gggcentres assess student performance using strategiesthat are valid and reliablenational standards of the qualifications are maintainedthe consistency and standards are verified by the LeadInternal Verifiergthe consistency of the qualifications nationally ismonitored using national comparisons.Before any awards are issued, standards verification mustconfirm that national standards are being applied consistentlyand certification is valid.Verification is undertaken using a range of methods, includingvisits and remote sampling. Sampling of students’ work isundertaken for all programmes.PROGRESSION/ARTICULATION:The qualifications have been developed to provide learners with apreparation for employment, to provide career developmentopportunities for those already in work and to enable progressionand continuation of study in the vocational area (to anyassociated level 3 vocationally-related qualification or to a level 2or 3 occupational competence qualification such as an NVQ).Edexcel BTEC level 2 Diploma(QCF)QCF LEVEL:Level 2BACKGROUND:These new QCF BTEC level 2 Diplomas replace the level 2 BTECFirst Diplomas which were accredited on the NQF. They aredesigned to provide specialist work-related qualifications in arange of sectors. They give learners the knowledge,understanding and skills that they need to prepare foremployment or for education progression. They also providecareer development opportunities for those already in work.DATE OF FIRST TEACHING:2010DATE OF FIRST AWARD:2011NUMBER OF UNITS/STRUCTURE:Specified mandatory units and a choice of optional units to total60 creditsASSESSMENT METHOD:All units are internally assessed and externally verified.The assessment is criterion-referenced, based on theachievement of specified outcomes.GRADING SYSTEM:The grading of units is at Pass, Merit and Distinction, which aredetailed as part of the documents for certification.Each qualification will have an overall grade awarded at Pass,Merit, Distinction or Distinction*.QUALITY ASSURANCE:External verification and National Standards quality assurance isundertaken as follows:gggGuidance and unit specificationTo promote consistency, the awarding body issues standardsfor programme/unit outcome, content, assessment andguidance on teaching and learning methods, programmedesign and assessment.ApprovalAny centre (college, school or company) wishing to offer thequalification has to gain approval for that qualification bydemonstrating that specified resources and quality criteriaare met, both for the centre and the qualification.Standards verificationThe awarding body appoints a standards verifier to everysector programme which it approves. These are experiencedpractitioners, normally with occupational competence, fromeducation and industry who are carefully selected andsuitably qualified. They have a responsibility for ensuringthat:ggggcentres assess student performance using strategiesthat are valid and reliablenational standards of the qualifications are maintainedthe consistency and standards are verified by theLead Internal Verifierthe consistency of the qualifications nationally ismonitored using national comparisons.Before any awards are issued, standards verification mustconfirm that national standards are being applied consistentlyand certification is valid.<strong>UK</strong> QUALIFICATIONS 63
<strong>Qualifications</strong> currently offeredVerification is undertaken using a range of methods, includingvisits and remote sampling. Sampling of students’ work isundertaken for all programmes.PROGRESSION/ARTICULATION:The qualifications have been developed to provide learners with apreparation for employment, to provide career developmentopportunities for those already in work and to enable progressionand continuation of study in the vocational area (to anyassociated level 3 vocationally-related qualification or to a level 2or 3 occupational competence qualification such as an NVQ).Edexcel BTEC Specialist Level 3Awards, Certificates andDiplomas (QCF) - designedoriginally for inclusion inAdvanced DiplomasQCF LEVEL:Level 3BACKGROUND:These graded BTEC level 3 Specialist qualifications have beenspecifically developed by Edexcel and have been drawn fromQCF-accredited BTEC level 3 National qualifications. They weredesigned for inclusion as Additional and Specialist learning for the14-19 Advanced Diploma, but may also be taken as independentBTEC specialist qualifications.DATE OF FIRST TEACHING:2010DATE OF FIRST AWARD:2011NUMBER OF UNITS/STRUCTURE:<strong>Qualifications</strong> are 10, 30 or 60 credits, depending upon thenumber of 10-credit units included.ASSESSMENT METHOD:All units are internally assessed and externally verified.The assessment is criterion-referenced, based on theachievement of specified outcomes.GRADING SYSTEM:Each unit is graded Pass, Merit or Distinction.Each qualification will have an overall grade awarded at Pass,Merit, or Distinction and carry UCAS Tariff points for entry tohigher education as shown below.AWARDSGradeUCAS Tariff pointsDistinction 20Merit 13Pass 7CERTIFICATESGradeUCAS Tariff pointsDistinction 60Merit 40Pass 20DIPLOMASGradeUCAS Tariff pointsDistinction 120Merit 80Pass 40QUALITY ASSURANCE:External verification and National Standards quality assurance isundertaken as follows:gggGuidance and unit specificationTo promote consistency, the awarding body issues standardsfor programme/unit outcome, content, assessment andguidance on teaching and learning methods, programmedesign and assessment.ApprovalAny centre (college, school or company) wishing to offer thequalification has to gain approval for that qualification bydemonstrating that specified resources and quality criteriaare met, both for the centre and the qualification.Standards verificationThe awarding body appoints a standards verifier to everysector programme which it approves. These are experiencedpractitioners, normally with occupational competence, fromeducation and industry who are carefully selected andsuitably qualified. They have a responsibility for ensuringthat:gcentres assess student performance using strategiesthat are valid and reliablegnational standards of the qualifications are maintainedgthe consistency and standards are verified by theLead Internal Verifiergthe consistency of the qualifications nationally ismonitored using national comparisons.Before any awards are issued, standards verification mustconfirm that national standards are being applied consistentlyand certification is valid.Verification is undertaken using a range of methods, includingvisits and remote sampling. Sampling of students’ work isundertaken for all programmes.PROGRESSION/ARTICULATION:Apprenticeships, employment, further learning.Edexcel BTEC level 3 Certificate(QCF)QCF LEVEL:Level 3BACKGROUND:The new Edexcel BTEC level 3 Certificates are designed toprovide highly specialist work-related qualifications in a range ofvocational sectors. They give learners the knowledge,understanding and skills that they need to prepare foremployment. They also provide career development opportunitiesfor those already in work, and through articulation to highereducation, degree and professional development programmesprovide progression opportunities within the same cognate orrelated areas of study within universities and other institutions.DATE OF FIRST TEACHING:2010DATE OF FIRST AWARD:2011NUMBER OF UNITS/STRUCTURE:Specified mandatory units and a choice of optional units to total30 creditsASSESSMENT METHOD:All units are internally assessed and externally verified.64 <strong>UK</strong> QUALIFICATIONS
<strong>Qualifications</strong> currently offeredThe assessment is criterion-referenced, based on theachievement of specified outcomes.GRADING SYSTEM:Each unit is assessed and graded at Distinction, Merit or Pass.The qualification will have an overall grade awarded atDistinction*, Distinction, Merit or Pass, as below.GradeUCAS Tariff pointsD* 70D 60M 40P 20QUALITY ASSURANCE:External verification and National Standards quality assurance isundertaken as follows:gggGuidance and unit specificationTo promote consistency, the awarding body issues standardsfor programme/unit outcome, content, assessment andguidance on teaching and learning methods, programmedesign and assessment.ApprovalAny centre (college, university, school or company) wishing tooffer the qualification has to gain approval for that qualificationby demonstrating that specified resources and quality criteriaare met, both for the centre and the qualification.Standards verificationThe awarding body appoints a standards verifier to every sectorprogramme which it approves. These are experiencedpractitioners, normally with occupational competence, fromeducation and industry who are carefully selected and suitablyqualified. They have a responsibility for ensuring that:gcentres assess student performance using strategiesthat are valid and reliablegnational standards of the qualifications are maintainedgthe consistency and standards are verified by theLead Internal Verifiergthe consistency of the qualifications nationally ismonitored using national comparisons.Before any awards are issued, standards verification mustconfirm that national standards are being applied consistentlyand certification is valid.Verification is undertaken using a range of methods, includingvisits and remote sampling. Sampling of students’ work isundertaken for all programmes.PROGRESSION/ARTICULATION:The qualifications have been developed to provide learners with apreparation for employment, to provide career developmentopportunities for those already in work and to enable progressionand continuation of study in the vocational area (to anyassociated level 4 or 5 vocationally-related qualification, includingdegrees, or to a level 3 or 4 vocationally-related qualification oroccupational competence qualification such as an NVQ).Edexcel BTEC level 3 SubsidiaryDiploma (QCF)QCF LEVEL:Level 3BACKGROUND:These new QCF BTEC level 3 Subsidiary Diplomas replace thelevel 3 BTEC National Awards which were accredited on the NQF.They are designed to provide highly specialist work-relatedqualifications in a range of vocational sectors. They give learnersthe knowledge, understanding and skills that they need toprepare for employment. They also provide career developmentopportunities for those already in work, and through articulationto higher education, degree and professional developmentprogrammes provide progression opportunities within the samecognate or related areas of study within universities and otherinstitutions.DATE OF FIRST TEACHING:2010DATE OF FIRST AWARD:2011NUMBER OF UNITS/STRUCTURE:Specified mandatory units and a choice of optional units to total60 creditsASSESSMENT METHOD:All units are internally assessed and externally verified.The assessment is criterion-referenced, based on theachievement of specified outcomes.GRADING SYSTEM:Each unit is assessed and graded at Distinction, Merit or Pass.The qualification will have an overall grade awarded atDistinction*, Distinction, Merit or Pass, as below.GradeUCAS Tariff pointsD* 140D 120M 80P 40QUALITY ASSURANCE:External verification and National Standards quality assurance isundertaken as follows:gggGuidance and unit specificationTo promote consistency, the awarding body issues standardsfor programme/unit outcome, content, assessment andguidance on teaching and learning methods, programmedesign and assessment.ApprovalAny centre (college, university, school or company) wishing tooffer the qualification has to gain approval for thatqualification by demonstrating that specified resources andquality criteria are met, both for the centre and thequalification.Standards verificationThe awarding body appoints a standards verifier to everysector programme which it approves. These are experiencedpractitioners, normally with occupational competence, fromeducation and industry who are carefully selected andsuitably qualified. They have a responsibility for ensuringthat:ggggcentres assess student performance using strategiesthat are valid and reliablenational standards of the qualifications are maintainedthe consistency and standards are verified by theLead Internal Verifierthe consistency of the qualifications nationally ismonitored using national comparisons.Before any awards are issued, standards verification mustconfirm that national standards are being applied consistentlyand certification is valid.<strong>UK</strong> QUALIFICATIONS 65
<strong>Qualifications</strong> currently offeredVerification is undertaken using a range of methods, includingvisits and remote sampling. Sampling of students’ work isundertaken for all programmes.PROGRESSION/ARTICULATION:The qualifications have been developed to provide learners with apreparation for employment, to provide career developmentopportunities for those already in work and to enable progressionand continuation of study in the vocational area (to anyassociated level 4 or 5 vocationally-related qualification, includingdegrees, or to a level 3 or 4 vocationally-related qualification oroccupational competence qualification such as an NVQ).Edexcel BTEC level 3 90-CreditDiploma (QCF)QCF LEVEL:Level 3BACKGROUND:The BTEC level 3 90-Credit Diploma (QCF) is built from theexisting bank of QCF BTEC level 3 units and uses the same BTECassessment approach. The 540 GLH size allows centres to delivera full level 3 qualification in just one year of curriculum time,supporting achievement and future progression. This newqualification provides the opportunity for learners to gain a moresubstantial chunk of achievement in the first year that will bemore easily recognised by employers, or built on with furtherlearning.DATE OF FIRST TEACHING:2010DATE OF FIRST AWARD:2011NUMBER OF UNITS/STRUCTURE:Specified mandatory units and a choice of optional units to total60 credits.ASSESSMENT METHOD:All units are internally assessed and externally verified.The assessment is criterion-referenced, based on theachievement of specified outcomes.GRADING SYSTEM:GradeUCAS Tariff pointsD*D* 210D*D 200DD 180DM 160MM 120MP 100PP 60QUALITY ASSURANCE:External verification and National Standards quality assurance isundertaken as follows:ggGuidance and unit specificationTo promote consistency, the awarding body issues standardsfor programme/unit outcome, content, assessment andguidance on teaching and learning methods, programmedesign and assessment.ApprovalAny centre (college, university, school or company) wishing tooffer the qualification has to gain approval for thatqualification by demonstrating that specified resources andquality criteria are met, both for the centre and thequalification.gStandards verificationThe awarding body appoints a standards verifier to every sectorprogramme which it approves. These are experiencedpractitioners, normally with occupational competence, fromeducation and industry who are carefully selected and suitablyqualified. They have a responsibility for ensuring that:ggggcentres assess student performance using strategiesthat are valid and reliablenational standards of the qualifications are maintainedthe consistency and standards are verified by theLead Internal Verifierthe consistency of the qualifications nationally ismonitored using national comparisons.Before any awards are issued, standards verification mustconfirm that national standards are being applied consistentlyand certification is valid.Verification is undertaken using a range of methods, includingvisits and remote sampling. Sampling of students’ work isundertaken for all programmes.PROGRESSION/ARTICULATION:There is potential for the qualification to prepare learners forprogression within education or into employment in theappropriate vocational sector and it is suitable for those who havedecided that they wish to study in detail or work in a particulararea of work. It is broadly equivalent to 1.5 GCE A levels andprovides a programme of study manageable in a year so thatlearners can bank and then build on their achievement. In thisway it encourages progression for those learners who wish toundertake a one-year course of study because of individualcircumstances.Some learners may wish to gain the qualification in order to entera specialist area of employment or to progress to a larger ordifferent level 3 programme. Other learners may want to extendthe specialism they studied on the BTEC level 3 Certificate or theBTEC level 3 Subsidiary Diploma programme. Learners may alsobe able to use the BTEC level 3 90-Credit Diploma to gain partialachievement and have the requisite skills, knowledge andunderstanding needed in the sector.For adult learners the BTEC level 3 90-Credit Diploma can extendtheir experience of working in a particular sector. It could also bea suitable qualification for those wishing to change career ormove into a particular area of employment following a careerbreak.Edexcel BTEC level 3 Diploma(QCF)QCF LEVEL:Level 3BACKGROUND:These new QCF BTEC level 3 Diplomas replace the level 3 BTECNational Certificates which were accredited on the NQF. They aredesigned to provide highly specialist work-related qualifications ina range of vocational sectors. They give learners the knowledge,understanding and skills that they need to prepare foremployment. They also provide career development opportunitiesfor those already in work, and through articulation to highereducation, degree and professional development programmesprovide progression opportunities within the same cognate orrelated areas of study within universities and other institutions.DATE OF FIRST TEACHING:201066 <strong>UK</strong> QUALIFICATIONS
<strong>Qualifications</strong> currently offeredDATE OF FIRST AWARD:2011NUMBER OF UNITS/STRUCTURE:Specified mandatory units and a choice of optional units to total120 creditsASSESSMENT METHOD:All units are internally assessed and externally verified.The assessment is criterion-referenced, based on theachievement of specified outcomes.GRADING SYSTEM:Each unit is assessed and graded at Distinction, Merit or Pass.The qualification will have one of seven overall grades awarded,as below.GradeUCAS Tariff pointsD*D* 280D*D 260DD 240DM 200MM 160MP 120PP 80QUALITY ASSURANCE:External verification and National Standards quality assurance isundertaken as follows:gGuidance and unit specificationTo promote consistency, the awarding body issues standards forprogramme/unit outcome, content, assessment and guidance onteaching and learning methods, programme design andassessment.gApprovalAny centre (college, university, school or company) wishing tooffer the qualification has to gain approval for that qualification bydemonstrating that specified resources and quality criteria aremet, both for the centre and the qualification.gStandards verificationThe awarding body appoints a standards verifier to every sectorprogramme which it approves. These are experiencedpractitioners, normally with occupational competence, fromeducation and industry who are carefully selected and suitablyqualified. They have a responsibility for ensuring that:gcentres assess student performance using strategiesthat are valid and reliablegnational standards of the qualifications are maintainedgthe consistency and standards are verified by theLead Internal Verifiergthe consistency of the qualifications nationally ismonitored using national comparisons.Before any awards are issued, standards verification mustconfirm that national standards are being applied consistentlyand certification is valid.Verification is undertaken using a range of methods, includingvisits and remote sampling. Sampling of students’ work isundertaken for all programmes.PROGRESSION/ARTICULATION:The qualifications have been developed to provide learners with apreparation for employment, to provide career developmentopportunities for those already in work and to enable progressionand continuation of study in the vocational area (to anyassociated level 4 or 5 vocationally-related qualification, includingdegrees, or to a level 3 or 4 vocationally-related qualification oroccupational competence qualification such as an NVQ).Edexcel BTEC level 3 ExtendedDiploma (QCF)QCF LEVEL:Level 3BACKGROUND:These new QCF BTEC level 3 Extended Diplomas replace thelevel 3 BTEC National Diplomas which were accredited on theNQF. They are designed to provide highly specialist work-relatedqualifications in a range of vocational sectors. They give learnersthe knowledge, understanding and skills that they need toprepare for employment. They also provide career developmentopportunities for those already in work, and through articulationto higher education, degree and professional developmentprogrammes provide progression opportunities within the samecognate or related areas of study within universities and otherinstitutions.DATE OF FIRST TEACHING:2010DATE OF FIRST AWARD:2011NUMBER OF UNITS/STRUCTURE:Specified mandatory units and a choice of optional units to total180 creditsASSESSMENT METHOD:All units are internally assessed and externally verified.The assessment is criterion-referenced, based on theachievement of specified outcomes.GRADING SYSTEM:Each unit is assessed and graded at Distinction, Merit or Pass.The qualification will have one of ten overall grades awarded, asbelow.GradeUCAS Tariff pointsD*D*D* 420D*D*D 400D*DD 380DDD 360DDM 320DMM 280MMM 240MMP 200MPP 160PPP 120QUALITY ASSURANCE:External verification and National Standards quality assurance isundertaken as follows:gggGuidance and unit specificationTo promote consistency, the awarding body issues standardsfor programme/unit outcome, content, assessment andguidance on teaching and learning methods, programmedesign and assessment.ApprovalAny centre (college, university, school or company) wishing tooffer the qualification has to gain approval for thatqualification by demonstrating that specified resources andquality criteria are met, both for the centre and thequalification.Standards verificationThe awarding body appoints a standards verifier to everysector programme which it approves. These are experiencedpractitioners, normally with occupational competence, from<strong>UK</strong> QUALIFICATIONS 67
<strong>Qualifications</strong> currently offerededucation and industry who are carefully selected andsuitably qualified. They have a responsibility for ensuringthat:gcentres assess student performance using strategiesthat are valid and reliablegnational standards of the qualifications are maintainedgthe consistency and standards are verified by theLead Internal Verifiergthe consistency of the qualifications nationally ismonitored using national comparisons.Before any awards are issued, standards verification mustconfirm that national standards are being applied consistentlyand certification is valid.Verification is undertaken using a range of methods, includingvisits and remote sampling. Sampling of students’ work isundertaken for all programmes.PROGRESSION/ARTICULATION:The qualifications have been developed to provide learners with apreparation for employment, to provide career developmentopportunities for those already in work and to enable progressionand continuation of study in the vocational area (to anyassociated level 4 or 5 vocationally-related qualification, includingdegrees, or to a level 3 or 4 vocationally-related qualification oroccupational competence qualification such as an NVQ).gggGuidance and unit specificationTo promote consistency, the awarding body issues standardsfor programme/unit outcome, content, assessment andguidance on teaching and learning methods, programmedesign and assessment.ApprovalAny centre (college, university, school or company) wishing tooffer the qualification has to gain approval for thatqualification by demonstrating that specified resources andquality criteria are met, both for the centre and thequalification.Standards verificationThe awarding body appoints a standards verifier to everysector programme which it approves. These are experiencedpractitioners, normally with occupational competence, fromeducation and industry who are carefully selected andsuitably qualified. They have a responsibility for ensuringthat:ggggcentres assess student performance using strategiesthat are valid and reliablenational standards of the qualifications are maintainedthe consistency and standards are verified by theLead Internal Verifierthe consistency of the qualifications nationally ismonitored using national comparisons.Edexcel BTEC Specialist courseslevels 1-3 (QCF)QUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Levels 1–3BACKGROUND:The BTEC specialist course framework is flexible, supporting andenabling a range of different progression purposes. Theframework was designed to:gggggsupport lifelong learning and achievementprovide access to qualification pathwaysprovide the means of approving programmes that assessknowledge, understanding and skills developmentprovide flexibility in terms of target audience, modes ofdelivery and assessment regimesfacilitate career progression and updating.A number of BTEC specialist course qualifications have beendevised which are included within the QCF. For each qualification:gthere is a very specialist focusgthe structure normally comprises core and specialist unitsgsizes across levels 1–3 are normally: Award up to 12 credits,Certificate up to 36 credits, and Diploma 37 + creditsglevel is indicated by 1, 2, or 3gassessment is internal or external, or a combination,depending on individual structures.ASSESSMENT METHOD:<strong>Qualifications</strong> within the short course framework are assessed,externally verified and recognised through national certification.This is supported by a credit transcript, which records andexplains achievement at each of the levels of units undertaken.QUALITY ASSURANCE:External verification and National Standards quality assurance isundertaken as follows:Before any awards are issued, standards verification mustconfirm that national standards are being applied consistentlyand certification is valid.Verification is undertaken using a range of methods, includingvisits and remote sampling. Sampling of students’ work isundertaken for all programmes.PROGRESSION/ARTICULATION:The qualifications have been developed to provide learners with apreparation for employment, to provide career developmentopportunities for those already in work and to enable progressionand continuation of study in the vocational area (to anyassociated level 4 or 5 vocationally-related qualification, includingdegrees, or to a level 3 or 4 vocationally-related qualification oroccupational competence qualification such as an NVQ).Edexcel WorkSkills levels 1-3(QCF)QUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Entry level and levels 1–3BACKGROUND:The WorkSkills suite comprises over 100 units and severalqualifications across four levels: entry 3, level 1, level 2 andlevel 3.WorkSkills is a flexible qualification, available in a range of sizesand levels, which can enrich curriculum at any time of the year.The qualification is funded and contributes to FoundationLearning provision at entry 3 and level 1 . It has an extensiverange of units, giving the opportunity to build a customised BTECthat caters for learners’ needs. WorkSkills provides recognition forlearners’ abilities and evidence of the skills required for successin the workplace.68 <strong>UK</strong> QUALIFICATIONS
<strong>Qualifications</strong> currently offeredThere are four skills pathways within the WorkSkills framework:ggggPersonal Life SkillsSustainable Employability SkillsWork Placement SkillsSkills for Business.Learners combine units from across these pathways to buildqualifications of different sizes and different levels.ASSESSMENT METHOD:BTEC WorkSkills is internally assessed and externally verified. Toachieve a ‘pass’ a learner must have successfully achieved all theassessment criteria.QUALITY ASSURANCE:External verification and National Standards quality assurance isundertaken as follows:gggGuidance and unit specificationTo promote consistency, the awarding body issues standardsfor programme/unit outcome, content, assessment andguidance on teaching and learning methods, programmedesign and assessment.ApprovalAny centre (college, university, school or company) wishing tooffer the qualification has to gain approval for thatqualification by demonstrating that specified resources andquality criteria are met, both for the centre and thequalification.Standards verificationThe awarding body appoints a standards verifier to everysector programme which it approves. These are experiencedpractitioners, normally with occupational competence, fromeducation and industry who are carefully selected andsuitably qualified. They have a responsibility for ensuringthat:ggggcentres assess student performance using strategiesthat are valid and reliablenational standards of the qualifications are maintainedthe consistency and standards are verified by theLead Internal Verifierthe consistency of the qualifications nationally ismonitored using national comparisons.Before any awards are issued, standards verification mustconfirm that national standards are being applied consistentlyand certification is valid.Verification is undertaken using a range of methods, includingvisits and remote sampling. Sampling of students’ work isundertaken for all programmes.PROGRESSION/ARTICULATION:Provides recognition for learners’ abilities and evidence of theskills required for success in the workplace. Learners takingBTECs, GCSEs, Diplomas, NVQs, Apprenticeships and otherrecognised courses can fit WorkSkills into their timetable, addingfurther value and an additional work-based qualification to theirCV. WorkSkills can be embedded into the curriculum to accreditskills already being taught.Edexcel BTEC Professionalcourses levels 4-7 (QCF)QUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Levels 4-7BACKGROUND:The BTEC Professional course framework is flexible, supportingand enabling a range of different progression purposes. Theframework was designed to:gggggsupport lifelong learning and achievementprovide access to qualification pathwaysprovide the means of approving programmes that assessknowledge, understanding and skills developmentprovide flexibility in terms of target audience, modes ofdelivery and assessment regimesfacilitate career progression and updating.A number of BTEC Professional course qualifications have beendevised which are included within the QCF. For each qualification:gthere is a very specialist focusgthe structure normally comprises core and specialist unitsgsizes across levels 4-7are normally: Award up to 12 credits,Certificate up to 36 credits, and Diploma 37 + creditsglevel is indicated by 4,5,6,7gassessment is internal or external, or a combination,depending on individual structures.ASSESSMENT METHOD:<strong>Qualifications</strong> within the short course framework are assessed,externally verified and recognised through national certification.This is supported by a credit transcript, which records andexplains achievement at each of the levels of units undertaken.QUALITY ASSURANCE:External verification and National Standards quality assurance isundertaken as follows:gggGuidance and unit specificationTo promote consistency, the awarding body issues standardsfor programme/unit outcome, content, assessment andguidance on teaching and learning methods, programmedesign and assessment.ApprovalAny centre (college, university, school or company) wishing tooffer the qualification has to gain approval for thatqualification by demonstrating that specified resources andquality criteria are met, both for the centre and thequalification.Standards verificationThe awarding body appoints a standards verifier to everysector programme which it approves. These are experiencedpractitioners, normally with occupational competence, fromeducation and industry who are carefully selected andsuitably qualified. They have a responsibility for ensuringthat:ggggcentres assess student performance using strategiesthat are valid and reliablenational standards of the qualifications are maintainedthe consistency and standards are verified by theLead Internal Verifierthe consistency of the qualifications nationally ismonitored using national comparisons.Before any awards are issued, standards verification mustconfirm that national standards are being applied consistentlyand certification is valid.Verification is undertaken using a range of methods, includingvisits and remote sampling. Sampling of students’ work isundertaken for all programmes.<strong>UK</strong> QUALIFICATIONS 69
<strong>Qualifications</strong> currently offeredPROGRESSION/ARTICULATION:The qualifications have been developed to provide learners with apreparation for employment, to provide career developmentopportunities for those already in work and to enable progressionand continuation of study in the vocational area (to anyassociated level 4 or 5 vocationally-related qualification, includingdegrees, or to a level 3 or 4 vocationally-related qualification oroccupational competence qualification such as an NVQ).Edexcel BTEC level 4 HNCDiploma (QCF)QCF LEVEL:Level 4BACKGROUND:The QCF BTEC level 4 HNC Diploma replaces the NQF BTECHigher National Certificate. The move onto the QCF guaranteescontinued funding for these qualifications.DATE OF FIRST TEACHING:2010DATE OF FIRST AWARD:2011NUMBER OF UNITS/STRUCTURE:Each HNC is made up of a number of units, with some beingmandatory and others optional. Units can be different sizes andhave different numbers of credits. There is no standard numberof units or credits. Some of the optional units are available atlevel 5.ASSESSMENT METHOD:Aural examination, coursework, e-assessment, multiple choiceexamination, oral examination, portfolio of evidence, practicaldemonstration/assignment, practical examination, task-basedcontrolled assessment, written examination.GRADING SYSTEM:Each unit is graded Pass, Merit or Distinction using gradingdescriptors provided for the Higher Nationals. All QCF BTECHigher National qualifications are awarded an overall grade ofPass, Merit or Distinction.HEIs often specify the number of H2 units and/or the number ofMerit or Distinction unit grades (sometimes specifying these)when framing their offers for degree programmes etc.QUALITY ASSURANCE:Independent assessment via external examiners.PROGRESSION/ARTICULATION:Progression to the second or third year of a degree programme,depending on the suitability of the units taken. Progression toemployment in the relevant industry.Edexcel BTEC level 5 HNDDiploma (QCF)QCF LEVEL:Level 5BACKGROUND:The QCF BTEC level 5 HND Diploma replaces the NQF BTECHigher National Diploma. The move onto the QCF guaranteescontinued funding for these qualifications.DATE OF FIRST TEACHING:2010DATE OF FIRST AWARD:2011NUMBER OF UNITS/STRUCTURE:Each HND is made up of a number of units, with some beingmandatory and others optional. Units can be different sizes andhave different numbers of credits. There is no standard numberof units or credits.ASSESSMENT METHOD:Aural examination, coursework, e-assessment, multiple choiceexamination, oral examination, portfolio of evidence, practicaldemonstration/assignment, practical examination, task-basedcontrolled assessment, written examination.GRADING SYSTEM:Each unit is graded Pass, Merit or Distinction using gradingdescriptors provided for the Higher Nationals. All QCF BTECHigher National qualifications are awarded an overall grade ofPass, Merit or Distinction.HEIs often specify the number of H2 units and/or the number ofMerit or Distinction unit grades (sometimes specifying these)when framing their offers for degree programmes etc.QUALITY ASSURANCE:Independent assessment via external examiners.PROGRESSION/ARTICULATION:Progression to the second or third year of a degree programme,depending on the suitability of the units taken. Progression toemployment in the relevant industry.EDI (Education DevelopmentInternational)Education Development International (EDI) is one of the <strong>UK</strong>’spremier examining and awarding bodies. EDI’s extensive range oftests and qualifications are accredited by the <strong>UK</strong> regulatoryauthorities. EDI’s vision is to offer progressive assessments andqualifications throughout a learner’s academic life and on intotheir professional career.EDI was formed by the merger of Goal and LCCIEB (LondonChamber of Commerce and Industry Examinations Board)in December 2002. EDI also offers a range of LCCIInternational <strong>Qualifications</strong>, specialising in Finance, EnglishLanguage and Business Skills (see Appendix K for EnglishLanguage Proficiency tests).EDI level 3 Certificate in PersonalTrainingQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 3BACKGROUND:This qualification will allow learners to apply knowledge,understanding and skills to a level recognised by employers asproviding entry into the exercise and fitness industry as personaltrainers at level 3.This qualification has been designed for fitness instructorswishing to further their knowledge and skills to work as personaltrainers and for learners with some prior knowledge of fitnessinstructing who wish to work in the industry as personal trainers.DATE OF FIRST TEACHING:January 201270 <strong>UK</strong> QUALIFICATIONS
<strong>Qualifications</strong> currently offeredPREREQUISITES:Level 2 qualification in fitness instructing, or equivalentNUMBER OF UNITS/STRUCTURE:Learners must achieve 7 mandatory unitsASSESSMENT METHOD:Portfolio of evidence and multiple choice testGRADING SYSTEM:Pass/FailPROGRESSION/ARTICULATION:Learners may progress to the L3 Diploma in Personal TrainingNVQ, to additional units/qualifications at L3 eg exercise referrals,and to L4 units/qualifications eg cardiac rehabilitation.EDI level 3 Award in IT User SkillsQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 3BACKGROUND:This qualification is suitable for candidates who are using ITwithin their job. Units can be taken at a variety of levels whichgives flexibility to enable the qualification to match job roles. Thequalification will allow candidates to apply knowledge,understanding and skills to a level recognised by employers, thusproving competency in their job role.This qualification is suitable for candidates using IT systems in awide range of job roles.DATE OF FIRST TEACHING:2010PREREQUISITES:NoneNUMBER OF UNITS/STRUCTURE:There are no mandatory units. Learners will take desired optionalunits to meet the credit threshold.ASSESSMENT METHOD:Portfolio of evidenceGRADING SYSTEM:Pass/FailPROGRESSION/ARTICULATION:This qualification is appropriate for those who wish to gainunderpinning knowledge and understanding through off-the-joblearning.EDI level 3 Certificate in IT UserSkillsQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 3BACKGROUND:This qualification is suitable for candidates who are using ITwithin their job. Units can be taken at a variety of levels whichgives flexibility to enable the qualification to match job roles. Thequalification will allow candidates to apply knowledge,understanding and skills to a level recognised by employers, thusproving competency in their job role.This qualification is suitable for candidates using IT systems in awide range of job roles.DATE OF FIRST TEACHING:2010PREREQUISITES:NoneNUMBER OF UNITS/STRUCTURE:One mandatory unit of Improving Productivity Using IT, plusoptional units to meet the credit threshold.ASSESSMENT METHOD:Portfolio of evidenceGRADING SYSTEM:Pass/FailPROGRESSION/ARTICULATION:This qualification is appropriate for those who wish to gainunderpinning knowledge and understanding through off-the-joblearning.EDI level 3 Diploma in IT UserSkillsQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 3BACKGROUND:This qualification is suitable for candidates who are using ITwithin their job. Units can be taken at a variety of levels whichgives flexibility to enable the qualification to match job roles. Thequalification will allow candidates to apply knowledge,understanding and skills to a level recognised by employers, thusproving competency in their job role.This qualification is suitable for candidates using IT systems in awide range of job roles.DATE OF FIRST TEACHING:2009PREREQUISITES:NoneNUMBER OF UNITS/STRUCTURE:One mandatory unit of Improving Productivity Using IT, plusoptional units to meet the credit threshold.ASSESSMENT METHOD:Portfolio of evidenceGRADING SYSTEM:Pass/FailPROGRESSION/ARTICULATION:This qualification is appropriate for those who wish to gainunderpinning knowledge and understanding through off-the-joblearning.EDI level 3 Award in Food SafetySupervision for LogisticsQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 3BACKGROUND:This qualification covers those aspects of the supervision of foodhygiene and safety which enable learners to identify problemareas and to recommend solutions. The aim is to provide a broadknowledge of food safety and food hygiene. Learners whoachieve the qualification will have the appropriate knowledge andunderstanding to be able to take responsibility for food safetymonitoring procedures, to identify hazards to food safety, takeappropriate action in the light of these hazards and contribute toimprovements in food safety practice.<strong>UK</strong> QUALIFICATIONS 71
<strong>Qualifications</strong> currently offeredDATE OF FIRST TEACHING:2010PREREQUISITES:NoneNUMBER OF UNITS/STRUCTURE:Learners must achieve one mandatory unit of 3 creditsASSESSMENT METHOD:Multiple choice testsDATE OF RESULT PUBLICATION:Six weeks for paper-based tests; 24 hours for online tests.GRADING SYSTEM:Pass/FailPROGRESSION/ARTICULATION:Achievement of this qualification will contribute to learners'career progression in the logistics industry, for example byapplying for positions at supervisory level.EDI level 3 Certificate forWorking in the Health SectorQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 3BACKGROUND:The EDI Level 3 Certificate for Working in the Health Sector ismapped to the Knowledge and Skills Framework at level 2. It isrelevant to all individuals working or planning to work in thehealth sector.PREREQUISITES:There are no formal entry requirements; this qualification is opento all candidates who are preparing to work, or who already work,in a health sector environmentNUMBER OF UNITS/STRUCTURE:Learners complete six mandatory unitsASSESSMENT METHOD:The assessment for this qualification is through centre-devisedassessment material, which is internally marked and externallymoderated.EXAMINATION TIMING:Not applicableDATE OF RESULT PUBLICATION:Results are published approximately eight weeks after the end ofcourse dateGRADING SYSTEM:The EDI certificate is awarded to learners who pass all units.There are no further categories of pass; the certificate is notgraded.PROGRESSION/ARTICULATION:Achievement of the core requirements of the NHS Knowledge andSkills Framework is an essential part of induction into work in thehealth sector, therefore completion of this qualification allowsfurther progression to a wide range of furthertraining/qualifications and/or employment.EDI level 3 Award in HospitalitySupervision and LeadershipPrinciples (QCF)QUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 3BACKGROUND:This qualification is designed to prepare learners for employmentin supervision and leadership roles in the hospitality sector, asAdvanced Apprenticeship framework. It will provide learners withthe knowledge required for a supervision and leadership rolewithin the hospitality industry, covering the make up of thehospitality industry, communication in the hospitality industry,leading a team, the supervision of customer service, stock controland the effective use of resources, as well as providing theknowledge component for the Hospitality Supervision andLeadership apprenticeship.DATE OF FIRST TEACHING:2011PREREQUISITES:There are no formal entry requirements for this qualificationNUMBER OF UNITS/STRUCTURE:Learners must achieve three mandatory unitsASSESSMENT METHOD:Multiple choice testEXAMINATION TIMING:On demandGRADING SYSTEM:Pass/FailPROGRESSION/ARTICULATION:This qualification is appropriate for those who wish to gainunderpinning knowledge and understanding of supervision andleadership within the hospitality sector.EDI level 3 Certificate inHospitality and CateringPrinciples (Professional Cookery)(QCF)QUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 3BACKGROUND:This Level 3 Certificate in Hospitality and Catering Principles(Professional Cookery) contributes to the underpinning knowledgeand understanding requirements of the level 3 NVQ Diploma inProfessional Cookery. It provides the learner with a relevantfoundation of knowledge as preparation for a rewarding career inthe hospitality industry.The knowledge and understanding of the identified NationalOccupational Standards have been used to direct the assessmentof this qualification.DATE OF FIRST TEACHING:2009PREREQUISITES:There are no formal entry requirements for this qualificationNUMBER OF UNITS/STRUCTURE:Learners must achieve eight mandatory units72 <strong>UK</strong> QUALIFICATIONS
<strong>Qualifications</strong> currently offeredASSESSMENT METHOD:Multiple choice testEXAMINATION TIMING:On demandGRADING SYSTEM:Pass/FailPROGRESSION/ARTICULATION:This qualification is appropriate for those who wish to gainunderpinning knowledge and understanding of professionalcookery skills and techniques.EDI level 3 Award in PracticalSupervision of Food Safety inCateringQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 3BACKGROUND:The purpose of this qualification is to provide candidates with theknowledge and skills in the practical supervision of both staff andfood safety operations in food handling environments, specificallythose in hospitality and catering establishments. Candidates willdevelop skills and knowledge which will enable them to meettheir supervisory responsibilities and enable their businesses tomeet statutory requirements for supervising food handlers.DATE OF FIRST TEACHING:2009PREREQUISITES:There are no formal entry requirements for this qualificationNUMBER OF UNITS/STRUCTURE:Learners must achieve one mandatory unitASSESSMENT METHOD:AssignmentsGRADING SYSTEM:Pass/FailPROGRESSION/ARTICULATION:Candidates may use achievement of this qualification towardsother qualifications at level 3 within the sector and may progressonto related food safety qualifications and/or related hospitalityand catering qualifications.EDI level 3 Award in Nutrition forHealthier Food and Special DietsQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 3BACKGROUND:This qualification aims to provide learners with knowledge of theprinciples of nutrition, healthier foods and special diets. Learnerswill develop their knowledge of the principles of balanced diets,nutritional information and their understanding of special dietaryneeds.DATE OF FIRST TEACHING:2010PREREQUISITES:There are no formal entry requirements for this qualificationNUMBER OF UNITS/STRUCTURE:Learners must achieve one mandatory unitASSESSMENT METHOD:Multiple choice testEXAMINATION TIMING:On demandGRADING SYSTEM:Pass/FailPROGRESSION/ARTICULATION:Learners can progress onto other sector-related qualifications,for example the Level 3 Award in Practical Supervision of FoodSafety in Catering or the Level 3 Certificate in Hospitality andCatering Principles (Professional Cookery). Completion of thisqualification also enhances the employment prospects of thoseemployed in the catering and caring professions or those seekingto gain employment in these areas.EDI level 3 Award in Principles ofSupervising Customer ServicePerformance in the Hospitality,Leisure, Travel and TourismSectorQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 3BACKGROUND:This qualification will provide in-depth knowledge of how tomanage customer service performance in the sector. The unit willbe appropriate for supervisory and management staff to enablethem to support their staff in providing excellent customer servicein the workplace.DATE OF FIRST TEACHING:2009PREREQUISITES:There are no formal entry requirements for this qualificationNUMBER OF UNITS/STRUCTURE:Learners must achieve one mandatory unitASSESSMENT METHOD:Multiple choice testEXAMINATION TIMING:On demandGRADING SYSTEM:Pass/FailPROGRESSION/ARTICULATION:Learners can progress onto other sector-related qualifications, forexample the Level 3 Award in Practical Supervision of FoodSafety in Catering or the Level 3 Certificate in Hospitality andCatering Principles (Professional Cookery). Completion of thisqualification also enhances the employment prospects of thoseemployed in the catering and caring professions or those seekingto gain employment in these areas.EDI level 3 Certificate inCustomer ServiceQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 3BACKGROUND:This qualification is intended to give learners a broaderunderstanding of the principles and background to providing<strong>UK</strong> QUALIFICATIONS 73
<strong>Qualifications</strong> currently offeredcustomer service and how they can be applied to typicalsituations. It is suitable for:gggggthose wishing to gain knowledge and understanding of theconcept of customer service at a more advanced leveluse as a development tool, building on previously gainedknowledge and experience in providing customer serviceprogression towards an NVQ, such as the EDI level 3 NVQDiploma in Customer Servicethose wishing to gain the knowledge and understandingnecessary for taking some degree of responsibility forsupervising or leading staff at lower levelslearners wishing to gain an Advanced Apprenticeship inCustomer Service.This qualification is relevant to all occupational areas.DATE OF FIRST TEACHING:2010PREREQUISITES:There are no formal entry requirements for this qualification.NUMBER OF UNITS/STRUCTURE:Two units:Unit 1 – Principles of Customer Service DeliveryUnit 2 – Developing and Improving the Customer Service ProcessASSESSMENT METHOD:Unit 1 will be assessed through a multiple choice text. Unit 2 isassessed through internally assessed workbook.EXAMINATION TIMING:Paper-based on demand or online.DATE OF RESULT PUBLICATION:Four weeks for paper-based tests.Online: 24 hours.GRADING SYSTEM:Pass/FailPROGRESSION/ARTICULATION:To progress a career or improve the understanding to supportthat career; progress towards the NVQ level 3 Diploma inCustomer Service; enter customer service roles that carry asignificant degree of responsibility; gain an AdvancedApprenticeship.EDI level 4 Certificate inDelivering Learning using aVirtual Learning Environment(VLE)QUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 4BACKGROUND:This qualification is designed for teachers, tutors, trainers andlearning support staff for any curriculum area, who want to beable to use a VLE or other online learning platform to provideonline learning resources and assessment for their learners.DATE OF FIRST TEACHING:2010PREREQUISITES:Learners need to be teachers, trainee teachers, or trainers, or ina learning support position. They need to have initial skills in wordprocessing, data handling, using presentation software, e-mailand the internet.NUMBER OF UNITS/STRUCTURE:Learners complete three mandatory units.ASSESSMENT METHOD:Assessment is through internal assessment of the assignment foreach mandatory unit. Internal assessment is internally moderatedand then externally moderated by EDI.EXAMINATION TIMING:Not applicableDATE OF RESULT PUBLICATION:Results are published approximately eight weeks after the end ofcourse dateGRADING SYSTEM:The overall result is either Pass or Referred.PROGRESSION/ARTICULATION:More advanced use of a VLE in teaching and learning.EDI level 4 Certificate in TeachingAdvanced ICTQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 4BACKGROUND:The EDI level 4 Certificate in Teaching Advanced ICT is suitablefor teachers who want to teach ICT in a school, college or trainingorganisation at a post-introductory level. The Certificate is alsoappropriate for those who have completed, or are in the processof completing, an initial teacher training qualification, and whowish to teach level 2 ICT.DATE OF FIRST TEACHING:2010PREREQUISITES:Learners need to hold the EDI Certificate in Education Practice:ICT Skills or have an equivalent qualification and experience toprovide a reasonable basis for entry to an advanced course. Theyshould also hold a teaching qualification or have carried out 40hours of ICT teaching during the past year.NUMBER OF UNITS/STRUCTURE:Learners complete two mandatory units.ASSESSMENT METHOD:The 12 credit Developing ICT Teaching Materials and Techniquesunit is assessed by nine assignments. Internal assessment isinternally moderated and then externally moderated by EDI. Thesix credit Teaching ICT Skills unit is assessed through a teachingproject and teaching practice.EXAMINATION TIMING:Controlled assessments are carried out on a date determined bythe centre and in advance of a final date specified by EDI.DATE OF RESULT PUBLICATION:Results are published approximately eight weeks after the end ofcourse date.GRADING SYSTEM:The overall result is either Pass or Referred.PROGRESSION/ARTICULATION:To higher level generic or ICT teaching qualifications74 <strong>UK</strong> QUALIFICATIONS
<strong>Qualifications</strong> currently offeredEDI level 4 Certificate in TeachingICT SkillsQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 4BACKGROUND:This qualification is designed for those who want to gain an ICTteaching certificate or need certification for their ability to teachICT.PREREQUISITES:Learners need to have 5 GCSEs or their equivalent, plus a level 3qualification in ICT, or a level 2 qualification in ICT and ICT skillsand experience.NUMBER OF UNITS/STRUCTURE:Learners complete the two mandatory units plus two hours ofteaching practice.ASSESSMENT METHOD:The 9 credit Planning and Preparing to Teach ICT unit is assessedby three assignments which are found within the specification.The 6 credit Teaching ICT Skills unit is assessed through ateaching project and teaching practice, details of which are foundwithin the specification.EXAMINATION TIMING:Case study assessments are carried out on a date determined bythe centre and in advance of a final date specified by EDI.DATE OF RESULT PUBLICATION:Results are published approximately eight weeks after the end ofcourse date.GRADING SYSTEM:The overall result is either Pass or Referred.PROGRESSION/ARTICULATION:To higher level generic or ICT teaching qualifications.EDI level 4 Certificate inEducation Principles andPracticeQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 4BACKGROUND:This qualification is designed for those who want to gain anintroductory teaching certificate or need confirmation of theirability to teach.DATE OF FIRST TEACHING:2010PREREQUISITES:Learners need to have five GCSEs or their equivalent, plus alevel 3 qualification, or a level 2 qualification and skills andexperience in their specialist area.NUMBER OF UNITS/STRUCTURE:Learners complete the two mandatory units, plus four hours ofteaching practice.ASSESSMENT METHOD:Assessment is through an examination and observation, andassessment of three hours of the teaching practice.EXAMINATION TIMING:Examinations are available on demand.DATE OF RESULT PUBLICATION:Results are published approximately eight weeks after theexamination date.GRADING SYSTEM:The overall result is either Pass or Referred.PROGRESSION/ARTICULATION:To higher level teaching qualifications.EDI level 3 Award in Preparing toTeach in the Lifelong LearningSectorQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 3BACKGROUND:This qualification is designed for those who are new to teaching,training or tutoring in the lifelong learning sector, who want to bea teacher or trainer in the lifelong learning sector or who want toupdate their underpinning knowledge and teaching or trainingskills.DATE OF FIRST TEACHING:2012PREREQUISITES:Learners need to have the skills and abilities to achieve an initialteaching qualification at level 3.NUMBER OF UNITS/STRUCTURE:Learners complete one mandatory unit and at least two otheroptional units.ASSESSMENT METHOD:Assessment is through internal assessment of the assessmentpro forma.Internal assessment is internally moderated and then externallymoderated by EDI.EXAMINATION TIMING:Not applicableDATE OF RESULT PUBLICATION:Results are published approximately eight weeks after the end ofcourse date.GRADING SYSTEM:The overall result is either Pass or Referred.PROGRESSION/ARTICULATION:To the level 3 or level 4 Certificate in Teaching in the LifelongLearning Sector for the associate teacher role or the level 5Diploma in Teaching in the Lifelong Learning Sector for those inthe full teaching role.EDI level 4 Award in Preparing toTeach in the Lifelong LearningSectorQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 4BACKGROUND:This qualification is designed for those who are new to teaching,training or tutoring in the lifelong learning sector, want to be ateacher or trainer in the lifelong learning sector or want to updatetheir underpinning knowledge and teaching or training skills.<strong>UK</strong> QUALIFICATIONS 75
<strong>Qualifications</strong> currently offeredDATE OF FIRST TEACHING:2012PREREQUISITES:Learners need to have the skills and abilities to achieve an initialteaching qualification at level 4.NUMBER OF UNITS/STRUCTURE:Learners complete one mandatory unit and at least two additionalunits making a total of 12 credits.ASSESSMENT METHOD:Assessment is through internal assessment of the assessmentpro forma.Internal assessment is internally moderated and then externallymoderated by EDI.EXAMINATION TIMING:Not applicableDATE OF RESULT PUBLICATION:Results are published approximately eight weeks after the end ofcourse date.GRADING SYSTEM:The overall result is either Pass or Referred.PROGRESSION/ARTICULATION:To the level 3 or level 4 Certificate in Teaching in the LifelongLearning Sector for the associate teacher role or the level 5Diploma in Teaching in the Lifelong Learning Sector for those inthe full teaching role.EDI level 3 Certificate in Teachingin the Lifelong Learning SectorQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 3BACKGROUND:This qualification is designed for those who are new to teaching,training or tutoring in the lifelong learning sector, want to be ateacher or trainer in the lifelong learning sector or want to updatetheir underpinning knowledge and teaching or training skills.DATE OF FIRST TEACHING:2012PREREQUISITES:Learners need to have the skills and abilities to complete ateaching qualification for the associate teacher role at level 3.NUMBER OF UNITS/STRUCTURE:Learners complete two mandatory units and option units to thevalue of thirty credits.ASSESSMENT METHOD:Assessment is through internal assessment of teaching practice,an evidence of practice file and reflective journal.Internal assessment is internally moderated and then externallymoderated by EDI.EXAMINATION TIMING:Not applicableDATE OF RESULT PUBLICATION:Results are published approximately eight weeks after the end ofcourse date.GRADING SYSTEM:The overall result is either Pass or Referred.PROGRESSION/ARTICULATION:To the level 5 Diploma in Teaching in the Lifelong Learning Sectorfor those in the full teaching role.EDI level 4 Certificate in Teachingin the Lifelong Learning SectorQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 4BACKGROUND:This qualification is designed for those who are new to teaching,training or tutoring in the lifelong learning sector, want to be ateacher or trainer in the lifelong learning sector or want to updatetheir underpinning knowledge and teaching or training skills.PREREQUISITES:Learners need to have the skills and abilities to complete ateaching qualification for the associate teacher role at level 4.NUMBER OF UNITS/STRUCTURE:Learners complete two mandatory units and option units to thevalue of thirty credits.ASSESSMENT METHOD:Assessment is through internal assessment of teaching practice,an evidence of practice file and reflective journal.Internal assessment is internally moderated and then externallymoderated by EDI.EXAMINATION TIMING:Not applicable.DATE OF RESULT PUBLICATION:Results are published approximately eight weeks after the end ofcourse date.GRADING SYSTEM:The overall result is either Pass or Referred.PROGRESSION/ARTICULATION:To the level 5 Diploma in Teaching in the Lifelong Learning Sectorfor those in the full teaching role.EDI level 3 Certificate inManagement PrinciplesQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 3BACKGROUND:The EDI level 3 Certificate in Management Principles aims toallow learners to:gggDevelop the essential, generic background knowledge andunderstanding for a range of middle management rolesDevelop the background knowledge and understanding of thepersonal and interpersonal skills required for an effectivemiddle managerSupport the learner in acquiring the knowledge andunderstanding for the level 3 NVQ Certificate/Diploma inManagementDATE OF FIRST TEACHING:2010PREREQUISITES:There are no formal entry requirements for this qualification.However, learners should have achieved a level of knowledge andunderstanding equivalent to a level 2 qualification in TeamLeading, through either previous learning or experience.76 <strong>UK</strong> QUALIFICATIONS
<strong>Qualifications</strong> currently offeredNUMBER OF UNITS/STRUCTURE:Three units assessed through multiple-choice papers.Unit 1 - Managing Self DevelopmentUnit 2 - Responsibilities as a ManagerUnit 3 - Objective Setting and Communicating to Support TeamsASSESSMENT METHOD:100% external assessments.EXAMINATION TIMING:On demand and onlineDATE OF RESULT PUBLICATION:Four weeks for paper-based tests; 24 hours for online.GRADING SYSTEM:Pass/Fail for each unitPROGRESSION/ARTICULATION:The level 3 Certificate in Management Principles has beendesigned to enable as many progression opportunities aspossible. Suggested progression routes include, but are notlimited to:gOccupational qualifications such as the EDI level 3 NVQCertificate/Diploma and level 5 NVQ Diploma inManagement.EDI level 3 Certificate/ Diploma inPrinciples of Bus and CoachEngineering and Maintenance(Mechanical / Electrical / Body)QUALIFICATION AND CREDIT FRAMEWORK LEVEL:Level 3BACKGROUNDThese qualifications are technical certificates covering theknowledge and competence required to carry out routine andcomplex maintenance and repair of passenger-carrying vehicles.Learners will gain a thorough understanding of the technicalprinciples underpinning the way engine and electrical systemsoperate as well as the construction of vehicle chassis andmechanical components.DATE OF FIRST TEACHING:2011PREREQUISITES:None, but learners may benefit from having completed the level 2qualifications beforehand.NUMBER OF UNITS/STRUCTURE:Learners must complete common mandatory units as well aschoose optional units relating the specialist areas in which theywant to study. Separate qualifications are available formechanical, electrical and body work.ASSESSMENT METHOD:This qualification is assessed through centre-devised questionpapers and practical assignments.EXAMINATION TIMING:Set by the delivery centre.DATE OF RESULT PUBLICATION:n/aGRADING SYSTEM:Pass/FailPROGRESSION/ARTICULATION:This qualification is recognised as a technical certificate in theAdvanced Apprenticeship framework. It is also appropriate forthose wishing to gain underpinning knowledge and understandingand can be used as a stepping stone for foundation degrees.EDI level 4 Diploma in EducationPractice: ICT AdvancedQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 4BACKGROUND:This qualification is designed for those who want to gain acertificate for teaching Advanced/level 3 ICT or need certificationfor their ability to teach level 3 ICT.DATE OF FIRST TEACHING:2006PREREQUISITES:Learners need to hold the EDI Certificate in Education Practice:ICT Skills or have an equivalent qualification and experience toprovide a reasonable basis for entry to an advanced course. Theyshould also hold a teaching qualification or have carried out 40hours of ICT training during the past year.NUMBER OF UNITS/STRUCTURE:Learners complete the six mandatory units, plus the AppliedPrinciples of Education if they do not hold the Education Practice:ICT Skills qualification.ASSESSMENT METHOD:Assessment for Units 1–3 is as for the Certificate in EducationPractice: ICT Advanced. (Learners who already hold thiscertificate are exempted from the assessments for these units.)Assessment for Units 4, 5 and 6 is through internal assessmentof two ICT teaching resources and documentation for and deliveryof an advanced ICT course. Learners would also complete theApplied Principles of ICT Education teaching project, if applicable.Internal assessment is internally moderated and then externallymoderated by EDI.Additionally, for Unit 4, learners devise teaching resources forDatabase and Spreadsheet in controlled conditions and these areexternally assessed by EDI.EXAMINATION TIMING:Controlled assessments are carried out on a date determined bythe centre and in advance of a final date specified by EDI.DATE OF RESULT PUBLICATION:Results are published approximately eight weeks after the end ofcourse date.GRADING SYSTEM:The overall result is either Pass, Referred or Incomplete.PROGRESSION/ARTICULATION:To higher level generic teaching qualifications or a degreeprogramme.EDI (LCCI IQ) level 3 Certificate inAccountingNATIONAL QUALIFICATIONS FRAMEWORK LEVEL:Level 3BACKGROUND:This qualification is suitable for learners who are working orpreparing to work in an advanced area of accountancy. It aims<strong>UK</strong> QUALIFICATIONS 77
<strong>Qualifications</strong> currently offeredto enable learners to develop the necessary knowledge and skills toprepare and interpret accounts for sole traders, partnerships,non-trading organisations, limited companies and groups of companies.It also introduces learners to the principles and practice of decisionmaking.DATE OF FIRST TEACHING:2008PREREQUISITES:Learners must have the knowledge and skills equivalent to theLCCI IQ level 1 Certificate in Bookkeeping and level 2 Certificatein Bookkeeping and Accounts qualifications.Additionally, learners should have a standard of English equivalentto the LCCI IQ level 2 English for Business qualification.NUMBER OF UNITS/STRUCTURE:Single unit.ASSESSMENT METHOD:100% external assessment. A three-hour examination consistingof four questions to be completed from a choice of five.EXAMINATION TIMING:Three times a year and on demand.DATE OF RESULT PUBLICATION:Series: nine weeks from end of exam period. On demand: six weeksfrom the receipt of scripts.GRADING SYSTEM:Pass 50%, Merit 60%, Distinction 75%.From 2008 this qualification carries UCAS Tariff points as follows.GradeUCAS Tariff pointsDistinction 120Credit 90Pass 70PROGRESSION/ARTICULATION:Successful learners can progress to the LCCI IQ level 4 FinancialAccounting qualification, or may go on to qualify for a range ofLCCI Group or specialist Diplomas. In addition, learners mayprogress to ACCA and CAT qualifications where they will gainexemption from specified modules.EDI (LCCI IQ) level 3 Certificate inAccounting (IAS)NATIONAL QUALIFICATIONS FRAMEWORK LEVEL:Level 3BACKGROUND:This qualification is suitable for learners who are working orpreparing to work in an advanced area of accountancy. It aims toallow learners to develop the ability to prepare accounting statementsand data in accordance with basic accounting conventions andcurrent international accounting practice, with reference to disclosureof accounting policies, inventory, accounting for depreciation, cashflow statements and group accounts. It also aims to develop learners’ability to apply the principles of decision making.DATE OF FIRST TEACHING:2008PREREQUISITES:Learners must have the knowledge and skills equivalent to theLCCI IQ level 1 Certificate in Bookkeeping and level 2 Certificatein Bookkeeping and Accounts qualifications.Additionally, learners should have a standard of English equivalentto the LCCI IQ level 2 English for Business qualification.NUMBER OF UNITS/STRUCTURE:Single unit.ASSESSMENT METHOD:100% external assessment. A three-hour examination consistingof four questions to be completed from a choice of fiveEXAMINATION TIMING:Three times a year and on demandDATE OF RESULT PUBLICATION:Series: nine weeks from end of exam period. On demand: six weeksfrom the receipt of scripts.GRADING SYSTEM:Pass 50%, Merit 60%, Distinction 75%.From 2008 this qualification carries UCAS Tariff points as follows.GradeUCAS Tariff pointsDistinction 120Credit 90Pass 70PROGRESSION/ARTICULATION:Successful learners can progress to the LCCI IQ level 4 FinancialAccounting (IAS) qualification or may go on to qualify for a rangeof LCCI Group or specialised Diplomas. In addition, learners mayprogress to ACCA and CAT qualifications where they will gainexemptions from specified modules.EDI level 3 Certificate inTransition to Playwork (from EarlyYears)QUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 3BACKGROUND:This qualification is targeted towards early years workers whohave completed an early years CCLD level 3 qualification andwant to move into working in playwork.DATE OF FIRST TEACHING:November 2011PREREQUISITES:Learners must have successfully completed a level 3 NVQ inChildren’s Care, Learning and Development.NUMBER OF UNITS/STRUCTURE:Learners must achieve two mandatory units to achieve theaward.ASSESSMENT METHOD:Portfolio of evidence.GRADING SYSTEM:Pass/FailPROGRESSION/ARTICULATION:The qualification will allow learners to progress onto the EDI level3 Diploma in Playwork (NVQ) and other level 4 / level 5 Playworkqualifications.EDI level 3 Certificate inPrinciples of the Creative andCultural SectorQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 378 <strong>UK</strong> QUALIFICATIONS
<strong>Qualifications</strong> currently offeredBACKGROUND:This qualification aims to provide learners with the underpinningknowledge required to work in the Creative and Cultural Sector.DATE OF FIRST TEACHING:June 2011PREREQUISITES:NoneNUMBER OF UNITS/STRUCTURE:To achieve the EDI level 3 Certificate in Principles of the Creativeand Cultural Sector, learners must achieve a minimum of 15credits. Learners must achieve two mandatory units plus unitsfrom their chosen pathway.ASSESSMENT METHOD:Portfolio of evidence and multiple choice tests.GRADING SYSTEM:Pass/FailPROGRESSION/ARTICULATION:Learners may progress onto a related higher level vocationalqualification or use achievement of the qualification to gainemployment in the sector.EDI level 3 Certificate inPreparing to Work in Adult SocialCareQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 3BACKGROUND:The EDI level 3 Certificate in Preparing to Work in Adult SocialCare is aimed at learners interested in, or new to, working inadult social care in England. It aims to develop knowledge aroundthe following areas relating to working in adult social care:gggggggggcommunicationequality, diversity and inclusionpersonal developmentrole of the social care workerhandling informationhealth and safetysafeguardingduty of careperson centred approaches.It does not confirm competence but relates to the knowledgeelements covered in the mandatory units of the Health and SocialCare Diploma at level 3. Learners progressing to the Health andSocial Care Diploma at level 3 will therefore be able to have theirachievement of the knowledge recognised in these units throughRecognition of Prior Learning.DATE OF FIRST TEACHING:27 January 2011PREREQUISITES:NoneNUMBER OF UNITS/STRUCTURE:To achieve the full EDI level 3 Certificate in Preparing to Work inAdult Social Care qualification learners must achieve a minimumof 21 credits. To achieve this, learners must achieve all ninemandatory units.ASSESSMENT METHOD:Portfolio of evidence and/or multiple choice tests.GRADING SYSTEM:Pass/FailPROGRESSION/ARTICULATION:The qualification will allow learners to progress onto the EDI level3 Diploma in Health and Social Care.EDI level 3 Award in Awarenessof DementiaQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 3BACKGROUND:The qualification is aimed at those who are already working incare roles with individuals with dementia and provides anopportunity to have their knowledge and skills recognised throughthe achievement of a nationally accredited qualification. Itassesses learners’ competence, ie their ability to competentlyperform a range of tasks in areas of practice such as personcentredworking, communication and interaction, equality anddiversity, individuals’ rights and choices.DATE OF FIRST TEACHING:1 September 2010PREREQUISITES:NoneNUMBER OF UNITS/STRUCTURE:To achieve the full level 3 Certificate in Dementia Care, learnersmust achieve a minimum of 21 credits. The learner must achieveall 15 credits from the mandatory units and a further six creditsmust be achieved from the optional units.ASSESSMENT METHOD:Portfolio of evidence and/or multiple choice tests.GRADING SYSTEM:Pass/FailPROGRESSION/ARTICULATION:The qualification will allow learners to progress onto the EDI level3 Diploma in Health and Social Care or EDI level 3 Certificate inDementia Care.EDI level 3 Award in Awarenessof End of Life CareQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 3BACKGROUND:This qualification provides an opportunity to developunderstanding of different perspectives of death and dying, aimsand principles of end of life care, communication factors in end oflife care, and how to access a range of support services in end oflife care.It is aimed at all learners in health and social care with aninterest in end of life care and the impact on individuals.DATE OF FIRST TEACHING:25 April 2012PREREQUISITES:NoneNUMBER OF UNITS/STRUCTURE:To achieve the full level 3 Award in Awareness of End of Life Care, learners must achieve a minimum of 21 credits. The learnermust achieve all 15 credits from the mandatory units and afurther six credits must be achieved from the optional units.<strong>UK</strong> QUALIFICATIONS 79
<strong>Qualifications</strong> currently offeredASSESSMENT METHOD:Portfolio of evidenceGRADING SYSTEM:Pass/FailPROGRESSION/ARTICULATION:The qualification offers the opportunity to develop knowledgearound supporting individuals in end of life care and could addfurther knowledge to the contextualised learning gained throughthe Health and Social Care Diploma.There is opportunity to progress to level 3 Certificate in Workingin End of Life Care, level 5 Certificate in Leading and ManagingServices to Support End of Life and Significant Life Events and/orthe level 3 Diploma in Health and Social Care.EDI level 3 Certificate in ContactCentre OperationsQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 3BACKGROUND:This level 3 Certificate in Contact Centre Operations is a flexiblequalification aimed at individuals working within contact centreenvironments.It has been designed to cater for a diverse range of job roles andto reflect the depth of knowledge to work within the sectorincluding: problem solving; improving customer satisfaction; teamleading; improving customer loyalty; gathering and analysingcustomer feedback; navigating software; processing complaints;maintaining reliable customer service and communicationtechnology.DATE OF FIRST TEACHING:2011PREREQUISITES:There are no formal entry requirements for this qualification.NUMBER OF UNITS/STRUCTURE:The minimum credit value for the level 3 Certificate in ContactCentre Operations is 16, of which at least 10 credits must be atlevel 3. To do this the learner must achieve:gthree mandatory units from Group A (nine credits)ga minimum of seven credits from Group B.ASSESSMENT METHOD:Internally assessed and internally verified unit workbooks,externally moderated by EDI.GRADING SYSTEM:Pass/FailPROGRESSION/ARTICULATION:Learners who achieve the EDI level 3 Certificate in Contact CentreOperations can progress to higher level vocational qualificationsincluding the level 4 NVQ Diploma in Contact Centre Operations(part of the Higher Apprenticeship framework) and/or highermanagement and leadership qualifications. In addition, learnersmay use achievement of the qualification to gain or advanceemployment in the sector.EDI level 5 Diploma inManagement and LeadershipQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 5BACKGROUND:The suite of EDI level 5 qualifications in Management andLeadership are designed to contribute to the knowledge,understanding and performance requirements of managementand leadership roles. Their purpose is to provide in-depthknowledge and understanding around key management andleadership principles and processes, all of which underpineffective performance.Each qualification is suitable for those who operate autonomouslywithin a management and leadership role, and/or for those whowish to extend their knowledge and understanding to supportcareer progression.Learners may choose to extend their learning through acomplementary competency- based qualification such as the EDIlevel 5 NVQ Diploma in Management.DATE OF FIRST TEACHING:2012PREREQUISITES:Whilst there are no formal entry requirements, the suite of EDIlevel 5 qualifications in Management and Leadership are linked tothe learner’s understanding around the principles of managementand leadership that underpin a range of tasks connected to theirwork. To successfully achieve these qualifications, learners areexpected to be working at an appropriate level, and have theautonomy to apply their learning towards management andleadership responsibilities.NUMBER OF UNITS/STRUCTURE:To achieve the EDI level 5 Diploma in Management andLeadership, learners must achieve a minimum of 40 credits. Thelearner must achieve 10 credits from the mandatory unit and aminimum of 30 credits from the optional units.ASSESSMENT METHOD:Internally assessed and internally verified assignments, externallyverified by EDI.GRADING SYSTEM:Pass/FailPROGRESSION/ARTICULATION:This qualification aims to improve management and leadershipskills, sharpen awareness of best practice, enhance overallmanagement performance and progress careers. It offersprogression to the EDI level 5 and level 7 NVQ Diploma inManagement.EDI level 3 Diploma in IT UserSkills (ITQ Apprentice)QUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 3BACKGROUND:The level 3 Diploma in IT User Skills (ITQ Apprentice) has beendesigned to meet the skills and knowledge requirements of theAdvanced Apprenticeship for IT Users.This qualification is suitable for learners who are using IT withintheir job. Units can be taken at a variety of levels, which givesflexibility to enable the qualification to match job roles. Thequalification will allow learners to apply knowledge,understanding and skills to a level recognised by employers, thusproving competence in their job role.DATE OF FIRST TEACHING:201180 <strong>UK</strong> QUALIFICATIONS
<strong>Qualifications</strong> currently offeredPREREQUISITES:There are no formal entry requirements for this qualification.NUMBER OF UNITS/STRUCTURE:To achieve the level 3 Diploma in IT User Skills (ITQ Apprentice),the learner will need to complete units to gain a minimum of 39credits.The credit total will be made up of three mandatory units (17credits) from mandatory group A:gggImproving Productivity Using ITUnderstanding the Potential of ITDeveloping Personal and Team Effectiveness Using IT.And an additional minimum of 22 credits will also be achievedfrom optional Group B and must include at least five credits atlevel 3 or above. Only one unit from each optional unit group (egAudio Software level 1, 2 or 3) can contribute to the credit total.ASSESSMENT METHOD:Portfolio of evidenceGRADING SYSTEM:Pass/FailPROGRESSION/ARTICULATION:This qualification is appropriate for those who wish to gainunderpinning knowledge and understanding of the principles of ITtechnology that underpins performance.EDI level 3 Certificate in ICTSystems and PrinciplesQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 3BACKGROUND:The aim of the EDI level 3 Certificate in ICT Systems andPrinciples is to meet the underpinning knowledge andunderstanding requirements in IT network, telecommunicationsand systems and data security. They have been designed forindividuals who already possess knowledge and understanding ofICT systems and principles, and are suitable for those who areworking or aspiring to work within the IT professional sector.DATE OF FIRST TEACHING:2011PREREQUISITES:There are no formal entry requirements for this qualification.NUMBER OF UNITS/STRUCTURE:To achieve the EDI level 3 Certificate in ICT Systems andPrinciples, learners must achieve a minimum of 25 credits. Aminimum of 19 credits must at level 3.ASSESSMENT METHOD:Multiple choice testsGRADING SYSTEM:Pass/FailPROGRESSION/ARTICULATION:Learners who achieve the EDI level 3 Certificate in ICT Systemsand Principles can progress to higher level vocationalqualifications, including the level 4 Diploma in ICT ProfessionalCompetence (PROCOM), part of the Higher Apprenticeshipframework. In addition, learners may use achievement of thequalification to gain or advance employment in the sector.EDI level 3 Certificate in RetailKnowledgeQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 3BACKGROUND:The EDI level 3 Certificate in Retail Knowledge is a knowledgebasedqualification designed to provide learners with an in-depthunderstanding of the principles of retail, delivered through arange of core and specialist options. It is aimed at learners whoare working or aspiring to work in senior roles; supervisory, teamleader and/or department lead within the retail sector and wish todevelop their knowledge and understanding further.Learners may choose to extend their learning through acomplementary competency- based qualification such as thelevel 3 Certificate and/or Diploma in Retail Skills (VisualMerchandising, Sales Professional and Management).DATE OF FIRST TEACHING:2009PREREQUISITES:There are no formal entry requirements for this qualification.NUMBER OF UNITS/STRUCTURE:To achieve the level 3 Certificate in Retail Knowledge learnersmust achieve a minimum of 16 credits.ASSESSMENT METHOD:Multiple choice testsGRADING SYSTEM:Pass/FailPROGRESSION/ARTICULATION:Learners who achieve the EDI level 3 Certificate in RetailKnowledge can progress to higher level knowledge-basedqualifications, for example the level 5 Certificate/Diploma inManagement and Leadership.EDI level 3 Certificate inPrinciples of SalesQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 3BACKGROUND:This is a knowledge-based qualification designed to providelearners with an in-depth understanding of the principles of sales,including the regulatory requirements and issues, salestechniques and processes, marketing principles, competitoranalysis, principles of online commerce and organisationaltargets.DATE OF FIRST TEACHING:2009PREREQUISITES:There are no formal entry requirements for this qualification.NUMBER OF UNITS/STRUCTURE:16 credits are required – four mandatory units and at least twofurther optional units from a choice of specialist areas.ASSESSMENT METHOD:Knowledge- based workbooksGRADING SYSTEM:Pass/Fail<strong>UK</strong> QUALIFICATIONS 81
<strong>Qualifications</strong> currently offeredPROGRESSION/ARTICULATION:This qualification is recognised as a technical certificate in theAdvanced Apprenticeship framework. It is also appropriate forthose wishing to gain underpinning knowledge and understandingand can be used as a stepping stone for foundation degrees.EDI (LCCI) level 3 Certificate inBusiness Principles and PracticeNATIONAL QUALIFICATIONS FRAMEWORK LEVEL:Level 3BACKGROUND:The level 3 Certificate in Business Principles and Practice developscandidates’ understanding of the advanced principles and practicesof business relating to the business environment and how businessesare organised and managed operationally and financially. It also looksat how business performance can be measured and improved andintroduces concepts of business strategy and planning. Thequalification is suitable for people who want to develop theirunderstanding of modern business management practices in order toimprove their business career opportunities and/or academicprogression. It is particularly suitable for people who currently holdmiddle management positions within any of the functional businessareas or those aspiring to such positions.DATE OF FIRST TEACHING:2012PREREQUISITES:Learners should have a standard of English which enables themto make themselves understood in a business context and whichis equivalent to LCCI level 2 Certificate English for Business.NUMBER OF UNITS/STRUCTURE:Single unit – learners need to achieve the single unit.ASSESSMENT METHOD:100% external assessment - an examination lasting 2.5 hourscontaining five compulsory questions.EXAMINATION TIMING:Three times a year and on demand.DATE OF RESULT PUBLICATION:Series: nine weeks from end of exam period. On demand: sixweeks from the receipt of scripts.GRADING SYSTEM:Pass 50%, Merit 60%, Distinction 75%.PROGRESSION/ARTICULATION:Successful learners may go on to achieve a range of LCCIDiplomas or to relevant foundation degree courses.EDI (LCCI) level 3 Award inProfessional Ethics and FinanceQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 3BACKGROUND:The level 3 Award in Professional Ethics and Finance introducescandidates to the importance of the ethical duties of anaccounting professional. It develops their knowledge andunderstanding of the framework and principles of ethicalbehaviour in accounting and how these are applied in the workenvironment. The qualification is suitable for people pursuing acareer in accounting or those who currently work in accountingand finance related roles. It can be taken as part of thecandidates' personal development as well as to maintaincontinuing professional development.DATE OF FIRST TEACHING:2010PREREQUISITES:Learners should have a standard of English which enables themto make themselves understood in a business context and whichis equivalent to LCCI level 2 Certificate English for Business.NUMBER OF UNITS/STRUCTURE:Single unit – learners need to achieve single unit of three credits.ASSESSMENT METHOD:100% external assessment - an examination lasting 1 hr 15minutes containing 20 case study-based multiple choicequestions.EXAMINATION TIMING:On demand only.DATE OF RESULT PUBLICATION:Six weeks from the receipt of scripts.GRADING SYSTEM:Pass 50%, Merit 60%, Distinction 75%.PROGRESSION/ARTICULATION:Successful learners may go on to achieve a range of LCCISpecialised Diplomas or to professional accounting and financequalifications.EDI (LCCI) level 3 Award inComputerised Accounting SkillsQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 3BACKGROUND:The level 3 Award in Computerised Accounting Skills developscandidates’ ability to manage a computerised accounting systemin order to provide management information. Candidates willlearn how to process non-routine accounting transactions andprint and analyse reports such as the profit and loss and balancesheet. This qualification is suitable for people who work or intendto work in an advanced accounting role. The assessment for thisqualification can be completed using a range of computerisedmethodsDATE OF FIRST TEACHING:2011PREREQUISITES:Learners should have a standard of English which enables themto make themselves understood in a business context and whichis equivalent to LCCI level 2 Certificate English for Business.Candidates for this qualification must at least have book-keepingand accounting knowledge and skills equivalent to the LCCI level2 Book-keeping and Accounts qualification.NUMBER OF UNITS/STRUCTURE:Single unit – learners need to achieve a single unit of 10 credits.ASSESSMENT METHOD:100% external assessment - an examination lasting three hoursconsisting of a practical case study with related tasks.EXAMINATION TIMING:On demand onlyDATE OF RESULT PUBLICATION:Six weeks from the receipt of scripts.GRADING SYSTEM:Pass 50%, Merit 60%, Distinction 75%.82 <strong>UK</strong> QUALIFICATIONS
<strong>Qualifications</strong> currently offeredPROGRESSION/ARTICULATION:Successful learners may go on to achieve a range of LCCISpecialised Diplomas or to professional accounting and financequalifications.EDI (LCCI) level 3 Award inUnderstanding FinancialStatementsQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 3BACKGROUND:The level 3 Award in Understanding Financial Statementsdevelops candidates’ knowledge and understanding of financialstatements and their ability to interpret the information presentedusing ratios. This qualification is suitable for people who are nonspecialistin financial accounting but who need to understand thelanguage and principles of financial statements in order tobroaden their career opportunities or improve their careerprogression. It is particularly suitable for candidates specialisingin cost and management accounting or other business-relatedcourses as well as managers, administrators, budget holders,salespeople, business owners, etc. It is also useful for anyonewishing to simply improve their own learning and personaldevelopment and better manage their personal finance.DATE OF FIRST TEACHING:2010PREREQUISITES:Learners should have a standard of English which enables themto make themselves understood in a business context and whichis equivalent to LCCI level 2 Certificate English for Business.NUMBER OF UNITS/STRUCTURE:Single unit – learners need to achieve single unit of five credits.ASSESSMENT METHOD:100% external assessment - an examination lasting one hourconsisting of 30 multiple-choice questions.EXAMINATION TIMING:On demand onlyDATE OF RESULT PUBLICATION:Six weeks from the receipt of scripts.GRADING SYSTEM:Pass 50%, Merit 60%, Distinction 75%.PROGRESSION/ARTICULATION:Successful learners may go on to achieve a range of LCCISpecialised DiplomasEDI (LCCI) level 3 Award inPrinciples and Practice ofCostingQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 3BACKGROUND:The level 3 Award in Principles and Practice of Costing developscandidates’ understanding and application of the principles ofcosting. It enables candidates to recognise different approachesto cost accounting and make informed and reasoned judgementsto guide management. The qualification is suitable for people whowish to develop a general understanding of the use of costaccounting in organisations in order to broaden their careeropportunities and progression.DATE OF FIRST TEACHING:2010PREREQUISITES:Learners should have a standard of English which enables themto make themselves understood in a business context and whichis equivalent to LCCI level 2 Certificate English for Business.NUMBER OF UNITS/STRUCTURE:Two compulsory units – learners need to achieve eight credits.ASSESSMENT METHOD:100% external assessment - an examination lasting 1 hour 15minutes consisting of 30 multiple-choice questions.EXAMINATION TIMING:On demand onlyDATE OF RESULT PUBLICATION:Six weeks from the receipt of scripts.GRADING SYSTEM:Pass 50%, Merit 60%, Distinction 75%.PROGRESSION/ARTICULATION:Successful learners may go on to achieve a range of LCCISpecialised Diplomas or to professional accounting and financequalifications.EDI (LCCI) level 4 Award inIslamic Finance and BankingQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 4BACKGROUND:The aim of this qualification is to provide candidates with anintroduction to Islamic finance and banking. They will review thefundamental principles underlying Islamic finance and learn aboutthe main Shariah-compliant financial instruments. They will beintroduced to the main operations of Islamic banking and learnabout Islamic contracts and Islamic bonds. Their study willinclude practical applications of Islamic financial principlesincluding those involving calculations.This qualification would suit a candidate working in a financialenvironment, who wishes to progress into a specialised rolewithin Islamic banking or other Islamic finance products.DATE OF FIRST TEACHING:2012PREREQUISITES:Learners should have a standard of English which enables themto make themselves understood in a business context and whichis equivalent to LCCI level 2 Certificate English for Business.NUMBER OF UNITS/STRUCTURE:Single unit – learners need to achieve a single unit of 10 credits.ASSESSMENT METHOD:100% external assessment - an examination lasting two hoursconsisting of four compulsory questions.EXAMINATION TIMING:On demand onlyDATE OF RESULT PUBLICATION:Six weeks from the receipt of scripts.GRADING SYSTEM:Pass 50%, Merit 60%, Distinction 75%.PROGRESSION/ARTICULATION:Successful learners may go on to achieve the LCCI level 4Diploma in Accounting and Finance.<strong>UK</strong> QUALIFICATIONS 83
<strong>Qualifications</strong> currently offeredEDI (LCCI) level 4 Award inBusiness Finance and BankingOperationsQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 4BACKGROUND:The level 4 Award in Business Finance and Banking Operationsdevelops the candidates’ skill and knowledge to be able toperform a cost benefit analysis on a range of investment andfinancing options and make recommendations which supportbusiness decision-making. Candidates will also gain a basicunderstanding of the principle activities carried out by acommercial bank, and the need for its governance andregulation, along with an introduction to the financial markets,including foreign exchange. This qualification is suitable forpeople who wish to work in an accounting environment, pathwayto higher education or as part of their own continuousprofessional development.DATE OF FIRST TEACHING:2012PREREQUISITES:Learners should have a standard of English which enables themto make themselves understood in a business context and whichis equivalent to LCCI level 2 Certificate English for Business.NUMBER OF UNITS/STRUCTURE:Single unit – learners need to achieve a single unit of 10 credits.ASSESSMENT METHOD:100% external assessment - an examination lasting two hoursconsisting of four compulsory questions.EXAMINATION TIMING:On demand only.DATE OF RESULT PUBLICATION:Six weeks from the receipt of scripts.GRADING SYSTEM:Pass 50%, Merit 60%, Distinction 75%.PROGRESSION/ARTICULATION:Successful learners may go on to achieve the LCCI Level 4Diploma in Accounting and Finance.EDI ( LCCI) level 4 Certificate inApplied Business EconomicsQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 4BACKGROUND:The level 4 Certificate in Applied Business Economics introducescandidates to micro and macro economic theory. Thisqualification will develop the candidates’ knowledge of economicconcepts and theory that can be applied to business activity.Candidates will understand the market mechanism and itsfailings, identify market structure, and will understand costs,revenues and profits. They will be able to analyse the effect ofdifferent market structures on price, output and efficiency.Candidates will also analyse macro economic activity, governmentmacro-objectives and the policies that can be implemented toachieve these objectives. This qualification is suitable for peoplewho wish to work in a role which requires a significant level ofbusiness decision-making, progress into higher education, or aspart of their own continuous professional development.DATE OF FIRST TEACHING:2012PREREQUISITES:Learners should have a standard of English which enables themto make themselves understood in a business context and whichis equivalent to LCCI level 2 Certificate English for Business.NUMBER OF UNITS/STRUCTURE:Single unit – learners need to achieve a single unit of 20 credits.ASSESSMENT METHOD:100% external assessment - an examination lasting three hoursconsisting of five compulsory questions.EXAMINATION TIMING:On demand only.DATE OF RESULT PUBLICATION:Six weeks from the receipt of scripts.GRADING SYSTEM:Pass 50%, Merit 60%, Distinction 75%.PROGRESSION/ARTICULATION:Successful learners may go on to achieve the LCCI Level 4Diploma in Accounting and Finance.EDI (LCCI) level 3 Award inIntroduction to BusinessPlanning and StrategyQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 3BACKGROUND:The level 3 Award in Introduction to Business Strategy andPlanning introduces and develops candidates’ knowledge andunderstanding of the key models and frameworks used instrategy development and planning, and how these may beapplied in given situations. It is suitable for people who wish todevelop a general understanding of strategic planning in order tobroaden their career opportunities and progression. It isparticularly suitable for people who currently hold managementpositions or those aspiring to such positions.DATE OF FIRST TEACHING:2010PREREQUISITES:Learners should have a standard of English which enables themto make themselves understood in a business context and whichis equivalent to LCCI level 2 Certificate English for Business.NUMBER OF UNITS/STRUCTURE:Single unit – learners need to achieve a single unit of five credits.ASSESSMENT METHOD:100% external assessment - an examination lasting one hourconsisting of 30 multiple-choice questions.EXAMINATION TIMING:On demand only.DATE OF RESULT PUBLICATION:Six weeks from the receipt of scripts.GRADING SYSTEM:Pass 50%, Merit 60%, Distinction 75%.PROGRESSION/ARTICULATION:Successful learners may go on to achieve a ranger of LCCI level3 Specialised Diplomas.84 <strong>UK</strong> QUALIFICATIONS
<strong>Qualifications</strong> currently offeredThe English Speaking Board(ESB)The English Speaking Board was founded in 1953 to promoteand assess effective, confident and constructive oralcommunication skills for all levels and all ages. ESB assessmentfocuses on the ability of candidates to communicate theirknowledge, developed opinions and understanding, as well astheir skills in performance of a range of world literature anddrama. ESB has been developing its unique profile as anassessor of spoken English skills for over 50 years, for all ages,skills and backgrounds, in all kinds of educational environments,including junior and senior schools, further and higher education,Special schools, prisons and commercial establishments. ESBoffers assessments and qualifications in speech, communication,drama, ESOL and EFL, throughout the <strong>UK</strong>, Europe and across theworld.ESB assessments cater for candidates from all levels and walksof life, from pre-Entry and foundation, through 8 Graded Examsand beyond, to professional diplomas. Accredited examinations atGrade 6-8 attract UCAS Tariff points.ESB is an awarding organisation recognised in the <strong>UK</strong> by theOffice of <strong>Qualifications</strong> Examinations Regulation (Ofqual), theWelsh Assembly Government, and the Northern Ireland Councilfor Curriculum Framework. ESB’s qualifications are accredited bythese organisations within the <strong>Qualifications</strong> and CreditFramework.English Speaking Board GradedExaminations in SpeechQUALIFICATION ABBREVIATION:ESBQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Grades 1-3 = Level 1Grades 4-5 = Level 2Grades 6-8 = Level 3BACKGROUND:ESB graded examinations in speech provide a plannedprogramme of assessment, enabling candidates and their tutorsor parents to monitor progress towards progressive mastery ofspoken English communication skills. The qualifications requirecandidates to be able to demonstrate their ability to communicateinformation, ideas and opinions in a variety of contexts, dealingwith complex concepts critically and analytically. They must alsodemonstrate their engagement with a variety of verse and prose,to communicate it effectively.DATE OF FIRST TEACHING:1953DATE OF FIRST AWARD:1953PREREQUISITES:No prerequisites. However, all grades are cumulative and entry fora grade assumes mastery of skills and knowledge in previousgrades.NUMBER OF UNITS/STRUCTURE:Single unit per grade.ASSESSMENT METHOD:100% external practical assessment by ESB-trained assessorsEXAMINATION TIMING:Examinations are available all year round.DATE OF RESULT PUBLICATION:Results are confirmed by certification from ESB within 6 weeks ofassessment.GRADING SYSTEM:Distinction, Merit, Pass or Unsuccessful. The syllabuses includeLearning Outcomes and assessment criteria for each grade andarticulation within grades.QUALITY ASSURANCE:Reports/results are quality checked and analysed by ESB HeadOffice, and 10% are further moderated by the standardisationteam before results are issued. These are confirmed by issue ofcertificates.All examiners undergo annual standardisation and training. Thereare regular scheduled standardisation observations for eachexaminer. 10% of all reports from each assessment aremonitored by the standardisation team. A proportion of allassessments are recorded and monitored.European BaccalaureateQUALIFICATION ABBREVIATION:EBBACKGROUND:The European Baccalaureate (EB) is awarded only by the 14European Schools of the European Union (EU), which provide freeeducation for children of staff employed by EU institutions. Thereare currently around 22,500 pupils in the system as a whole, andapproximately 1400 pupils take the final examination each year.The EB examines the final two years of a seven-year secondaryeducation cycle. A significant element of study is alwaysundertaken in the first foreign language, including History andGeography from Year 3. The syllabuses in the 14 languagesections are, with the exception of the mother tongue, identicaland the same standards of attainment are required of all. Not allschools are able to offer all language options. If an option coursecannot be offered in Language I, it may be offered in either theworking language of the student concerned, or in the language ofthe school’s host country. See table below.gStudents must choose all subjects in column 1.gBiology, history, geography and philosophy must be chosen ineither column 2 or 3.gBiology is compulsory unless physics or chemistry is chosenin column 3.gStudents must choose a minimum of two and a maximum offour four-period subjects from column 3 to ensure theirweekly timetable consists of at least 31 periods.In addition they may choose subjects from column 4 and amaximum of two subjects from column 5. The maximumnumber of periods per week is 35 (36 if a column 4 subjectis chosen).The EB should not be confused with the Option International duBaccalauréat (OIB) which is part of the French Baccalauréatdesigned for bilingual candidates, or the InternationalBaccalaureate.DATE OF FIRST TEACHING:1953DATE OF FIRST AWARD:1959PREREQUISITES:Promotion to the EB Year (Year 13 in <strong>UK</strong> system).NUMBER OF UNITS/STRUCTURE:Between eight and 12 subjects are likely to be taken in the EB.<strong>UK</strong> QUALIFICATIONS 85
<strong>Qualifications</strong> currently offeredASSESSMENT METHOD:Forty percent internal assessment during EB year, 36% five finalwritten exams, 24% four final oral exams. Final written and oralexams are jointly assessed by teacher and external examiner.EXAMINATION TIMING:JuneDATE OF RESULT PUBLICATION:JulyGRADING SYSTEM:The EB is a group diploma and candidates are awarded a finaloverall mark expressed as a percentage and a mark out of ten foreach individual subject. Candidates who achieve an overall markof 60% or above are awarded the Baccalaureate. The final markis the result of:a) Internal assessment of all subjects studied during Year 7 bymeans of:ginternal school examinations – 25%gcontinuous assessment – 15%.b) Five final written exams set by the Examining Board, in themother tongue, first foreign language, mathematics and twoelective subjects – 36%.c) Four final oral exams set by the teacher and an externalexaminer appointed by the Examining Board, in mothertongue, first foreign language, history or geography, and afourth compulsory or elective subject – 24%.Complementary subjects cannot be offered in the final written ororal examinations; they contribute only to internal assessment. Atleast two of the four orals are in one of the candidate’s foreignlanguages. There are no individual subject pass certificates butindividual subject marks are calculated at all stages, and areindicated on the final Baccalaureate certificate. Students mustpass each year – if not they must repeat the year, and ultimatelyleave the school if they fail the same year twice. Students receivethe Diploma, which is their formal record of achievement, and themarks for each subject at about the same time in early July. Thesubject results are in simple tabular form.The average score across the European Schools is around 75%.it is extremely difficult to score 90% or more.QUALITY ASSURANCE:The European Schools are administered by a Board of Governorswhich consists of representatives of the member states, and arepresentative of the European Commission. The EB is administeredand directly supervised by an external Examining Board appointedannually by the Board of Governors. The Examining Board ischaired by a university professor and is composed of examinersfrom each of the European Union countries. These representativesmust meet the requirements laid down in their home countries forappointment to the Examining Board.COMPULSORY SUBJECTS OPTIONAL SUBJECTS COMPLEMENTARYACTIVITIESColumn 1 Column 2 Column 3 Column 4 Column 5(2 periods) (4 periods) (3 periods) (2 periods)Language I (4 periods) Biology Latin* Advanced language I Practical physics**Language II (3 periods) History Ancient Greek* Advanced language II Practical chemistry**Mathematics (3 periods) Geography Geography Advanced mathematics^ Practical biology**or Philosophy Philosophy ComputingMathematics (5 periods) Language III Elementary economics ∫Religion/Ethics (1 period) Language IV SociologyPhysical education (2 periods) History Art ∫EconomicsMusic ∫PhysicsPhysical educationChemistryDramaBiologyPoliticsArtLanguage VMusicColumn 2 courses are compulsory unless chosen from column 3. Biology from column 2 is compulsory unless Biology, Physics or Chemistry is taken from column 3.* Students may take these subjects only if they have taken them in Years 4 and 5.^ Advanced mathematics may only be taken in conjunction with five-period mathematics.∫ Not allowed if already chosen in column 3.** Only allowed if corresponding science option is chosen from column 3.For more information on pass rates, average scores and the university performance of EB students, please see the Department forEducation’s publication, ‘The European Schools and the European Baccalaureate: Guidance for Universities and Colleges’:https://www.education.gov.uk/publications/standard/Highereducationanduniversities/Page1/EURO-BACC86 <strong>UK</strong> QUALIFICATIONS
<strong>Qualifications</strong> currently offeredExtended ProjectNATIONAL QUALIFICATIONS FRAMEWORK LEVEL:Level 3BACKGROUND:The 14-19 White Paper of February 2005 called for theintroduction of an extended project to test a wide range of higherlevel skills such as research and autonomous working. Theextended project is a mandatory part of Level 3 Diplomas, andstudents taking A level programmes often have the opportunity ofundertaking an extended project as part of their programme.However, A level programmes are not compulsory and thereforethe extended project will not be mandatory.At level 3, the extended project should offer opportunities forcandidates to:ggggggghave a significant input to the choice and design of theproject, and take responsibility for either an individual task ora defined task within a group projectdevelop and improve their own learning and performance ascritical, reflective and independent learnersdevelop and apply decision-making and, where appropriate,problem-solving skillsextend their planning, research, critical thinking, analysis,synthesis, evaluation and presentation skillsdevelop, where appropriate, as e-confident learners andapply new technologies in their studiesdevelop and apply skills creatively, demonstrating initiativeand enterpriseuse their learning experiences to support their personalaspirations for HE and career development.The project is likely to take a variety of forms, for example apiece of research, a performance or an artefact. In each case, itwill be necessary for the student to provide evidence of theorganisation, research, evaluation and outcomes of the project.Guidance from HEIs will assist students in choosing appropriateprojects in the light of their aspirations for progression to HE.Students will have a wide range of choice of extended project –the project could relate closely to one or more of their A levelsubjects or could be in another area in which the student has aninterest and aptitude. It has been suggested that for somestudents the extended project might replace the fourth AS orGeneral Studies.While Diploma students will be required to undertake a projectrelated to the Diploma line, it is likely that they will be free todecide on the nature of the extended project undertaken(dissertation, investigation, performance, artefact), but schoolsand colleges will give guidance to their students in deciding thescope of their projects to ensure that they meet the criteria. It ispossible that the requirements or preferences of HEIs may be aninfluence on the choice of extended project, and it would greatlyhelp students, and those who advise them in schools andcolleges, if HEIs could publish any requirements or preferences.However, it should be noted that the success of the extendedproject will depend on students being engaged with a topic whichsparks their imagination. The more the student has a major inputto the selection of the topic the more creative the outcome islikely to be. Also, very useful generic skills aiding progression toHE will be developed whatever the project undertaken.The extended project is a qualification equivalent in size to onehalf of an A level and may be taken in year 1, year 2 or spanningthe two years.EXTENDED PROJECT AND THE DIPLOMAFollowing Diploma reforms in 2010 and 2011, the Diplomacontinues to be available to current students to enable them tocomplete the qualification. The Diploma will not be available tonew students from September 2012 (following decisions byawarding organisations to stop offering it). Schools and collegesmay continue to offer the component qualifications (e.g. PrincipalLearning) individually, recognising the inherent value of thesequalifications.DATE OF FIRST TEACHING:2008 (pilots in 2006-7 and 2007-8)DATE OF FIRST AWARD:2009 (pilot students 2007 and 2008 entries)ASSESSMENT METHOD:Internal with external verificationDATE OF RESULT PUBLICATION:AugustGRADING SYSTEM:The extended project has a common framework for both A levelstudents and those taking Diplomas and is graded A* to E.UCAS Tariff points with effect from 2009 entry:GradeUCAS Tariff pointsA* 70A 60B 50C 40D 30E 20QUALITY ASSURANCE:Ofqual arrangements for awarding and setting standards in theExtended Project and Diploma are available at the following link –www.ofqual.gov.uk/files/ofqual-08-3865_DASG_report.pdfFree-Standing Mathematics<strong>Qualifications</strong>QUALIFICATION ABBREVIATION:FSMQNATIONAL QUALIFICATIONS FRAMEWORK LEVEL:Levels 1, 2, 3BACKGROUND:FSMQs (formerly referred to as Free-Standing Mathematics Units)are qualifications for post-16 students (all are accredited pre-16)that were piloted from September 1998 to August 2000. Theybecame part of the National <strong>Qualifications</strong> Framework fromSeptember 2000.The qualifications are available at three levels:gLevel 1 (Foundation) – includes mathematics at grades D –G standard of GCSE MathematicsgLevel 2 (Intermediate/Higher) – includes mathematics at gradesA* – C standard of GCSE MathematicsgLevel 3 (Advanced) – includes mathematics equivalent tothat found in GCE A level and AS courses.At Advanced level, each free-standing qualification is similar insize and demand to a unit of GCE A level/AS, but cannot beaggregated to those qualifications. However, a choice of two ofthe three FSMQs forms components of the GCE AS in Use ofMathematics, for which teaching started in September 2001.<strong>UK</strong> QUALIFICATIONS 87
<strong>Qualifications</strong> currently offeredEach FSMQ:gggggis a qualification in its own rightrequires 60 guided learning hoursallows students to study principles and develop applicationsof specific aspects of mathematics to some depth, drawingupon and enhancing other areas of their work studies orinterestsencourages the use of ICT tools to analyse real dataassociated with a range of realistic contextsis graded A – E or U (Higher level FSMQs are graded A*-E).FSMQs have been designed to meet a range of student needs,eg for:gggggggstudents wanting to gain some mathematics equivalent indemand to GCSE mathematicsstudents who already have GCSE mathematics at grade C orabove, who can use the units to reinforce or extend particularareas of mathematics to support other areas of studyGCE A level or equivalent students who are taking nonmathematicalsubjects but who would like to continue tostudy some mathematics or who need mathematical back-upto their post-16 programmestudents on Access to HE or Foundation coursesstudents in HE who might use them as revision unitsapprentices and National Traineesemployees, including those taking NVQs.The following FSMQs are available:Foundation/Level 1Money managementUsing dataUsing spatial techniquesIntermediate/Level 2Algebra and graphsData handlingFinancial calculationsFoundations of advanced mathematicsShape and spaceAdvanced/Level 3Additional mathematicsCalculus (pilot)Data analysis (pilot)Decision mathematics (pilot)Dynamics (pilot)Hypothesis testing (pilot)Mathematical principles for personal finance (pilot)Modelling with calculusUsing and applying decision mathematicsUsing and applying statisticsWorking with algebraic and graphical techniquesDATE OF FIRST TEACHING:2001DATE OF FIRST AWARD:2002PREREQUISITES:Generally GCSE mathematics (not at levels 1 and 2).NUMBER OF UNITS/STRUCTURE:Varies, generally oneASSESSMENT METHOD:Generally external and portfolioEXAMINATION TIMING:June, some examinations in JanuaryDATE OF RESULT PUBLICATION:August, some results published in MarchGRADING SYSTEM:Most FSMQs are assessed by equally weighted elements ofportfolio evidence and external examinations.Only level 3 FSMQs in Additional Mathematics, Using andApplying Statistics, Working with Algebraic and GraphicalTechniques, and Modelling with Calculus carry Tariff points.GradeUCAS Tariff pointsA 20B 17C 13D 10E 7PROGRESSION/ARTICULATION:GCE mathematics, HEGeneral Certificate of EducationAdvanced levelQUALIFICATION ABBREVIATION:GCE A level or A levelNATIONAL QUALIFICATIONS FRAMEWORK LEVEL:Level 3BACKGROUND:The GCE A level was first introduced in 1951 to replace theHigher Schools Certificate. The earlier history of the qualificationand its grading systems, including the arrangements up to andincluding programmes started before September 2000, isoutlined in a subsequent section.GCE A level is an advanced (level 3) qualification normally takenin schools and colleges in England and Wales in Year 12 (for AS)and Year 13 (for A2) (Year 14 in Northern Ireland), ie two yearsafter GCSE examinations.The effect of Lord Dearing’s Review of <strong>Qualifications</strong> for 16-19-year-olds in 1996, and the Government’s subsequent Qualifyingfor Success consultation in 1997, was to create a flexible post-16 system, which allows the opportunity for a broader curriculumand greater choice without sacrificing depth or reducing thestandard of GCE A level.In order to achieve these aims, the following major changes wereimplemented in schools and colleges from September 2000.gggThe GCE Advanced Subsidiary (AS) was introduced, both asthe first year of GCE A level and as a substantive qualificationin its own right.The structure of GCE A level was revised – modular systemintroduced.The Advanced Supplementary qualification was phased out.Candidates, in conjunction with schools/colleges, choose howmany GCE A level and AS examinations they take and there isconsiderable flexibility in the way in which post-16 programmescan be constructed. Students can also study a combination ofvocational and general qualifications if they wish.GCE A levels are awarded by AQA, CCEA, Edexcel, OCR andWJEC. Awarding bodies developed both GCE A level and ASspecifications for all subjects for use from September 2000. Thespecifications reflect the structural changes for GCE A level andAS qualifications.88 <strong>UK</strong> QUALIFICATIONS
<strong>Qualifications</strong> currently offeredAll specifications are based on the requirements of the published:gggcommon criteriaGCE criteriasubject criteria, where applicable.The regulators in England, Wales and Northern Ireland consideredindividual specifications against the criteria, and those that metall the requirements were accredited to the National<strong>Qualifications</strong> Framework.Opportunities for developing and, where possible, generatingevidence for the assessment of one or more of the six Key Skills areclearly indicated in all GCE AS and A level specifications. Where aKey Skill is deemed to be integral to a subject, it is assessed throughthe GCE A level and this is clearly stated in the specification.Further details are provided by the regulators and the awardingbodies. The Secretary of State for Education recently announcedthat A levels would be reformed, with new A levels in place fromSeptember 2014. For more information please see Ofqual’swebsite at www.ofqual.gov.uk/news-andannouncements/83/873.DATE OF FIRST TEACHING:2000DATE OF FIRST AWARD:2002PREREQUISITES:Normally, candidates take the GCE AS level in their first year ofstudy and then take A2 units in their second year of study tomake it up to the full A level. However, it is possible to sit all ofthe AS and A2 units in the same session at the end of thecourse. There is therefore no requirement to have certificated ASbefore moving on to the full A level.NUMBER OF UNITS/STRUCTURE:From 2000-2007, most GCE A level qualifications were based onsix units of approximately equal size.ggThree of these units constitute the GCE AS qualification,representing the first half of the full A level.The other three constitute the second half of the GCE A level,and are known collectively as A2. The A2 units contributeonly to the full GCE A level and do not constitute a separatequalification.In a small number of cases, GCE A level qualifications have hadfewer than six units. This applies to the small number of minorityforeign languages in order to guarantee continued provision ofthe qualifications (new specifications for minority foreignlanguages were introduced in September 1999). These are:AQA: Bengali, Modern Hebrew, Panjabi, PolishEdexcel: Arabic, Chinese, Japanese, Modern GreekOCR: Biblical Hebrew, Dutch, Gujarati, Persian, Portuguese,Turkish.The following four-unit awards were added:From 2005:OCR: Critical thinking.From 2006:AQA: Critical thinking.Edexcel: Art & design, design & technology, religious studies;OCR: Accounting, law;WJEC: Psychology, world development, sociology.CHANGES FROM SEPTEMBER 2008Revised A level criteria were incorporated into new specificationsfirst taught in 2008. All A levels became four-unit awards, withthe exception of biology, chemistry, electronics, environmentalscience, geology, mathematics, music, physics, some minoritylanguages and A levels in applied subjects.The revisions were designed to ensure that A levels are morechallenging and that the highest levels of achievement arerecognised. The revised A levels were available for first teachingin September 2008. The changes include:gggggfewer units of study (from six to four) without a reduction incontentfewer structured questions, and more open-ended questionswhich require extended essay responsesmore questions which require a synoptic overview of thesubjectthe introduction of an extended projectthe introduction of an A* grade which recognises very highachievement.ASSESSMENT METHOD:The majority of GCE AS and A2 level specifications consist of bothexternal and internal assessment.ggThe GCE AS units are assessed and graded to match thelevel of attainment expected from students in the first half ofan advanced course of study.The more demanding A2 units are assessed at the full Alevel standard.GCE AS units focus on skills, knowledge and understandingdeveloped during the first half of an advanced course of study.The conceptually less demanding material is assessed in AS unitsand the conceptually more demanding material assessed in A2units. Where subjects emphasise the development of skills ratherthan the learning of specific content, the focus on particular skillsmay differ in the AS and A2 units.In all subjects, there will usually be some differences between thetypes of questions used in AS and A2 examinations. There may,for example, be a greater proportion of open-ended and essaystylequestions within A2 papers.There is a continuing requirement for all GCE A levels to provideopportunities for all students to demonstrate their writtencommunication skills (English, Welsh or Irish) in all subjectsexcept mathematics, and the synoptic assessment requirementsin all subjects.There will be differences in the style of questions andexamination papers between subjects, and, where it isappropriate, between specifications in the same subject.Synoptic assessment was introduced as a requirement for allmodular GCE A levels to help ensure that the standard of GCE Alevel continues to be maintained. Candidates are examined ontheir ability to make connections between the different elementsof the subject at the end of the full GCE A level. The synopticelement contributes at least 20% of the overall assessment andappears in one or more of the A2 units. The nature of thesynoptic assessment varies according to the nature of theparticular subject.The GCE A level specifications permit amaximum of 30% internal assessment.EXAMINATION TIMING:There is a common examinations timetable across awardingbodies, with examinations taking place in January and mid-Mayto end of June. This arrangement allows centres to offer studentsthe opportunity of taking AS and A2 units in stages or all togetherat the end of the course. Not all units are available forexamination in January. All specifications indicate clearly whetherunits are available in January as well as June.<strong>UK</strong> QUALIFICATIONS 89
<strong>Qualifications</strong> currently offeredDATE OF RESULT PUBLICATION:August/MarchThe exact timing of publication of GCE A level and AS examinationresults is notified in an annual circular to UCAS correspondents.Results from each awarding body are normally available in mid-August via the UCAS Awarding Body Linkage (ABL) process, whichprovides them to HEIs several working days before the officialpublication date, on the understanding that the results will not berevealed directly or indirectly to the candidates themselves. Theefficient operation of this service depends upon UCAS being able tomatch information on the UCAS application about the applicantwith the records of the awarding body or bodies concerned.GRADING SYSTEM:Graded on a scale of A* – EGCE A level and AS qualifications carry points scores within theUCAS Tariff.If a student is taking the GCE AS and then proceeding to take thefull GCE A level in the same subject, the AS point score will besubsumed into the A level point score.Double counting of qualifications in the same subject area is notpermitted. The points score will be derived from the highest gradeachieved.There is no limit to the total points achievement from GCE or anyother qualifications.More detailed information about the UCAS Tariff is given inAppendix B.The scores used are as follows.GradeUCAS Tariff pointsA* 140A 120B 100C 80D 60E 40U indicates an unclassified performance, which is not certificated.The final result of the A level is based on the sum of individual unitresults. A2 units are graded using judgements about what mightbe reasonably expected of all students at the end of the course.An A* is awarded to candidates who have achieved an A gradeoverall in their A level, and 90% of the maximum marks on theUniform Mark Scale (UMS) at A2. Candidates who achieve an Acan have higher UMS marks than those who achieve an A*,where better performance is concentrated in the AS units (seeexample below):Candidate AS Unit 1 AS Unit 2 A2 Unit 3 A2 Unit 4 Total UMS Grade1 90 85 95 92 362 A*2 100 100 95 83 378 AFor more information on UMS marks, please refer to the Ofqualwebsite at www.ofqual.gov.ukThe standards of the revised GCE A levels are the same as thoseof the previous qualifications.QUALITY ASSURANCE:All GCE AS and A level examinations are subject to qualityassurance procedures. The regulators (Ofqual, DCELLS andCCEA) are responsible for keeping under review all aspects ofschool examinations and assessments. They publish TheStatutory Regulation of External <strong>Qualifications</strong> which includes thecommon criteria for all qualifications and the GCE A levelqualification criteria.These comprise the essential requirements for GCE AS/A levelspecifications in all subjects. They help to ensure uniformity ofstandards and subject content between awarding bodyspecifications, and to clarify the relationship between GCE A leveland AS. They also help HE to know what has been studied andassessed in the qualifications.The subject criteria outline the:gggggaimscore content at AS and A2assessment objectives (and their relative weightings at ASand A2)scheme of assessmentgrade descriptions.All GCE AS and A level specifications are accredited by Ofqual,DCELLS and/or CCEA. All new specifications must comply withthe requirements of the common criteria, GCE A level qualificationcriteria and, where they exist, the subject criteria.The regulators also publish the GCSE, GCSE in vocationalsubjects, GCE, Applied GCE and GNVQ Code of Practice which:gglays down detailed procedures to promote accuracy, fairness,quality and consistency across all awarding bodiesrepresents an enhanced measure of national uniformity ofprocedures and quality assurance.The awarding bodies operate their own detailed quality assuranceprocedures conforming to the Code of Practice. Ofqual andDCELLS carry out scrutinies, probes, five-yearly reviews andcomparability studies to monitor the quality of GCE A level and ASexaminations to ensure the fairness, consistency andcomparability of standards. Ofqual also works with the regulatorsof A levels in Wales (Welsh Government) and Northern Ireland(CCEA) to ensure consistency across the three countries.A list of GCE A level and AS specifications with agreed subjecttitles is given in Appendix E.PROGRESSION/ARTICULATION:Information on areas such as recommended prior learning,overlap of qualifications, progression opportunities, sequencingof units and opportunities for developing and gathering evidencefor the assessment of key skills is clearly indicated in allspecifications. Commonly, students go on to higher education,training and employment.General Certificate of EducationAdvanced Subsidiary levelQUALIFICATION ABBREVIATION:AS level, GCE ASNATIONAL QUALIFICATIONS FRAMEWORK LEVEL:Level 3BACKGROUND:GCE AS level is normally taken over one year of full-time study.It has been designed as a free-standing qualification, or tocontribute the first half of a full GCE A level.Where the normal pattern is for GCE AS to be taken over oneyear of study, followed by a further year of study for GCE A level,it is possible that some students may take one or more GCE ASqualifications over two years. It is possible for GCE A level to betaken over one year and a minority of students may take90 <strong>UK</strong> QUALIFICATIONS
<strong>Qualifications</strong> currently offeredadvantage of this. It should also be understood that GCE AS is notrestricted to the first year of sixth form studies, and that it ispossible to take one or more further GCE AS qualifications in thesecond year of post-16 study.In order to be awarded an overall AS grade and a certificate, it isnecessary for the candidate to ask specifically to ‘cash-in’ units.This normally takes place at the time the entry is made for thefinal units for the qualification, although a student may cash in ata later series. Certificates will only be issued on two occasions inthe year, following the June examination series and, for manyspecifications, following the January examination series.Students who have cashed in for an AS award must give thegrade in their UCAS application.Candidates who have accepted and have been awarded an AScertificate can resit AS units, in which case the better resultcounts towards the full A level. However, candidates are not issuedwith a new AS certificate unless they resit all the AS units, in whichcase it is based solely on their resits because the earlier AS unitsare ‘used up’ for AS purposes by the original act of AS certification.Summer 2007 was the last session in which candidates wereable to decline certification. From the January 2008 examinationseries, a candidate wishing to improve a grade is no longerrequired, nor able, to decline the original award. This means, thatafter certification, candidates do not have to retake the wholequalification to improve performance but can do so throughre-sitting individual units.Students are not normally able to combine the AS units taken onone specification with the AS units taken on a differentspecification. However, students completing a full AS in onecentre and then having to move to a new centre for A2, may beallowed to transfer an AS of one specification to the A level ofanother specification. Such arrangements are at the discretion ofthe receiving awarding body. Permission is likely to be granted inthe vast majority of cases, but will depend on the compatibility ofthe two specifications.DATE OF FIRST TEACHING:2000DATE OF FIRST AWARD:2001PREREQUISITES:Although there had not previously been a formal requirementthat a candidate must have taken a subject at GCSE beforeattempting the same subject at GCE A level, recommended priorlearning has been a feature of new GCE specifications fromSeptember 2000.NUMBER OF UNITS/STRUCTURE:From 2000-2007 most GCE A level qualifications were based onsix units of approximately equal size: the first three of these unitsconstituted the GCE AS qualification, representing the first half ofthe full A level. In a small number of cases, GCE A levelqualifications had fewer than six units. This applies to the smallnumber of minority foreign languages in order to guaranteecontinued provision of the qualifications (new specifications forminority foreign languages were introduced in September 1999).These are:AQA: Bengali, Modern Hebrew, Panjabi, Polish.Edexcel: Arabic, Chinese, Japanese, Modern Greek.OCR: Biblical Hebrew, Dutch, Gujarati, Persian, Portuguese,Turkish.The following four-unit awards have since been added:From 2005:OCR: Critical thinking.From 2006:AQA: Critical thinking.Edexcel: Art & design, design & technology, religious studies;OCR: Accounting, law.WJEC: Psychology, world development, sociology.Revised AS criteria have been incorporated into newspecifications first taught in 2008. All AS have become two-unitawards, with the exception of biology, chemistry, electronics,environmental science, geology, mathematics, music, physics, thelanguages listed above and AS in applied subjects.ASSESSMENT METHOD:GCE AS units focus on skills, knowledge and understandingdeveloped during the first half of an advanced course of study.The conceptually less demanding material is assessed in AS unitsand the conceptually more demanding material assessed in A2units. Where subjects emphasise the development of skills ratherthan the learning of specific content, the focus on particular skillsmay differ in the AS and A2 units. There is no synopticassessment in the GCE AS.The majority of AS qualifications are assessed by means ofexternally assessed written papers and internally assessedcoursework/ practicals of normally up to 30%.EXAMINATION TIMING:There is a common examinations timetable across awardingbodies, with examinations taking place in January and June. Thisarrangement allows centres to offer students the opportunity oftaking AS and A2 units in stages or all together at the end of thecourse. AS units do not have to be taken during the first half ofthe course only.Not all units are available for examination in January. Allspecifications indicate clearly whether units are available inJanuary as well as June.AS/A levels in applied subjects were introduced for first teachingin 2005 to replace VCEs. The first awards of the applied ASqualifications were in summer 2006.DATE OF RESULT PUBLICATION:Results from each awarding body are normally available inmid-August. The results of January examinations are normallyavailable in the following March.GRADING SYSTEM:Graded on a scale of A – E.GradeUCAS Tariff pointsA 60 Highest grade awardedB 50C 40D 30E 20 Lowest pass awardedU indicates an unclassified performance which is not certificated.Examiners grade the AS by judging the performance that mightreasonably be expected of advanced level students halfwaythrough the course, unlike the former Advanced Supplementaryexamination in which judgements were made about performancethat might be expected at the end of the full A level.The AS grade is based on students’ attainments in the two ASunits; for those who go on to complete the full A level, their gradewill be based on attainment in the two AS and two A2 units<strong>UK</strong> QUALIFICATIONS 91
<strong>Qualifications</strong> currently offeredcombined. For candidates who sit all assessment units of A levelat the end of the course, grades will be awarded for the AS andthe full A level.QUALITY ASSURANCE:All GCE AS level examinations are subject to quality assuranceprocedures. The regulators (Ofqual, CCEA and DCELLS) areresponsible for keeping under review all aspects of schoolexaminations and assessments. They have published, inconjunction with the awarding bodies, the GCSE, GCSE invocational subjects, GCE, VCE and GNVQ Code of Practice2002/3 which:gglays down detailed procedures to promote accuracy, fairness,quality and consistency across all awarding bodiesrepresents an enhanced measure of national uniformity ofprocedures and quality assurance.PROGRESSION/ARTICULATION:GCE A level, Advanced Apprenticeship, training and employment.VARIANTS:Since 2000, there has been a small number of free-standingAS qualifications, for which there is no equivalent GCE A level.The list is given in Appendix E.The GCE AS in Use of mathematics was introduced in September2001, with first awards in summer 2002. This AS is designed tomeet the needs of students who do not intend to take the subjectto A level, but who would welcome an opportunity to study somemathematics to AS level with an emphasis on how mathematicsis used to model a wide range of real-world problems.This AS is of comparable demand to GCE AS mathematics, butconcentrates less on the mastery of additional content and moreon the process skills of reasoning, understanding the way inwhich mathematics is used to model reality, and communication.The AS is designed to be more applications orientated and tostress the use of ICT for working with large data sets andstudying the graphical behaviour of functions.The AS has three components, two of which are Advanced FreestandingMathematics <strong>Qualifications</strong> (FSMQs) (see section onFSMQs above). All students have to study the Advanced FSMQWorking with algebraic and graphical techniques and one ofusing and applying statistics or modelling with calculus. Inaddition, all students study a terminal unit – Applyingmathematics – which is unique to this qualification.Students not obtaining the full AS in Use of mathematicsqualification will gain credit for each of the FSMQs successfullycompleted.The AS in Use of mathematics acts as a full proxy qualification forthe award of level 3 of the Key Skill of Application of Number.GCE Advanced Subsidiary/Advanced level in AppliedSubjectsQUALIFICATION ABBREVIATION:AS, AS Double Award, A level, A level Double Award.NATIONAL QUALIFICATIONS FRAMEWORK LEVEL:Level 3BACKGROUND:A levels in applied subjects are qualifications that enable studentsto develop skills, knowledge and understanding in the area theyare studying and prepare them for both the world of work and forprogression to higher education. They have replaced theAdvanced Vocational Certificate of Education that used to beinformally known as ‘Vocational A levels’ or AVCEs. They have astructure that is similar to the GCE AS/A2 model and wereavailable for first teaching in 2005/6 academic year. At the sametime, the formal distinction between GCEs and the old AVCEs hasbeen dropped and both applied and academic qualifications areknown as GCEs. However, a small number of subjects – art &design, business, ICT and science – were previously available asboth GCEs and AVCEs. In order to distinguish between the twoqualifications, the term “applied” has been introduced into therevised VCE qualification in these subjects: for example, the oldVCE in art & design is known as the GCE A level in applied art &design.A levels in applied subjects are designed to be related to NationalOccupational Standards in relevant sectors and to equip studentswith up-to-date knowledge, skills and understanding of theunderpinning principles and processes of those sectors. Learningis expected to be active and student-led, although directed byteachers and, where appropriate, supported by professional andemployer input.A levels in applied subjects are available as a series of differentsizes of award to promote flexibility in the post-16 curriculum:ggggAS – three units (three AS units)AS double award – six units (six AS units)A level – six units (three AS and three A2 units)A level double award – 12 units (six AS and six A2 units).Students should be aware that not all awarding bodies offer thefull range of subjects and awards.As with all GCE AS/A levels, the achievement of an AS/A level inapplied subjects is not dependent on achievement of Key Skills.However, the development of Key Skills forms an integral part ofthe award and they are signposted in all units.DATE OF FIRST TEACHING:2005DATE OF FIRST AWARD:AS and AS double award – 2006A level and A level double award – 2007NUMBER OF UNITS/STRUCTURE:Applied AS/A levels were introduced in September 2005. Theawards consist of a mixture of mandatory and optional units.Within individual sector areas, there may be alternative modelsof how the award may be constructed, providing a measure ofcontrolled flexibility. In the VCEs, the mandatory units werecommon to all specifications. However, with the applied A levels,criteria were developed to inform the development by theawarding bodies of their own mandatory units. The A levels maybe taken over one or two years. (The first A2 awards were notavailable until 2007 and so any students studying a one-yearA level programme in 2005/6 would have taken the old VCE.)From summer 2008, a new award was available to rewardachievement of candidates who have achieved nine units in anAS/A level in an applied subject. The title of the award is:Advanced GCE with Advanced Subsidiary (Additional) in [subject]– 9 units (six AS and three A2)92 <strong>UK</strong> QUALIFICATIONS
<strong>Qualifications</strong> currently offeredIt is not expected that many candidates will receive this award. Ithas been created to reward candidates who for some reasonwere unable to complete the full double award A level.ASSESSMENT METHOD:The four awards (outlined earlier) all draw from the same pool ofunits and use the same assessment arrangements: a combinationof externally assessed written papers (usually one-third) andinternally assessed coursework/portfolio (usually two-thirds).The broad aim of the redesign of vocational qualifications atadvanced level was to give the qualifications the same AS/A2structure and A – E grading system as the GCE AS/A levels.The qualifications are unit based. Each unit clearly sets outthe learning which students must cover in order to provide theassessment evidence. Assessment criteria are used to assess thestudents’ ability to apply their skills, knowledge and understandingin a vocational context. The assessment criteria are written foreach unit, and the units are written for, and addressed directlyto, the students themselves. The exact nature of externalassessment varies depending on the subject area, level (ie ASor A2) and unit content.Evidence for assessors on the use of the criteria is given ina section of the units entitled ‘Essential Information forTeachers’ which suggests teaching strategies and resources,and includes Key Skills signposting.EXAMINATION TIMING:January/JuneDATE OF RESULT PUBLICATION:March/August.GRADING SYSTEM:Note: A new grade of A* was introduced for A level in 2008.AS level is reported on a five-grade scale from A – E where A isthe highest.A level is reported on a six-grade scale from A* – E where A* isthe highest.AS double award is reported on the following grading scale: AA,AB, BB, BC, CC, CD, DD, DE, EE, EUA level double award is reported on the following grading scale:A*A*, A*A, AA, AB, BB, BC, CC, CD, DD, DE, EE, EUGradeUCAS Tariff pointsASA levelA* n/a 140A 60 120B 50 100C 40 80D 30 60E 20 40ASA levelDouble DoubleAward AwardA*A* n/a 280A*A n/a 260AA 120 240AB 110 220BB 100 200BC 90 180CC 80 160CD 70 140DD 60 120DE 50 100EE 40 80Separate points are available for each unit, and these areaggregated to determine an overall grade for the qualification.These points should not be confused with those used on theUCAS Tariff (see above).U indicates an unclassified performance, which is not certificated.QUALITY ASSURANCE:For internal assessment, a moderation system designed toensure that entry grades are in line with national standards hasreplaced the external verification system. Normally at least a thirdof the overall assessment is externally set and marked by theawarding bodies.A subject listing of GCE A/AS levels in applied subjects is given inAppendix E.PROGRESSION/ARTICULATION:The awards have been designed to promote flexibility in thepost-16 curriculum allowing students to incorporate them intotheir programmes and in particular to combine them with otherGCE AS and A2s.General Certificate of SecondaryEducationQUALIFICATION ABBREVIATION:GCSENATIONAL QUALIFICATIONS FRAMEWORK LEVEL:levels 1, 2BACKGROUND:The General Certificate of Secondary Education (GCSE) is aqualification which is normally taken in schools at approximatelyage 16. It was created by the merging of the former GeneralCertificate of Education (GCE) Ordinary (O) level and theCertificate of Secondary Education (CSE) to form a single systemof examining at 16+.Currently, the majority of pupils take GCSEs at the end of KeyStage 4, the last two years of compulsory education. GCSEs areavailable in a wide range of academic and, since 2002, appliedsubjects.GCSE qualifications are available in three sizes.GCSEThis is the main form of the qualification and is sometimesreferred to as a single award.SHORT COURSE GCSEGCSE awarding bodies have offered short course GCSEs sinceSeptember 1996, the first examinations having taken place insummer 1997. These qualifications cover half the subject contentof a GCSE and are usually taught in half the time.DOUBLE AWARD GCSEThe Double Award GCSE exists in certain, mainly applied subjects.The qualification usually occupies two option blocks in schooltimetables and students are awarded two grades, eg AA, CD.DATE OF FIRST TEACHING:GCSE was first introduced in 1986, with first examinations in1988. Specifications have been revised periodically, most recentlyfor first teaching in 2009 in most subjects, except English, Welsh,mathematics and ICT (revised for first teaching in 2010), and thesciences (revised for first teaching in 2011). Applied GCSEs weredeveloped for first teaching in September 2002.The final grade is calculated using a points-based system.<strong>UK</strong> QUALIFICATIONS 93
<strong>Qualifications</strong> currently offeredDATE OF FIRST AWARD:1988; most recently revised specifications in 2011 (mostsubjects except the following), 2012 (English, Welsh,mathematics and ICT), and <strong>2013</strong> (the sciences).NEW GCSE TITLES IN KEY SUBJECTSThe suite of GCSEs available in key subjects has changed inrecent years. In science, since 2006, students take Science GCSEand Additional or Additional Applied Science GCSE – coveringbiology, chemistry and physics - or the three separate scienceGCSEs. In England, from 2010, students have been able to takeeither English GCSE, which covers both language and literature,or separate English Language and English Literature GCSEs. InWales, students may take either or both English Language andEnglish Literature GCSEs but may not take English GCSE. Inmathematics, in addition to the single award GCSE, the <strong>UK</strong> andWelsh Governments are funding a pilot of a linked pair ofmathematics GCSEs which started in 2010. The mathematicslinked pair aims to improve pupils’ attitudes towards andengagement with mathematics and inspire more young people tostudy maths beyond GCSE. The two GCSEs are Methods inMathematics and Applications of Mathematics, both of whichmust be taken since together they cover the Programme of Studyplus some additional content. First awards of the pilotqualifications are in 2012.PREREQUISITES:NoneNUMBER OF UNITS/STRUCTURE:Most GCSEs are offered at two tiers, foundation and higher,corresponding with level 1 and level 2 of the NQF.GCSEs were generally linear in structure, with some modularcourses in some subjects, but have no set number of units.However, Applied GCSEs introduced in 2002 had a three-unitstructure. New GCSEs in the sciences introduced in 2006 wereunit-based. From 2009 most GCSEs have been modular with amaximum of four assessment units in a single award.ASSESSMENT METHOD:GCSE assessment used to be at the end of the course for themajority of subjects and consist of both external and internalassessment. The number of examination papers and the exactproportion of internal assessment varied from subject to subject.Internal assessment often accounted for 20% of the total, theremainder being external, although this varied across subjects.Internal assessment included coursework and practicalinvestigations, depending on the balance allowed by the subjectcriteria.From September 2009 coursework was replaced by controlledassessment in most subjects. Controlled assessment is internalassessment that takes place under controlled conditions inschools and is normally set by an awarding body. The balance ofcontrolled assessment to external examinations varies betweensubjects, ranging from 100% external examination, to 25% or60% controlled assessment. At least 40% of the assessmentmust be terminal.Further changes to GCSE assessments in England will take placefrom September 2012, following the Government’s commitmentto reform GCSEs set out in the Schools White Paper Theimportance of teaching, published in November 2010. All externalassessments on current GCSEs must take place at the end of thecourse for GCSEs certificating in 2014; and specific marks foraccurate spelling, punctuation and grammar will be restored toexternal examinations in key subjects requiring extended writtenresponses from January <strong>2013</strong>. Resitting of individual unitexaminations will no longer be allowed, although it will still bepossible to resit the whole qualification. The Government iscurrently reviewing the National Curriculum and intends to reformexaminations at 16 to reflect the new curriculum.The changes to GCSEs which take effect in England fromSeptember 2012 are not required in Wales. Candidates in Walesmay continue to follow both linear and modular specifications.Although not a Welsh Government requirement, marks foraccurate spelling, punctuation and grammar will also be awardedin key subjects in Wales as in England.In the north of Ireland, following public consultation, theEducation Minister John O’Dowd decided schools would be freeto choose between the linear and unitised modes of assessment.For unitised GCSEs, there will continue to be only one resitopportunity for each unit. There will also be a small number ofadditional marks (5%) available in English literature, geography,history and religious studies for Spelling, Punctuation andGrammar (SPaG). As part of the planned overall review of GCSEsin the north of Ireland, an evaluation of the impact of unitisedGCSEs will be undertaken in 2014/15 to establish whetherchanges to specifications are needed.EXAMINATION TIMING:GCSEs are taken in the summer, normally from mid-May to theend of June, in November and in winter/spring. As part of theforthcoming changes to GCSEs, from 2014 GCSE examinationswill only be available in the summer examination series, exceptfor GCSEs in English, English language and mathematics forwhich there will also be an assessment opportunity in November.In Wales, assessment opportunities continue to be available inJanuary as well as in the summer.DATE OF RESULT PUBLICATION:GCSE results are normally available in late August, one weeklater than A level/AS results. HEIs can make conditional offersto students incorporating a GCSE requirement in additionto A level/AS. The process of confirming the offer is likelyto be delayed pending the issue of the GCSE results.GRADING SYSTEM:A* – C are the levels of attainment normally required for entry toHE (level 2 in the NQF). The A* grade was introduced from 1994to reflect a level of performance above grade A, and to rewardoutstanding achievement. Grades D – G are lower levels ofattainment (level 1 in the NQF). U represents unclassified, iejudged to be of insufficient standard to be recorded.GCSE Double Awards are equivalent to two GCSEs in size,and result in the award of full grades, A*A* – GG, with Ufor unclassified.QUALITY ASSURANCE:GCSEs are accredited, monitored and scrutinised by Ofqual.From December 2000, all GCSE examinations have beengoverned by the joint regulators’ GCSE, GCE, GNVQ and AEACode of Practice.GCSE specifications are developed in accordance with GCSEregulations, GCSE qualifications criteria, and, where relevant,subject-specific criteria.PROGRESSION/ARTICULATION:Recommended prior learning at GCSE level has been a feature ofnew GCE specifications from September 2000. Students can alsoprogress to Applied GCE, Advanced Apprenticeships, NVQ,training and employment.VARIANTS:GCSE Double Award and Short CourseGCSE mathematics has two tiers of entry: foundation (gradesC – G) and higher (grades A* – D). This replaced the three-tier94 <strong>UK</strong> QUALIFICATIONS
<strong>Qualifications</strong> currently offeredsystem from September 2006; first awards were insummer 2008.A number of GCSE titles are untiered.ICCE International Certificate ofChristian EducationQUALIFICATION ABBREVIATION:ICCEBACKGROUND:The ICCE provides qualifications for pupils who use theAccelerated Christian Education (ACE) programme in independentfaith-based schools and homeschools. ICCE Advanced Certificateis accepted by many universities for undergraduate entry. A <strong>UK</strong>NARIC assessment in 2011 carried out in both school andhomeschool environments stated that the General Certificate canbe considered comparable to Cambridge InternationalExaminations O levels and the Advanced Certificate can beconsidered comparable to CIE A levels.Since September 2004, the ICCE has replaced the NationalChristian Schools’ Certificate (NCSC). The curriculum content andstandard have been enhanced by coursework at the four highestlevels.DATE OF FIRST AWARD:2005NUMBER OF UNITS/STRUCTURE:ICCE Foundation = 7.5 creditsICCE Vocational = 16 creditsICCE General = 16 credits plus courseworkICCE Intermediate = 23 credits plus courseworkICCE Advanced = 29 credits plus courseworkICCE Advanced Plus = 34 credits plus courseworkASSESSMENT METHOD:By unit tests, essays and practical science projects, all externallymoderated (80% internal, 20% external).EXAMINATION TIMING:Throughout the yearDATE OF RESULT PUBLICATION:Throughout the yearGRADING SYSTEM:A* 100%–98%A 97.99%–96%B 95.99%–92%C 91.99%–88%D 87.99%–84%E 83.99%–80%Fail below 80%QUALITY ASSURANCE:All unit tests are moderated by internal trained moderators andverified by external moderation. Schools are vetted by an annualassessment visit. Home educated pupils are required to submit alltests annually for external moderation.PROGRESSION/ARTICULATION:Students complete each level of the certification programme overa period of, typically, five years. Pupils must complete the lowercertificates before proceeding to the next. The credits areaccumulative.Institute of CommercialManagementThe Institute of Commercial Management (ICM) offers educationaland vocational qualifications which are recognised throughout the<strong>UK</strong> and worldwide. ICM is an accredited awarding organisationoffering awards on the National <strong>Qualifications</strong> Framework (NQF)and the <strong>Qualifications</strong> and Credit Framework (QCF). ICM works inpartnership with universities, commerce, industry, governmentsand higher education and training providers. In its capacity as acourse developer, and an examining and awarding board, theInstitute provides a wide range of professional and vocationalqualifications in business and management studies and relatedareas.ICM programmes are designed to address the wide variety ofpersonal development and training needs of those wishing toenter the commercial sector and to support the continueddevelopment and workplace flexibility of those already inemployment.ICM’s global services include the:ggggdesign, development and certification of business educationand training programmes for education providersdevelopment and certification of tailored education andtraining programmes for the corporate sector, emergingindustries and the global workforceexamination, assessment and certification of studentsundertaking business, management and trainingprogrammesprovision of technical assistance and consultancy services inthe fields of business management, tourism and personaldevelopment.The Institute offers qualifications at certificate, diploma, advanceddiploma, graduate and postgraduate diploma levels.<strong>Qualifications</strong> are awarded in a wide range of subjects includingbusiness, management, marketing, finance, human resourcemanagement, tourism, hospitality, law, computing, maritime,professional sales, journalism and media.The Institute is a professional body for commercial and businessdevelopment managers and supports career and personaldevelopment. Associate and professional membership is open tothose who complete the relevant degree-level qualifyingexaminations.ICM Certificate/Diploma/Advanced Diploma/GraduateDiploma/Postgraduate DiplomaProgrammesBACKGROUNDCertificatesCertificates are foundation programmes designed for postsecondaryeducation and open access programmes for adultswith little or no formal academic qualifications. The courseduration is normally up to one year of full-time study. Certificateprogrammes are accredited at NQF level 4. ICM certificates areappropriate as an entry level qualification for relevant degreeprogrammes.DiplomasDiploma-level programmes are designed for business students(18+) and working adults. The programmes are normallydelivered over one to two years of full-time study or two to three<strong>UK</strong> QUALIFICATIONS 95
<strong>Qualifications</strong> currently offeredyears of part-time study. Diploma-level programmes equate toNQF level 5 qualifications. Relevant ICM Diploma awards areconsidered acceptable by many universities for direct entry to thesecond year of Honours degree programmes.ICM Diploma holders demonstrate competence in the applicationof knowledge in a broad range of varied work activities performedin a wide variety of contexts. Learning at this level involvesobtaining detailed knowledge and skills and is appropriate forpeople working independently, or providing basic supervision andtraining of others in their field of work and people wishing to go touniversity.Advanced DiplomasAdvanced Diploma programmes are designed for advanced levelbusiness students, supervisors, managers and mature workingadults with existing business qualifications. Advanced Diplomasare normally completed in two years of full-time study or at leastthree years of part-time study and are designed to provide a levelof business knowledge equal to that obtained after two years ofundergraduate study.The Advanced Diploma is accredited as an NQF level 6 qualificationand involves specialist learning and detailed analysis of informationand knowledge in a specified area of work or study. Studentsdemonstrate an increased depth of knowledge and understandingof an area of work or study that enables them to formulatesolutions and responses to complex problems and situations.ICM Advanced Diploma qualifications are appropriate for peopleworking as higher grade supervisors, professionals or managerswho need to demonstrate high levels of knowledge, a high levelof work expertise in appropriate job roles and competence inmanaging and training others.These qualifications are considered to be equivalent to <strong>UK</strong>intermediate HE awards. Most Advanced Diploma programmesare taken as an end in themselves, but they can also be used forentry at an appropriate level (usually final year) in first degreestudies.Graduate DiplomasThe Graduate Diploma qualifications equate to NQF level 6 andinvolve further study and analysis (incorporating a dissertation/project). The ICM Graduate Diploma is considered to be at finalyear degree level and may be used as an entry level qualificationfor postgraduate study.Postgraduate DiplomasThe Postgraduate Diplomas (at level 7 on the NQF) consist of 120credits of Masters level work and enable successful students toenter with advanced standing onto appropriate Mastersprogrammes such as the MBA.ASSESSMENT METHODS:ICM Certificate units focus on the development of knowledge andunderstanding of conceptually less demanding material whilsthigher level awards such as Advanced Diploma units assess theconceptually more demanding material. Many units testcandidates' accumulated understanding of the domain as awhole and their ability to integrate and apply their skills,knowledge and understanding in appropriate contexts. All unitsequate to 200-hour (20-credit) courses and are assessed bymeans of externally assessed and moderated written papers.Assessment is generally by 100% examination.All ICM programmes are multi-subject and candidates arerequired to undertake formal, externally set and markedexaminations in all subjects within any programme. Alternatively,candidates may be able to study single subjects.GRADING SYSTEM:Examination grades are as follows.A Distinction 70% and aboveB Pass with Merit 60% to 69%C Pass with Credit 50% to 59%D Pass 40% to 49%F Fail 39% and underQUALITY ASSURANCE:In order to maintain global standards, examination papers for allstandard ICM programmes are set by the Institute’s Examinersand all candidates’ work is returned to ICM for marking,assessment and moderation and the issue of results andcertificates. Many major ICM qualifications are accredited byOfqual.NUMBER OF UNITS/STRUCTURE:A standard full-time Advanced Diploma course (incorporating theCertificate and Diploma stages) consists of 12 units equivalent to240 credits.PROGRESSION/ARTICULATIONOn successful completion of ICM Certificates/Diplomas/AdvancedDiplomas, students may progress to further professionalqualifications or to appropriate levels of honours degree courses.An ICM Graduate Diploma may allow access to postgraduatestudy such as Masters degree programmes.ifs School of FinanceThe ifs School of Finance is a leading provider of financialeducation.As a School of Finance, the ifs provides for the formal learningneeds of consumers and those employed within the industry, bothin the <strong>UK</strong> and in key markets worldwide.ifs Certificate in Financial StudiesQUALIFICATION ABBREVIATION:CeFSQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 3BACKGROUND:The ifs level 3 Certificate in Financial Studies (CeFS) has beendesigned to encourage individuals to be inspired to meet theirlifestyle aspirations. This will be achieved by teaching them toapply the appropriate solution(s) from the wide range availablewithin the evolving financial services marketplace. Learners whowish to make informed and confident decisions regarding theirfinances should consider the Certificate in Financial Studies.DATE OF FIRST TEACHING:2001DATE OF FIRST AWARD:2002NUMBER OF UNITS/STRUCTURE:Three units:Unit 1: Why money mattersUnit 2: Risk and reward in personal financeUnit 3: Making personal financial judgementsASSESSMENT METHOD:Electronic and paper-based examination.Unit 1: Why money matters. Tested electronically or by paperbasedexamination. The exam consists of fifty multiple-choice96 <strong>UK</strong> QUALIFICATIONS
<strong>Qualifications</strong> currently offeredquestions in a one-hour examination. The examination scorecontributes 25% to the overall qualification score.Unit 2: Risk and reward in personal finance. Tested electronicallyor by paper-based examination. The examination consists of twosections. Section A: five multiple-choice questions. Section B: sixcase studies of five questions each in a one-hour examination.The examination score contributes 35% to the overallqualification score.Unit 3: Making personal financial judgements. Tested by a writtenexamination. The examination consists of one question from achoice of two in a one-hour 30 minute examination. Thequestions are based on case studies with a number of short/partquestions. The examination score contributes 40% to the overallqualification score.EXAMINATION TIMING:On demand for electronic examinations. Unit 3 assessment isoffered three times a year.DATE OF RESULT PUBLICATION:Unit 1 and 2 results are available via the web within 72 hours ofreceipt of the examination papers. Unit 3 results should beavailable within one calendar month of the examination date.GRADING SYSTEM:Graded A – E and U for ungraded. CeFS has been awarded thefollowing UCAS Tariff points with effect from 2005 entry to highereducation.Grade UCAS Tariff pointsA 60B 50C 40D 30E 20QUALITY ASSURANCE:OfqualPROGRESSION/ARTICULATION:CeFS provides underpinning knowledge for, and a pathway into,study for other ifs qualifications. CeFS also aids entry into highereducation and provides a good basis from which to pursue acareer in the financial services industry.ifs level 3 Diploma in FinancialStudiesQUALIFICATION ABBREVIATIONDipFSQUALIFICATIONS AND CREDIT FRAMEWORK LEVELLevel 3BACKGROUNDThe ifs level 3 Diploma in Financial Studies (DipFS) consists ofthe CeFS units and three additional units. The additional unitsapply learners’ knowledge to the broader financial environment:the financial planning element introduced in the CeFS unitsbecomes more dynamic and flexible, as the learners becomemore aware of the (financial) environment within which they live.DATE OF FIRST TEACHING2004DATE OF FIRST AWARD2005NUMBER OF UNITS/STRUCTURESix units:Unit 1: Why money mattersUnit 2: Risk and reward in personal financeUnit 3: Making personal finance judgementsUnit 4: Financing the futureUnit 5: Financial services from the providers’ perspectiveUnit 6: Enhancing financial capability.ASSESSMENT METHODElectronic and paper-based examination.Unit 1: Why money matters. Tested electronically or by paperbasedexamination. The examination consists of fifty multiplechoicequestions in a one-hour examination. The examinationscore contributes 25% to the overall qualification score.Unit 2: Risk and reward in personal finance. Tested electronicallyor by paper-based examination. The examination consists of twosections. Section A: five multiple-choice questions; Section B: sixcase studies of five questions each in a one-hour examination.The examination score contributes 35% to the overallqualification score.Unit 3: Making personal financial judgements. Tested by a writtenexamination. The examination consists of one question from achoice of two in a one-hour 30 minute examination. Thequestions are based on case studies with a number of short/partquestions. The examination score contributes 40% to the overallqualification score.Unit 4: Financing the future. Tested electronically or by paperbasedexamination. The examination consists of two sections.Section A: seven multiple-choice questions; Section B: sevencase studies of five questions in a one-hour 15 minuteexamination. The examination score contributes 30% to theoverall qualification score.Unit 5: Financial services from the providers’ perspective. Testedelectronically or by paper-based examination. The examinationconsists of two sections. Section A: 21 multiple-choice questions;Section B: three case studies of seven questions in a one-hour15 minute examination. The examination score contributes 30%to the overall qualification score.Unit 6: Enhancing financial capability, paper-based examination.Tested by a written examination. The examination consists of onequestion from a choice of two in a one-hour 30 minuteexamination. The questions are based on pre-released casestudies with a number of short/part questions. The examinationscore contributes 40% to the overall qualification score.EXAMINATION TIMINGOn demand for units 1, 2, 4 and 5, the assessment for unit 3 isoffered three times a year and the assessment for unit 6 isoffered twice a year.DATE OF RESULT PUBLICATIONUnit 1, 2, 4 and 5 results are available via the web within 72hours of receipt of the examination papers. Unit 3 and 6 resultsshould be available within one calendar month of the examinationdate.GRADING SYSTEMGraded A – E and U for ungraded. DipFS has been awarded thefollowing UCAS Tariff points with effect from 2012 entry to highereducation.Grade UCAS Tariff pointsA 120B 100C 80D 60E 40<strong>UK</strong> QUALIFICATIONS 97
<strong>Qualifications</strong> currently offeredPlease note that the new QCF version of the Diploma includes thecontent of the Certificate. Therefore Tariff points cannot becounted for both qualifications as they could for the NQF versions.QUALITY ASSURANCEOfqualPROGRESSION/ARTICULATIONDipFS provides underpinning knowledge for, and a pathway into,study for other ifs qualifications. DipFS also aids entry into highereducation and provides a good basis from which to pursue acareer in the financial services industry.International BaccalaureateThe International Baccalaureate (IB) is a non-profit educationalorganisation that was established in 1968.The IB offers programmes to a wide variety of schools locatedthroughout the world, including:gthe Diploma Programme, for students aged 16-19 in the finaltwo years of school before universitygthe Career-related Certificate, for students aged 16-19gthe Middle Years Programme, for students aged 11 to 16gthe Primary Years Programme (PYP), for students aged threeto 12.There are 3,412 schools (IB World Schools) that are authorised tooffer International Baccalaureate programmes in 141 countries.International BaccalaureateDiplomaQUALIFICATION ABBREVIATION:IBNATIONAL QUALIFICATIONS FRAMEWORK LEVEL:Level 3BACKGROUND:The International Baccalaureate Diploma Programme is aninternational academic qualification administered by theInternational Baccalaureate (IB). It is a two-year academicallyrigorous pre-university programme designed, amongst a varietyof broader aims, to promote international mindedness.All students, irrespective of their particular interests, are requiredto follow six subjects in a range of disciplines. At least three andnot more than four of these must be at higher level (HL) andthree (or two if four HL courses are completed) at standard level(SL). The recommended minimum classroom contact time foreach HL is 240 hours, and for each SL, 150 hours over the twoyearperiod of the programme. The examined subjects mustinclude two languages, one subject from Individuals andsocieties, an Experimental science, Mathematics and one furtheroption. All subjects are designed to incorporate internationalperspectives. The IB has three working languages, English,French and Spanish, and almost all examination papers areavailable in each of these languages.The six subjects are bound together in a coherent form by the100-hour theory of knowledge course followed by all students,and by an extended essay which demonstrates research skills. Afurther requirement is that candidates be involved in 150 hours ofcreativity, action and service (CAS), which supports the philosophyof a holistic international education.Only an authorised IB World School that meets the IB’s standardsand practices can enter candidates for IB qualifications. TheDiploma programme is designed as a two-year course of study,although in exceptional cases a maximum of two SL subjectsmay be taken as one year courses. All HL courses, at least oneSL course and the core must be completed over two years.DATE OF FIRST AWARD:1970NUMBER OF UNITS/STRUCTURE:Candidates choose six subjects, at least three and not more thanfour at higher level and three (or two if four HL courses arecompleted) at standard level. Candidates choose theirprogrammes of six subjects by selecting one each from thefollowing six groups, Alternatively a candidate may offer, insteadof a Group 6 subject, a third modern language, a second subjectfrom Individuals and societies, a second subject fromexperimental sciences or further mathematics SL or computerscience. Students therefore study all subject areas, gaining adepth at Higher Level similar to that at A level. In most cases,standard level subjects maintain similar depth to those at Higherlevel, but with reduced course content.Group 1 – LanguageThe candidate’s best language or mother tongue; students eitherstudy Literature and Performance (interdisciplinary), a languageand literature or a literature course.Group 2 – Language A2, or Language B, or Ab initioA foreign language course for students with previous experienceof learning the language. The main focus of the programme is onlanguage but a variety of texts also forms part of the course.Classical Greek and Latin can also be studied as a group 2course.OrAb initioA foreign language learning course over two years at SL forstudents with no previous experience of learning the targetlanguage.Group 3 – Individuals and societiesBusiness and managementEconomicsEnvironmental system and societies (SL) (this is aninterdisciplinary subject and can be taken through group 3 andgroup 4)GeographyHistoryInformation technology in a globalsocietyPhilosophyPsychologySocial and cultural anthropologyGroup 4 – Experimental sciencesBiologyChemistryComputer ScienceDesign technologyEnvironmental system and societies (SL only)Environmental system and societies (SL) (interdisciplinary)PhysicsSports, exercise and health science (SL)Group 5 – mathematicsMathematics (HL)Mathematics (SL)Mathematical studies (SL)Further mathematics (HL)All students must do a course in mathematics98 <strong>UK</strong> QUALIFICATIONS
<strong>Qualifications</strong> currently offeredGroup 6 – ArtsMusicTheatreVisual artsFilmLiterature and Performance (interdisciplinary)All Diploma Programme candidates will also undertake:A) Theory of knowledge – a 100-hour course taught over twoyears, which is an interdisciplinary requirement intended tostimulate critical reflection on knowledge and issues.B) Extended essay – a substantial piece of independent researchwork about 4,000 words long. It must be written in a DiplomaPrograme subject. 50 hours.C) Creativity,action, service (CAS) – the CAS programme isprovided by the school and monitored by the IB. 50 hours.ASSESSMENT METHOD:Assessment in the IB varies widely across the disciplines andincludes multiple choice, essay, data analysis, short answer andstructured questions. In most subjects the teachers contributemore than 20% of the marks through internal assessment whichare then moderated by external examiners. Students areassessed on the whole course in final examinations held at theend of the two years. The courses are not modular. Candidatesnot completing all the requirements for a Diploma may beawarded certificates for individual subjects. Assessmentprocedures are kept constantly under review to ensure bothintegrity and quality. Their validation includes, amongst otheractivities, question paper and marking scheme review by externaladvisers, standardisation of examiners, marking, moderation,grade awarding and arbitration procedures, an enquiry uponresults service, and public reporting of statistics.EXAMINATION TIMING:May and NovemberDATE OF RESULT PUBLICATION:Early July and early JanuaryGRADING SYSTEM:Each subject is graded 1–7 (7 being the highest)The recommendation for the award of the final grade in eachsubject is normally the responsibility of the Chief Examiner. A gradewill not normally be awarded to a candidate in any subject forwhich any of the required assessment components have not beencompleted.All assessment components for each of the six subjects and theadditional Diploma requirements must be completed in order toqualify for the award of the Diploma.The Diploma will be awarded to a candidate whose total score is24, 25, 26 or 27 points, provided all the following requirementshave been met:(a) numeric grades have been awarded in all six subjectsregistered for the diploma(b) all CAS requirements have been met(c) at least a grade D has been awarded for both theory ofknowledge and the extended essay(d) there is no grade 1 in any subject(e) there is no grade 2 at HL(f) there is no more than one grade 2 at SL(g) overall, there are no more than three grades 3 or below(h) at least 12 points have been gained on HL subjects(candidates who register for four HL subjects must gain atleast 16 points at HL)(i) at least nine points have been gained on SL subjects(candidates who register for two SL subjects must gain atleast six points at SL)(j) the candidate has not been found guilty of malpractice by theIB organisation.The Diploma will be awarded to a candidate whose total score is28 points or above, provided all the following requirements havebeen met:(a) numeric grades have been awarded in all six subjectsregistered for the diploma(b) all CAS requirements have been met(c) grades A (highest) to E (lowest) have been awarded for boththeory of knowledge and an extended essay, with a grade ofat least D in one of them(d) there is no grade 1 in any subject(e) there is no more than one grade 2 at HL(f) there are no more than two grades 2 at SL(g) overall, there are no more than three grades 3 or below(h) at least 11 points have been gained on HL subjects(candidates who register for four HL subjects must gain atleast 14 points at HL)(i) at least eight points have been gained on SL subjects(candidates who register for two SL subjects must gain atleast five points at SL)(j) the candidate has not been found guilty of malpractice by theIB organisation.A maximum of three examination sessions is allowed in which tosatisfy the requirements for the award of the IB Diploma.Award of InternationalBaccalaureate CoursesA candidate who is not registered for the full Diploma mayregister for examination in one or more subjects.Such a candidate is classified as a Diploma Programme (DP)course student and receives a certificate recording the result(s)obtained in each subject. Candidates who have registered for thefull Diploma, but who have not fulfilled all the requirements forthe award, will receive a certificate indicating the results obtainedin individual DP courses. A Diploma candidate who wishes toregister for more than the six subjects required for the Diplomamay register for one or more additional subjects at HL.The IB Diploma Programme is recognised by Ofqual as anaccredited qualification. The IB is recognised by <strong>UK</strong> HEIs asfulfilling the minimum matriculation requirements for entry. The IBrecommends that institutions make offers to applicants based ona total points acquisition by the candidate. Offers to IB studentsthat are expressed in terms of gaining the Diploma and withspecific grades, usually in HL subjects, should not be made byequating IB grades to GCE A level grades. No formal equivalenceexercise has been conducted on IB higher level courses and Alevels, therefore, it is not possible to make comparisons on thebasis of any external evidence. This approach also does not takeaccount of, and give credit to, the breadth of study required in theIB Diploma Programme.The IB Diploma Programme has been awarded the following UCASTariff points.Grade UCAS Tariff points (2010 onwards)45 72044 69843 676<strong>UK</strong> QUALIFICATIONS 99
<strong>Qualifications</strong> currently offered42 65441 63240 61139 58938 56737 54536 52335 50134 47933 45732 43531 41330 39229 37028 34827 32626 30425 28224 260International Baccalaureate (IB) courses*Higher Level Standard Level Core requirements**Grade Tariff points Grade Tariff points Grade Tariff points7 130 7 70 3 1206 110 6 59 2 805 80 5 43 1 404 50 4 27 0 103 20 3 11*Points for IB courses come into effect for entry into highereducation from 2010 onwards.**Students who register for an IB Diploma but do not successfullycomplete all elements can achieve UCAS Tariff points from theirachievement in individual courses and the core requirements ofthe Diploma curriculum (extended essay, theory of knowledge(TOK) and creativity, action, service (CAS). Students who registerfor individual IB Certificates rather than the IB Diploma cannotcollect Tariff points from the core.International BaccalaureateCareer-related CertificateQUALIFICATION ABBREVIATION:IBCCNATIONAL QUALIFICATIONS FRAMEWORK LEVEL:Level 3BACKGROUND:The IBCC (International Baccalaureate Career-related Certificate)is an IB programme designed to be taken over two years, and tocomplement career-related/vocational courses. It is the school’sresponsibility to determine the appropriate careerrelated/vocationalcourse that is linked to the IBCC, and shouldbe determined by the local context and aligned with studentneeds, whether they are used to support further studies or toassist direct employment opportunities. The IB is not responsiblefor the choice and administration of the career-related/vocationalcourse offered to students; however, schools need to ensure thatthe course is recognised by local, national or internationalauthorities, and that it is usually taken over a two year period.The IBCC:ggggprovides flexibility to allow for local differencesis relevant and creativesets appropriate and achievable attainment requirementsencourages significant school and student input in thecurriculum and assessmentgprovides breadth and balance.DATE OF FIRST AWARD:May 2009NUMBER OF UNITS/STRUCTURE:The IBCC is a framework that consists of three key elements:1: Candidates choose a minimum of two IB DiplomaProgramme courses from any of the six Diploma groups, atHigher Level (HL), Standard Level (SL) or a combination ofboth.2: In addition to the Diploma courses requirements, studentsmust also complete the IBCC core which consists of aninternally assessed Approaches to Learning course andCommunity and Service programme as well as an internallyassessed and externally moderated Reflective Project.Students must also complete a language developmentcourse relevant to their needs.3: The above requirements must all be studied concurrent witha career-related course of study.ASSESSMENT METHOD:With regard to the Diploma courses, assessment in the IB varieswidely across the disciplines and includes externally assessedmultiple choice, essay, data analysis, short answer and structuredquestions. In most subjects the teachers contribute more than20% of the marks through internal assessment which is thenmoderated by external examiners. Students are assessed on thewhole course in final examinations held at the end of the twoyears. The courses are not modular. Assessment procedures arekept constantly under review to ensure both integrity and quality.Their validation includes, amongst other activities, question paperand marking scheme review by external advisers, standardisationof examiners, marking, moderation, grade awarding andarbitration procedures, an enquiry upon results service, andpublic reporting of statistics.The Approaches to Learning and Community and Servicesaspects of the IBCC are internally assessed and can take theform of either formative or summative assessment. The ReflectiveProject is internally assessed and externally moderated againstrigorous assessment criteria. In the case of the languagedevelopment course, schools can offer a wide range of provision,eg an externally assessed course or an internally assessedmodule. The requirement is that students must fulfill theminimum requirements as set out in the Guide.EXAMINATION TIMING:May and NovemberDATE OF RESULT PUBLICATION:Early July and early JanuaryGRADING SYSTEM:Each Diploma course is graded 1-7 (see the information on IBDiploma Courses above). The recommendation for the award ofthe final grade in each subject is normally the responsibility of theChief Examiner. A grade will not normally be awarded to acandidate in any subject for which any of the requiredassessment components have not been completed.The Reflective Project is marked out of 30 and graded A-E.All assessment components for the IBCC core must be completedin order to qualify for the award of the IBCC.The Career-related Certificate of the International Baccalaureateand the statement of results will be issued subject to satisfactorycompletion of the following requirements by a student.ggA level 3 or above in two Diploma courses.A level D or above in the Reflective Project.100 <strong>UK</strong> QUALIFICATIONS
<strong>Qualifications</strong> currently offeredgSatisfactory completion of the internally assessed aspects ofthe IBCC core (Language development, Community andService and Approaches to Learning).Students must also complete a concurrent course of study in arecognised career-related field of choice. This must be a level 3course for <strong>UK</strong>-based students.Where a student does not satisfy the requirements for the awardof the Career-related Certificate of the InternationalBaccalaureate, they will be eligible to receive only the statementof results.**UCAS Tariff points are currently available for the individual IBsubject components and the vocational elements of the IBCC butare not currently available for the IBCC core. However, HEIs areencouraged to consider the skills students develop on the core,including the graded Reflective Project.PROGRESSION/ARTICULATION:The IBCC prepares students for flexibility and mobility in a rangeof employment opportunities as well as continuing lifelonglearning. Employers have as an emphasis, the importance of workethic and values, maturity and responsibility, linguistic proficiencyand critical-thinking skills, as well as job-specific skills. These ‘lifeskills’ ensure adaptability in a society whereby jobs are createdand eliminated annually. Further Education institutions includinguniversities place emphasis on academic strength, curriculum fitand reading and writing skills - all of which IBCC studentsexperience during their two years of study. This blend of learningstyles ensures that multiple pathways are enabled for morestudents.International BaccalaureateMiddle Years Programme (MYP)QUALIFICATION ABBREVIATION:MYPBACKGROUND:The Middle Years Programme (MYP) offered by the InternationalBaccalaureate (IB) provides a framework of academic and lifeskills for students aged 11–16. The five-year programme followson from the IB’s Primary Years Programme and serves as apreparation for the IB’s Diploma Programme.The MYP provides a framework of concepts, skills, objectives andassessment criteria in eight subject groups and a pedagogyaimed at engaging students in disciplinary understanding byexposure to authentic connections, as well as developing theirawareness of the relationships between disciplines.The MYP is guided by the following three fundamental concepts,rooted in the IB mission statement: communication, interculturalawareness and holistic learning.The ’areas of interaction’ are at the core of the programme,providing the contexts for curriculum planning and an opportunityfor teachers’ and students’ interaction with authentic situations.Students develop an understanding of each through contributionin all subjects. They are grouped as: approaches to learning,community and service, health and social education,environments and human ingenuity. These pervade and recurthroughout the five years of the MYP, through the eight subjectgroups, and also through interdisciplinary teaching and projects,whole-school activities and the MYP personal project. The areasof interaction are not directly assessed nor awarded individualgrades, since they are perspectives rather than subjects.In the last year of the MYP, students complete the personalproject, a significant body of work, the product of the student’sown initiative and creativity. The personal project must reflect apersonal understanding of the areas of interaction and theapplication of skills acquired through approaches to learning.MYP students are expected to choose their project, which cantake many forms, and take the process to completion with thesupervision of an adult in the school. The personal project formspart of the assessment scheme of the MYP. It involves planning,research and a high degree of personal reflection.All schools are expected to develop their own written curriculumfollowing the guidelines provided by the IB and ensuring studentswill be able to meet the objectives for the final year of theprogramme. In doing so, schools may need to consider anynational or local requirements about mandated curricula, providedthe integrity of the MYP is respected at all times.The MYP subject groups:gArts – visual arts and performing artsgHumanities – studies of individuals, societies andenvironment including subjects such as history, geography,economics, politics, civics, sociology, anthropology and/orpsychologygLanguage A – student’s best language, usually the school’slanguage of instructiongLanguage B – a modern foreign language learned at schoolgMathematics – course includes the five branches ofmathematics: number, algebra, geometry and trigonometry,probability and statistics, and discrete mathematicsgPhysical Education – course includes health and fitness,individual and team sportsgSciences – biology, chemistry, physicsgTechnology – computer and design technology.MYP authorisation and programme evaluation of schools: allschools undergo an authorisation visit, following a minimum ofone year as a candidate school. Four years after authorisationand then every five years, the school receives a programmeevaluation visit, which is the culmination of a detailed self-studyprocess. The IB standards and practices provide the frameworktowards authorisation and programme evaluation.ASSESSMENTTeachers assess students’ work with guidance from IB accordingto prescribed, published criteria which state final levels ofachievement in each discipline for the final year of theprogramme. All schools must assess their students with thepublished assessment criteria in the final year. The IB alsoprovides recommended interim assessment criteria based on theobjectives for each of the subject groups for years 1 and 3 of thefive-year programme. Schools can opt for the MYP certificate,accompanied by a record of achievement issued by the IB. Theseare formal documents limited to schools that offer the last year ofthe programme and elect to have their own student assessmentvalidated by IB through a rigorous and quality assured process ofexternal moderation.The IB will issue an MYP certificate to each student who satisfiesthe following conditions. The student must:ggggbe registered, and have gained at least a grade 2 in at leastone subject per subject group of the MYP. (Please note that asecond language A may be taken instead of a language B.)have gained at least a grade 3 for the personal projecthave participated in the programme for at least the final twoyearshave met the expectations of community and service to thesatisfaction of the school<strong>UK</strong> QUALIFICATIONS 101
<strong>Qualifications</strong> currently offeredghave gained a grade total of at least 36 from the eightsubject groups and the personal project combined, out of apossible maximum of 63. (This total and the maximum willbe different in the case of the mother-tongue languageoption or if a student has gained an exemption due to specialeducational needs.) If more than one subject has beenentered in a given subject group, only the single best gradewill count towards certification, although all subject resultswill appear on the MYP record of achievement.The IB also provides all schools with a portfolio of achievementfor each student. This allows the school to document thestudent’s accomplishments at the end of the course. The portfolioincludes papers from the IB describing the programme. Theschool may add its own certificates, academic results andawards, a self-evaluation by the student, information aboutcommunity and service, the personal project and any otherachievements. Schools not applying for MYP certificates arerequired to regularly submit samples for the process ofmonitoring of assessment to ensure they comply with theassessment requirements of the programme.GENERAL GRADE DESCRIPTORSGrade 1 – Minimal achievement in terms of the objectives.Grade 2 – Very limited achievement against all the objectives.The student has difficulty in understanding the requiredknowledge and skills and is unable to apply them fully in normalsituations, even with support.Grade 3 – Limited achievement against most of the objectives, orclear difficulties in some areas. The student demonstrates alimited understanding of the required knowledge and skills and isonly able to apply them fully in normal situations with support.Grade 4 – A good general understanding of the requiredknowledge and skills, and the ability to apply them effectively innormal situations. There is occasional evidence of the skills ofanalysis, synthesis and evaluation.Grade 5 – A consistent and thorough understanding of therequired knowledge and skills, and the ability to apply them in avariety of situations. The student generally shows evidence ofanalysis, synthesis and evaluation where appropriate andoccasionally demonstrates originality and insight.Grade 6 – A consistent and thorough understanding of therequired knowledge and skills, and the ability to apply them in awide variety of situations. Consistent evidence of analysis,synthesis and evaluation is shown where appropriate. The studentgenerally demonstrates originality and insight.Grade 7 – A consistent and thorough understanding of therequired knowledge and skills, and the ability to apply themalmost faultlessly in a wide variety of situations. Consistentevidence of analysis, synthesis and evaluation is shown whereappropriate. The student consistently demonstrates originality andinsight and always produces work of high quality.International General Certificateof Secondary Education(IGCSE)/International Certificateof Education (ICE)/O Level/School CertificateThe International General Certificate of Secondary Education(IGCSE) is offered by two awarding organisations, InternationalExaminations and Edexcel. Since September 2010 a range ofIGCSE subjects have been accredited by Ofqual and receivefunding for teaching in state schools.Cambridge InternationalExaminationsBACKGROUND:Cambridge IGCSE was developed by Cambridge InternationalExaminations and introduced in 1988 primarily as a qualificationfor overseas candidates that aims to prepare students for furtheracademic success, including progression to A level and AS study.The qualification is equivalent in standard to GCSE and may beconsidered acceptable at grades A*, A, B or C in lieu of GCSE ona subject for subject basis. Cambridge IGCSE is assessed on aneight-point scale of grades: A* – G. with A* being highest.Many Cambridge IGCSE syllabuses have been approved byOfqual and are funded for teaching in state schools in Englandand Northern Ireland. When a Cambridge IGCSE is approved byOfqual, it appears on the Register of Regulated <strong>Qualifications</strong> as aCambridge International Level 1/Level 2 Certificate. This is theofficial title for all Cambridge IGCSEs approved by Ofqual.Cambridge International Level 1/Level 2 Certificates are assessedin the same way as Cambridge IGCSEs, using an eight-pointscale of grades: A*-G with A* being highest.If a student passes seven Cambridge IGCSE/Level1/Level2examinations, from particular groupings, they will qualify for theCambridge International Certificate of Education (ICE).Cambridge ICE is awarded at Distinction, Merit and Pass.Cambridge O levels continue to be taken in approximately 80countries around the world. The qualification is equivalent instandard to GCSE and may be considered acceptable at gradesA*, A, B or C in lieu of GCSE on a subject for subject basis.Passing grades at Cambridge O level are A* – E, with A* beinghighest. If a student passes six Cambridge O level examinations,from particular groupings, they will qualify for the CambridgeSchool Certificate. The Cambridge School Certificate is awardedwith First, Second and Third Divisions. Full information is availablefrom Cambridge International Examinations.Edexcel (Pearson Education Ltd)BACKGROUND:Edexcel’s International GCSE qualifications were developed inorder to provide recognition and progression opportunities forinternational students. First teaching took place in September2003. Revised specifications were developed for first teaching inSeptember 2009. The revised International GCSE qualificationsreplace legacy O levels and existing IGCSEs, incorporating thebest features of both. They aim to be modern, relevant andacademically rigorous. There is a full suite of 40 subjects. Thefollowing subjects are now also available for teaching in <strong>UK</strong> stateschools: English Language A, English Literature, Science (DoubleAward), Biology, Chemistry, Physics, Mathematics A, History,Geography, Modern Foreign Languages (Chinese, French, Germanand Spanish) These are accredited as level 1/level 2 Certificates.On successful completion of these qualifications students canchoose to further their study by taking GCE AS and A levels orother equivalent qualifications such as Edexcel BTECs or theInternational Baccalaureate.GRADING SYSTEM:The International GCSE is graded A*-G, and is considered to becomparable to GCSE on a subject for subject basis.102 <strong>UK</strong> QUALIFICATIONS
<strong>Qualifications</strong> currently offeredMalvern Literature CertificateQUALIFICATION ABBREVIATION:MLCBACKGROUND:This is Malvern College’s own English literature GCSE equivalentthat was developed in response to frustrations with the existingqualifications. The aims were to offer its students a broaderliterary experience in preparation for both A level and IB literaturecourses and to give themselves the freedom to choose from awider range of literature. This was done whilst retaining a core ofconventional literary study that would be expected to be at theheart of any literature GCSE.DATE OF FIRST TEACHING:September 2009DATE OF FIRST AWARD:August 2011PREREQUISITES:Any student considered capable of tackling GCSE English wouldbe eligible to take the Malvern Literature Certificate.NUMBER OF UNITS/STRUCTURE:Unit 1: Coursework essay on prose fictionUnit 2: Coursework essay on drama other than ShakespeareUnit 3: Coursework essay on a Shakespeare playUnit 4: Coursework essay on poetryUnit 5: Individual oral commentary on poetryUnit 6: Unseen poetry commentary examinationUnit 7: Completion of a reading and writing journal.ASSESSMENT METHOD:All work is internally marked and moderated. The assessmentcriteria have been developed in order that the demands of thecourse are at least equivalent to those of a conventional EnglishLiterature GCSE. A selection of final folders from across the markrange are externally moderated. The external moderation iscurrently done by the Head of English at another school that doesits own GCSE equivalent literature course.EXAMINATION TIMING:All work has to be completed by the end of June.DATE OF RESULT PUBLICATION:Same day as GCSE results.GRADING SYSTEM:Same as GCSE: A* to U.QUALITY ASSURANCE:The work for the examination is externally moderated.PROGRESSION/ARTICULATION:The course content is regularly assessed and reviewed. Asignificant proportion of those who took the certificate lastsummer have gone on to study English literature in the sixthform, either at A level, or at Standard or Higher level for theInternational Baccalaureate.National Vocational QualificationQUALIFICATION ABBREVIATION:NVQNATIONAL QUALIFICATIONS FRAMEWORK LEVEL:Levels 1–5 (some NVQs have not revised their levels according tothe new QCF framework.)QUALIFICATIONS AND CREDIT FRAMEWORK:Levels 1-7BACKGROUND:National Vocational <strong>Qualifications</strong> (NVQs) are work-related,competence-based qualifications. They reflect the skills andknowledge needed to do a job effectively and show that a candidateis competent in the area of work the NVQ framework represents.NVQs are based directly on the National Occupational Standards(NOS) defined by Sector Skills Councils and other recognisedStandards-Setting Bodies. These standards are statements ofperformance that describe what competent people in a particularoccupation are expected to be able to do. They cover all the mainaspects of an occupation, including current best practice, theability to adapt to future requirements and the knowledge andunderstanding that underpin competent performance. NVQsassess occupational competence against the requirements of theNOS. Assessment is mainly through performance in the workplace,but may also include oral and written questioning, according towhatever is most appropriate to demonstrate that the individualcan perform the task to the required standard. NVQs are nowavailable for almost all occupations in the <strong>UK</strong>. NVQs must includean element of assessment which is demonstrably independent ofanyone who may have a vested interest in the outcome.Since December 2010, most NVQs have been replaced byqualifications which are accredited within the <strong>Qualifications</strong> andCredit Framework (QCF). The QCF regulations state that the term‘NVQ’ can be used in the title of QCF qualifications to helpindicate that assessment was competency based. Some SectorSkills Councils are retaining the word ‘NVQ’ in the titles of thesenew QCF qualifications, but others are not.For more details on NVQs, visit www.direct.gov.uk/en/educationandlearningDetails of the titles and constituent units of all accredited NVQscan be found in the Register of Regulated <strong>Qualifications</strong>(http:register.ofqual.gov.uk).The NQF and QCF establish parity of esteem between NVQs,regardless of which awarding organisation awards them.Applicants to HE with NVQs as main entry qualifications are likelyto offer NVQ at level 3. These applicants should be judged ontheir merits alongside those with qualifications such as GCE Aand AS level. Such applicants are likely to offer, in particular:gggggga high level of technical competence in their specialist areaspractical experience of work and the associated maturityhigh skills levelsportfolios of evidenceability to assimilate knowledge and apply it in practicea high level of self-reliance.A large number of candidates already in the workplace will havegained NVQs. These qualifications may therefore be useful insupplying accreditation of achievement, which would otherwiseneed to be judged through the Accreditation of Prior ExperientialLearning.NVQs also often form part of the content of Apprenticeships.DATE OF FIRST AWARD:1992NUMBER OF UNITS/STRUCTURE:All NVQs are unit-based and allow candidates to accumulate unitcertification until the complete NVQ award is achieved. Each unitis written in the form of outcomes describing what a candidatemust be able to do, know and understand, and the context inwhich the assessment should take place.ASSESSMENT METHOD:Competence-based assessment, mainly within the workplace.<strong>UK</strong> QUALIFICATIONS 103
<strong>Qualifications</strong> currently offeredAssessment of NVQs is independent of any learning involved orthe time taken.GRADING SYSTEM:As NVQs define competence, candidates are either ‘competent’or ‘not yet competent’ to perform at the required level. They aretherefore generally graded Pass/Fail.The AAT level 3 NVQ in Accounting (NQF) (now the AAT level 3Diploma in Accounting (QCF)) carries UCAS Tariff points asfollows:Grade UCAS Tariff pointsPass 160QUALITY ASSURANCE:Internal and external verification.PROGRESSION/ARTICULATION:Single units may be certificated.NCC EducationNCC Education is a global provider of British higher educationand a recognised <strong>UK</strong> awarding body. NCC Education has beenproviding programmes in Business and IT, ranging fromfoundation to master’s level since 1966. Today students are ableto study for qualifications at one of over 200 Accredited PartnerCentres, either in their home country or in the <strong>UK</strong>. NCC Educationstudents can benefit from face-to-face teaching and more than1,000,000 have boosted their careers with NCC Educationprogrammes.NCC Education is accredited by Ofqual in England to awarddiplomas in the computing and business fields within the<strong>Qualifications</strong> and Credit Framework (QCF) at levels equivalent tofoundation, undergraduate and postgraduate qualifications in theuniversity system.NCC Education provides programmes which are designed tomaximise students potential, by equipping them with the requiredskills and knowledge to pursue further academic study or enter acareer of their choice.NCC Education InternationalFoundation YearQUALIFICATION ABBREVIATION:IFYNATIONAL QUALIFICATIONS FRAMEWORK LEVEL:Level 3BACKGROUND:A one-year programme for speakers of English as a foreignlanguage who are seeking entrance to a university bachelor’sprogramme or the NCC Education level 4 Diplomas in Business,Computing or Business IT. The programme covers Englishlanguage, study skills, mathematical technique, culture studiesand introduces students to the world of business IT.PREREQUISITES:Students must have successfully completed secondary educationin an appropriate range of subjects and have a valid score of 4.5or above in the International English Language Testing System(IELTS), or the required minimum result in the Standard EnglishLanguage Placement Test (SEPT).DATE OF FIRST TEACHING:2005NUMBER OF UNITS/STRUCTURE:The programme consists of the following six compulsorymodules: Developing English Language Skills, Advanced EnglishLanguage Skills, English for Academic Purposes, Study Skills,Culture Studies, Foundation Mathematics. A further two modulesare chosen from the following four electives: Introduction toComputing, Introduction to Programming, Introduction toBusiness, Introduction to Accounting and Economics.Students must pass all eight modules to be awarded thequalification.ASSESSMENT METHODS:Assessed by assignment and examinationEXAMINATION TIMING:January, April, June, SeptemberGRADING SYSTEM:Pass, Merit or Distinction (percentage marks available for eachmodule)PROGRESSION/ARTICULATION:Students can continue their NCC Education International Degreejourney with the level 4 Diploma in Business, level 4 Diploma inBusiness IT or level 4 Diploma in Computing.Alternatively students can apply to over 40 universities whichaccept NCC Education IFT graduates onto the first year of theirdegree programmes.For more details consult the NCC Education website:www.nccedu.com.NCC Education Level 3 Diplomain BusinessQUALIFICATION ABBREVIATION:L3DBBACKGROUND:An introduction to business which equips students with thenecessary skills for entry to NCC Education’s level 4 Diploma inBusiness programme. The level 3 Diploma in Business (L3DB)provides students with a broad but secure foundation in thefundamental concepts of business, effective and practical IT skillsand the essential study skills necessary to succeed atundergraduate level.PREREQUISITES:Students must be able to demonstrate that they have previouslystudied English at secondary school level, or have a valid score of5.5 or above in the International English Language TestingSystem (IELTS).DATE OF FIRST TEACHING:2009NUMBER OF UNITS/STRUCTURE:The programme consists of five compulsory modules as follows:Study and Communication Skills, Mathematical Techniques, ITSkills, Introduction to Business, Introduction to Accounting andEconomics. Students must pass all five compulsory modules tobe awarded the qualification.ASSESSMENT METHODS:Assessed by assignment and examination.EXAMINATION TIMING:December, March, June, September.GRADING SYSTEM:Pass, Merit or Distinction.104 <strong>UK</strong> QUALIFICATIONS
<strong>Qualifications</strong> currently offeredPROGRESSION/ARTICULATION:Successful graduates will be eligible for entry onto the NCCEducation level 4 Diploma in Business or Business ITprogrammes.NCC Education Level 3 Diplomain ComputingQUALIFICATION ABBREVIATION:L3DSBACKGROUND:An introduction to computing which provides students with abroad but secure foundation in the fundamental concepts ofcomputing and the essential study skills needed to succeed atundergraduate level. Students will be introduced to programmingand mathematical techniques which will assist them in theirunderstanding of computing and their future studies.PREREQUISITES:Students must be able to demonstrate that they have previouslystudied English at secondary school or have a valid score of 5.5or above in the International English Language Testing System(IELTS).DATE OF FIRST TEACHING:2012NUMBER OF UNITS/STRUCTURE:The programme consists of the following five compulsorymodules: Study and Communication Skills, MathematicalTechniques, IT Skills, Introduction to Computing and Introductionto Programming. Students must pass all five modules to beawarded the qualification.ASSESSMENT METHODS:Assessed by assignment and examination.EXAMINATION TIMING:December, March, June, September.GRADING SYSTEM:Pass, Merit or Distinction.PROGRESSION/ARTICULATION:The programme allows progression to the NCC Education level 4Diploma in Computing or Business IT programmes.For more details consult the NCC Education website:www.nccedu.comNCC Education Level 4 Diplomain Computing (QCF)QUALIFICATION ABBREVIATION:L4DCBACKGROUND:A one-year, classroom-based academic programme, whichequips students fundamental skills and knowledge in computing.Upon completion of the programme students will be competent inthe development, testing and maintenance of software anddatabase systems. The programme is aimed at students seekingundergraduate entry onto the NCC Education International DegreeJourney in computing or those wishing to progress to study atuniversities with which NCC Education has articulationagreements. Alternatively, the programme helps those who arelooking to improve their career prospects or gain employmentwithin the IT sector.PREREQUISITESOn entry you must have one of the following:gNCC Education International Foundation Year (IFY) or level 3Diploma in Computer Studies (L3DCS) qualificationorgorgorgA local or international qualification deemed to be of a similarlevel to the IFY or L3DCS programmes. These shall beagreed in advance with NCC EducationAt least one A level pass or 80 points on the UCAS Tariff forrelevant qualificationsMature students need to demonstrate over two yearsrelevant work experience and also hold an O level/GCSEEnglish and mathematics or equivalent.Applicants who are not NCC Education graduates or whose firstlanguage is not English need to obtain a valid score of 5.5 orabove in the International English Language Testing System(IELTS) examination or equivalent.DATE OF FIRST TEACHING:2011NUMBER OF UNITS/STRUCTURE:The programme consists of a total of eight core modules: skillsfor Computing, Computer Networks, Computer Systems,Designing and Developing a Website, Databases, Designing andDeveloping Object-oriented Computer Programmes, SoftwareDevelopment Techniques, Office Solutions Development. Studentsmust pass all eight modules to be awarded the qualification.ASSESSMENT METHODS:Assessed by assignment and examinationEXAMINATION TIMING:March, June, September, DecemberGRADING SYSTEM:Pass, Merit or Distinction.PROGRESSION/ARTICULATION:Upon successful completion, students can use the qualification tosecure employment in the IT sector, or continue their studies onto the level 5 Diploma in Computing (L5DC).Alternatively students can apply to one of the universities whichaccept NCC Education graduates onto the second year of theirdegree programmes.For more details consult the NCC Education website:www.nccedu.comNCC Education Level 4 Diplomain Business InformationTechnology (QCF)QUALIFICATION ABBREVIATION:L4DBITBACKGROUND:A one-year, classroom-based academic programme, whichprovides students with a comprehensive understanding ofcomputing, communication and business skills. Upon completionof the programme students will be able to demonstrate a clearunderstanding of computing systems. Students will also gain asolid foundation and breadth of knowledge in business.<strong>UK</strong> QUALIFICATIONS 105
<strong>Qualifications</strong> currently offeredThe programme is aimed at students seeking undergraduateentry onto the NCC Education International Degree Journey inBusiness IT or those wishing to progress to study at universitieswith which NCC Education has articulation agreements.Alternatively, the programme helps those who are looking toimprove their career prospects or gain employment within the ITsector.PREREQUISITESOn entry you must have one of the following:gNCC Education International Foundation Year (IFY), level 3Diploma in Computer Studies (L3DCS) or level 3 Diploma inBusiness (L3DB) qualification.gA local or international qualification deemed to be of a similarlevel to the IFY, L3DCS or L3DB programme. These shall beagreed in advance with NCC Education.gAt least one A level pass or 80 points on the UCAS Tariff forrelevant qualifications.gMature students need to demonstrate over two years’relevant work experience and also hold an O level/GCSEEnglish and mathematics or equivalent.Applicants who are not NCC Education graduates, or whose firstlanguage is not English, will need to obtain a valid score of 5.5 orabove in the International English Language Testing System(IELTS) examination or equivalent.DATE OF FIRST TEACHING:2011NUMBER OF UNITS/STRUCTURE:The programme consists of a total of eight core modules: Skillsfor Computing, Computer Networks, Computer Systems,Designing and Developing a Website, Databases, eBusiness,Essentials of Management, Understanding BusinessOrganisations.Students must pass all eight modules to be awarded thequalification.ASSESSMENT METHODS:Assessed by assignment and examination.EXAMINATION TIMING:December, March, June, September.GRADING SYSTEM:Pass, Merit or Distinction.PROGRESSION/ARTICULATION:Upon successful completion, students can use the qualification tosecure employment in the IT sector or continue their studies onto the level 5 Diploma in Business IT (L5DBIT)Alternatively students can apply to one of the universities whichaccept NCC Education graduates onto the second year of theirdegree programmes.For more details consult the NCC Education website:www.nccedu.comNCC Education Level 4 Diplomain Business (QCF)QUALIFICATION ABBREVIATION:L4DBBACKGROUND:A one-year, classroom-based academic programme, whichprovides students with a broad introduction to the many aspectsof international business in today’s world. Upon completion of theprogramme students will be able to demonstrate a clearunderstanding of business principles and concepts. Students willalso gain a solid foundation and breadth of knowledge inbusiness management, economics and eBusiness.The programme is aimed at students seeking undergraduateentry onto the NCC Education International Degree Journey inBusiness, or those wishing to progress to study at universitieswith which NCC Education has articulation agreements.Alternatively, the programme helps those who are looking toimprove their career prospects or gain employment within theBusiness sector.PREREQUISITES:On entry you must have one of the following:gNCC Education International Foundation Year (IFY) or level 3Diploma in Business (L3DB) qualification.gA local or international qualification deemed to be of a similarlevel to the IFY or L3DB programme. These shall be agreedin advance with NCC Education.gAt least one A level pass or 80 points on the UCAS Tariff forrelevant qualifications.gMature students need to demonstrate over two years’relevant work experience and also hold an O level/GCSEEnglish and mathematics or equivalent.Applicants who are not NCC Education graduates, or whose firstlanguage is not English, will need to obtain a valid score of 5.5 orabove in the International English Language Testing System(IELTS) examination or equivalent.DATE OF FIRST TEACHING:2004NUMBER OF UNITS/STRUCTURE:The programme consists of a total of eight core modules:Essentials of Management, Fundamentals of Economics,Communications for Business, Understanding BusinessOrganisations, Business Mathematics, Introduction to Finance,eBusiness, Principals of Marketing. Students must pass all eightmodules to be awarded the qualification.ASSESSMENT METHODS:Assessed by either examination or assignment.EXAMINATION TIMING:March, June, September, DecemberGRADING SYSTEM:Pass, Merit or Distinction.PROGRESSION/ARTICULATION:Upon successful completion, students can use the qualification tosecure employment in the business sector or continue theirstudies on to the level 5 Diploma in Business (L5DB).Alternatively students can apply to one of the universities whichaccept NCC Education graduates onto the second year of theirdegree programmes.For more details consult the NCC Education website:www.nccedu.comNCC Education Level 5 Diplomain Computing (QCF)QUALIFICATION ABBREVIATION:L5DC106 <strong>UK</strong> QUALIFICATIONS
<strong>Qualifications</strong> currently offeredBACKGROUND:A one-year, classroom-based academic programme, which equipsstudents with a critical understanding of the established principlesof computing. Students will develop new skills relevant to the ITindustry and build upon the knowledge gained from the L4DC.The programme is aimed at students seeking to progress to thesecond year of a three-year NCC Education International DegreeJourney in Computing, or those wishing to progress to study atuniversities with which NCC Education has articulation agreements.Alternatively, the programme helps those who are looking to improvetheir career prospects or gain employment within the IT sector.PREREQUISITES:On entry you must have one of the following:ggNCC Education level 4 Diploma in Computing (L4DC)A local or international qualification which is deemed to be ofa similar level to the NCC Education Level 4 Diploma inComputing programme. This must be agreed in advance withNCC Education.Applicants who are not NCC Education graduates, or whose firstlanguage is not English, will need to obtain a valid score of 5.5 orabove in the International English Language Testing System(IELTS) examination or equivalent.DATE OF FIRST TEACHING:2011NUMBER OF UNITS/STRUCTURE:The programme consists of a total of eight core modules:Professional Issues in IT, Network Security and Cryptography,Information Systems Analysis, Dynamic Websites, Analysis,Design and Implementation, Database Development and Design,Agile Development, Computing Project.Students must pass all eight modules to be awarded the qualification.ASSESSMENT METHODS:Assessed by assignments and examinationEXAMINATION TIMING:March, June, September and DecemberGRADING SYSTEM:Pass, Merit or Distinction.PROGRESSION/ARTICULATION:The qualification allows entry to either NCC Education’s final yeartop-up programme in IT (further entry requirements may apply).Students can apply to the final year of a degree programme atone of the universities which accept NCC Education graduates onto the third year of their degree programmes.For more details consult the NCC Education website:www.nccedu.comNCC Education Level 5 Diplomain Business IT (QCF)QUALIFICATION ABBREVIATION:L5DBITBACKGROUND:A one-year, classroom-based academic programme, which equipsstudents with a critical understanding of the established principlesof computing relevant to the IT and business industry. Students willdevelop new skills relevant to the IT industry and build upon theknowledge gained from the L4DBIT.The programme is aimed at students seeking to progress to thesecond year of a three-year NCC Education International DegreeJourney in Business IT, or those wishing to progress to study atuniversities with which NCC Education has articulation agreements.Alternatively, the programme helps those who are looking toimprove their career prospects or gain employment within the ITsector.PREREQUISITES:On entry you must have one of the following:ggNCC Education level 4 Diploma in Business IT (L4DBIT)A local or international qualification which is deemed to be ofa similar level to the NCC Education level 4 Diploma inBusiness IT programme. This must be agreed in advancewith NCC Education.Applicants who are not NCC Education graduates, or whose firstlanguage is not English, will need to obtain a valid score of 5.5 orabove in the International English Language Testing System(IELTS) examination or equivalent.DATE OF FIRST TEACHING:2011NUMBER OF UNITS/STRUCTURE:The programme consists of a total of eight core modules:Professional Issues in IT, Information Systems Analysis, DynamicWebsites, Database Development and Design, Business ITProject, Information Systems and Organisations, Principles ofBusiness Operations, Office Solutions Development.ASSESSMENT METHODS:Assessed by assignment and examination.EXAMINATION TIMING:December, March, June, September.GRADING SYSTEM:Pass, Merit or Distinction.PROGRESSION/ARTICULATION:The qualification allows entry to either NCC Education’s final yeartop-up programme in Business IT (further entry requirements mayapply).Students can apply to the final year of a degree programme atone of the universities which accept NCC Education graduatesonto the third year of their degree programmes.For more details consult the NCC Education website:www.nccedu.comNCC Education Level 5 Diplomain Business (QCF)QUALIFICATION ABBREVIATION:L5DBBACKGROUND:A one-year, classroom-based academic programme, which equipsstudents with a critical understanding of the established principlesof business and management. Students develop new skills relevantto the business industry and build upon the knowledge gained fromthe L4DB.The programme is aimed at students seeking to progress to thesecond year of a three-year NCC Education International DegreeJourney in Business, or those wishing to progress to study atuniversities with which NCC Education has articulation agreements.Alternatively, the programme helps those who are looking toimprove their career prospects or gain employment within thebusiness sector.<strong>UK</strong> QUALIFICATIONS 107
<strong>Qualifications</strong> currently offeredPREREQUISITES:On entry you must have one of the following:ggNCC Education level 4 Diploma in Business (L4DB).A local or international qualification which is deemed to be ofa similar level to the NCC Education level 4 Diploma inBusiness programme. This must be agreed in advance withNCC Education.Applicants who are not NCC Education graduates, or whose firstlanguage is not English, will need to obtain a valid score of 5.5 orabove in the International English Language Testing System(IELTS) examination or equivalent.DATE OF FIRST TEACHING:2004NUMBER OF UNITS/STRUCTURE:The programme consists of eight core modules: BusinessEconomics, Advanced Business Mathematics, Marketing inBusiness, Human Resources in Business, UnderstandingConsumer Behaviour, Principles of Business Operations, FinancialManagement, Information Systems and Organisations.Students must pass all eight modules to be awarded thequalification.ASSESSMENT METHODS:Assessed by assignment and examination.EXAMINATION TIMING:December, March, June, September.GRADING SYSTEM:Pass, Merit or Distinction.PROGRESSION/ARTICULATION:The qualification allows entry to either NCC Education’s final yeartop-up programme in Business (further entry requirements mayapply).Students can apply to the final year of a degree programme atone of the universities which accept NCC Education graduatesonto the third year of their degree programmes.For more details consult the NCC Education website:www.nccedu.comPre-Master’s in BusinessQUALIFICATION ABBREVIATION:PMBBACKGROUND:This programme is designed to enable students to quickly bridgethe gap between their existing qualifications and a master'sprogramme. Students will upgrade their English language ability toa level suitable for master's entrance, while also being introducedto studying business subjects through the medium of English.PREREQUISITES:If applicants hold a non-honours degree or Chinese Da Zhuan (orequivalent) in a relevant subject, they can enter the Pre-Master’sin Business directly. Applicants who hold a full honours degreecan take a shorter version of the programme: Master’sPreparation in Business.Students must also have a minimum English language level ofIELTS 5.0 (or equivalent). Applicants holding higher IELTS scoresmay also be eligible for exemptions from programme modules,meaning they can complete the programme more quickly.DATE OF FIRST TEACHING:2010NUMBER OF UNITS/STRUCTURE:Pre-Master’s in Business: English Language Level 4, English LanguageLevel 5, English for Academic Purposes 1 and 2, Developing StudySkills for Postgraduate Learning, Finance and Accounting, GlobalMarketing Strategies and Strategic Business Management.Master’s Preparation in Business: English Language Level 4,English Language Level 5, English for Academic Purposes 1 and2, Developing Study Skills for Postgraduate Learning and one ofthe three business modules.ASSESSMENT METHODS:Assessed by assignment and examination.EXAMINATION TIMING:December, March, June, September.GRADING SYSTEM:Pass, Merit or Distinction (percentage marks available for eachmodule).PROGRESSION/ARTICULATION:Students can continue their NCC Education Postgraduate DegreeJourney with the Level 7 Diploma in Business Management.Alternatively students can apply to one of the universities whichaccept NCC Education Pre- Master’s in Business graduates ontotheir master’s degree programmes.For more details consult the NCC Education website:www.nccedu.comPre-Master’s in ITQUALIFICATION ABBREVIATION:PMITBACKGROUND:This programme is designed to enable students to quickly bridgethe gap between their existing qualifications and a master’sprogramme. Students will upgrade their English language ability toa level suitable for master's entrance, while also being introducedto studying IT subjects through the medium of English.PREREQUISITES:If applicants hold a non-honours degree or Chinese Da Zhuan (orequivalent) in a relevant subject, they can enter the Pre Master’sin IT directly. Applicants who hold a full honours degree can takea shorter version of the programme: Master’s Preparation in IT.Students must also have a minimum English language level ofIELTS 5.0 (or equivalent). Applications holding higher IELTS scoresmay also be eligible for exemptions from programme modules,meaning they can complete the programme more quickly.DATE OF FIRST TEACHING:2010NUMBER OF UNITS/STRUCTURE:Pre-Master’s in IT: English Language Level 4, English LanguageLevel 5, English for Academic Purposes 1 and 2, Developing StudySkills for Postgraduate Learning, Databases, Object-OrientedModelling, Strategic Business Management.Master’s Preparation in IT: English Language Level 4, EnglishLanguage Level 5, English for Academic Purposes 1 and 2,Developing Study Skills for Postgraduate Learning and one of thethree IT modules.ASSESSMENT METHODS:Assessed by assignment and examination.GRADING SYSTEM:Pass, Merit or Distinction (Percentage marks available for eachmodule).108 <strong>UK</strong> QUALIFICATIONS
<strong>Qualifications</strong> currently offeredPROGRESSION/ARTICULATION:Students can continue their NCC Education Postgraduate DegreeJourney with the Level 7 Postgraduate Diploma in StrategicBusiness IT.Alternatively students can apply to one of the universities whichaccept NCC Education Pre- Master’s in Business graduates ontotheir master’s degree programmes.For more details consult the NCC Education website:www.nccedu.comNCC Education Level 7 Diplomain Business Management (QCF)QUALIFICATION ABBREVIATION:L7DBMBACKGROUND:The Level 7 Diploma in Business Management is designed todevelop a student’s career in management. The programmecovers a wide range of contemporary issues and develops thecritical, analytical and technical skills needed for seniormanagement positions. The programme will also develop theacademic skills required for further study at master’s level.PREREQUISITES:On entry you must have one of the following:ggAn honours degree from a <strong>UK</strong> university (minimum 2:2) inany subject, or equivalent award from a non-<strong>UK</strong> universityThree years’ work experience at a managerial level withsignificant responsibility for resources (staff, financial,physical etc or a combination of these). Prospective studentsmust be able to demonstrate that these responsibilities weresignificant and that they had a high level of autonomy.A decision on entry to the programme through a workexperience route will be made by NCC Education.All applicants who do not hold a degree-level qualification whollytaught and examined in English must also hold an IELTS score ofat least 6.5 (or equivalent).DATE OF FIRST TEACHING:2009NUMBER OF UNITS/STRUCTURE:The programme consists of eight core modules as follows:Information and Knowledge Management, International MarketingStrategy, Management, Control and Accountability for FinancialResources, Managing People in Organisations, ResearchMethods, Study Skills for Postgraduate Learning, StrategicManagement and Strategic Operations Management. Studentsmust pass all modules to be awarded the qualification.ASSESSMENT METHODS:Assessed by assignment and examinationEXAMINATION TIMING:December, JuneGRADING SYSTEM:Pass, Merit or DistinctionPROGRESSION/ARTICULATION:NCC Education also works in conjunction with a number of <strong>UK</strong>universities, to deliver MBA and MSc programmes for PgDBMgraduates. For more information please visit www.nccedu.com.NCC Education Level 7 Diplomain Strategic Business IT (QCF)QUALIFICATION ABBREVIATION:L7PgDSBITBACKGROUND:The Level 7 Postgraduate Diploma in Strategic Business IT isdesigned for IT and computing graduates or practitioners whowith to further develop their career. The programme covers awide range of contemporary issues and develops the critical,analytical and technical skills needed for senior positions in theIT industry. The course also develops the academic skills requiredfor further study at master’s level.PREREQUISITES:On entry you must have one of the following:ggg<strong>UK</strong> bachelor’s degree with honours (or equivalent) inInformation Technology, Computer Science, or related subject.<strong>UK</strong> bachelor’s degree with honours in a non-IT-relatedsubject (or equivalent) and three+ years of work experiencein an IT environment, with significant technical or managerialresponsibility.Five+ years of work experience in an IT environment, withsignificant technical or managerial responsibility and theability to demonstrate suitability for academic study, bypersonal or telephone interview with the course co-ordinatorat your Accredited Partner Centre.All applicants who do not hold a degree-level qualification whollytaught and examined in English must also hold an IELTS score ofat least 6.5 (or equivalent).DATE OF FIRST TEACHING:2001NUMBER OF UNITS/STRUCTURE:The programme consists of four core modules as follows:Research in Information Technology, Enterprise Software andBusiness Infrastructure, Strategic Information Systems Analysisand Project Management. Students must pass all four modules tobe awarded the qualification.ASSESSMENT METHODS:Assessed by assignment and examinationEXAMINATION TIMING:December, March, June, SeptemberGRADING SYSTEM:Pass, Merit or DistinctionPROGRESSION/ARTICULATION:NCC Education also works in conjunction with a number of <strong>UK</strong>universities, to deliver MSc programmes for PgDSBIT graduates.For more information please visit www.nccedu.com.NCFENCFE qualifications and awards are offered by centres throughoutthe <strong>UK</strong>, including further education colleges, adult educationcentres, private training providers, schools and businesses.NCFE works primarily with adult learners within further educationcolleges, although it strives to promote its qualifications to awider audience.NCFE offers qualifications in the following eight sector areas:ggArt, media and publishingBusiness, administration and law<strong>UK</strong> QUALIFICATIONS 109
<strong>Qualifications</strong> currently offeredggggggEducation and trainingEngineering and manufacturing technologiesHealth, public services and careLeisure, travel and tourismPreparation for life and workRetail and commercial enterprise.NCFE offers qualifications and awards at eight levels: Entry leveland levels 1–7. NCFE’s level 3 qualifications are listed below.gAward in Assessing Competence in the Work EnvironmentgAward in Assessing Vocationally Related AchievementgAward in Counselling Skills and TheorygAward in Employability SkillsgAward in Employment and Personal Learning Skills in HealthgAward in Externally Assuring the Quality of AssessmentProcesses and PracticegAward in the Internal Quality Assurance of AssessmentProcesses and PracticegAward in IT User Skills (ITQ)gAward in Job Search and Interview SkillsgAward in Learning to Learn for Higher Level StudiesgAward in Managing DiversitygAward in Practical Supervision of Food Safety in CateringgAward in Preparing to Teach in the Lifelong Learning Sector(PTLLS)gAward in Supporting Teaching and Learning in SchoolsgAward in Understanding the External Quality Assurance ofAssessment Processes and PracticegAward in Understanding the Internal Quality Assurance ofAssessment Processes and PracticegAward in Understanding the Principles and Practices ofAssessmentgCertificate in Art and DesigngCertificate in Assessing Vocational AchievementgCertificate in Contact Centre OperationsgCertificate in Cover Supervision of Pupils in SchoolsgCertificate in Creative CraftgCertificate in Early Years Foundation Stage PracticegCertificate in Employability SkillsgCertificate in IT User Skills (ITQ)gCertificate in Interactive MediagCertificate in Leading the External Quality Assurance ofAssessment Processes and PracticegCertificate in Leading the Internal Quality Assurance ofAssessment Processes and PracticegCertificate in Leisure ManagementgCertificate in Logistics Operations (600/0729/1)gCertificate in ManagementgCertificate in Personal TraininggCertificate in Preparing to Work in Adult Social CaregCertificate in Principles of Business and AdministrationgCertificate in Principles of Customer ServicegCertificate in the Principles of End of Life CaregCertificate in Retail KnowledgegCertificate in Retail Skills (Management)gCertificate in Retail Skills (Sales Professional)gCertificate in Retail Skills (Visual Merchandising)gCertificate in Travel ServicesgCertificate in Stroke Care ManagementgCertificate in Supporting Teaching and Learning in SchoolsgCertificate in Teaching in the Lifelong Learning SectorgCertificate in Working in End of Life CaregCertificate in Working in the Health SectorgDiploma in Business for the Creative IndustriesgDiploma in Clinical Healthcare SupportgDiploma in Counselling SkillsgDiploma in Health and Social Care (Adults) for EnglandgDiploma in IT User Skills (Apprenticeship version)gDiploma in IT User Skills (ITQ)gDiploma in Specialist Support for Teaching and Learning inSchoolsgDiploma for Entry to the Uniformed Services (501/1307/0)gDiploma for the Children and Young People’s WorkforcegDiploma in Healthcare Support ServicesgDiploma in Managing a Music Business EnterprisegDiploma in Outdoor LearninggDiploma in Radio (501/0262/X)gDiploma in Retail Skills (Management)gDiploma in Retail Skills (Sales Professional)gDiploma in Retail Skills (Visual Merchandising)gKey SkillsgNVQ Certificate in Advice and GuidancegNVQ Certificate in Business and AdministrationgNVQ Certificate in Spectator SafetygNVQ Diploma in Business and AdministrationgNVQ Diploma in Contact Centre OperationsgNVQ Diploma in Custodial Care (600/0247/5) – new QCFversion for Jan 2011gNVQ Diploma in Customer ServicegNVQ Diploma in Leisure ManagementgNVQ Diploma in Outdoor ProgrammesgNVQ Diploma in Personal TraininggNVQ Diploma in Travel ServicesgNVQ in Food Manufacture (various pathways (500/7996/7)gNVQ Certificate in ManagementgNVQ Certificate in Occupational Health and SafetygNVQ Certificate in Witness Care (600/1047/2)NCFE Certificate in Art and DesignQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 3BACKGROUND:Aims to develop advanced level skills and techniques in art anddesign.DATE OF FIRST TEACHING:2010NUMBER OF UNITS/STRUCTURE:Three mandatory units.ASSESSMENT METHOD:Internally assessed and externally moderated portfolio.GRADING SYSTEM:Pass mark for portfolio 100%. Portfolio norm referenced.Qualification is not graded.QUALITY ASSURANCE:Internal and external moderation of portfolio.PROGRESSION/ARTICULATION:Level 3 Creative Craft qualifications; Level 3 Certificate inInteractive Media; level 3 NVQs in Design, Arts and Culture;Foundation Degrees in Art and Design.NCFE Certificate in Creative CraftQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 3BACKGROUND:Provides learners with an opportunity to extend their knowledgeof the creative craft process to an advanced level.DATE OF FIRST TEACHING:2009110 <strong>UK</strong> QUALIFICATIONS
<strong>Qualifications</strong> currently offeredNUMBER OF UNITS/STRUCTURE:Three mandatory unitsASSESSMENT METHOD:Internally assessed and externally moderated portfolio.GRADING SYSTEM:Pass mark for portfolio 100%. Portfolio norm referenced.Qualification is not graded.QUALITY ASSURANCE:Internally assessed and externally moderated portfolio.PROGRESSION/ARTICULATION:Level 3 Certificate in Art and Design; Level 3 Certificate inInteractive Media; NVQs in craft-related subjects; level 3 HigherProfessional Diploma in Creative Arts.NCFE Certificate in InteractiveMediaQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 3BACKGROUND:For those interested in developing interactive media skills at anadvanced level, extending candidates’ knowledge of processesand principles and enabling progression into further educationand training.DATE OF FIRST TEACHING:2010NUMBER OF UNITS/STRUCTURE:Four mandatory units plus one optional unit.ASSESSMENT METHOD:Internally assessed and externally moderated portfolio.GRADING SYSTEM:Pass mark for portfolio is 100%. Portfolio norm referenced.Qualification is not graded.QUALITY ASSURANCE:Internally assessed and externally moderated portfolio.PROGRESSION/ARTICULATION:Level 3 Certificate in Art and Design; Level 3 Certificate inCreative Craft; NVQs in craft-related subjects; level 4 HigherProfessional Diploma in Creative Arts; level 5 Higher ProfessionalDiploma in Creative Arts.NCFE Certificate in PersonalTrainingQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 3BACKGROUND:An ideal qualification for those in the exercise and fitness sectorwho wish to complement their existing skills. The qualificationaims to provide learners with the understanding and practicalskills needed to work as a personal trainer in a variety of settings.This includes understanding health and safety in a fitnessenvironment, customer service, anatomy and physiology, personaltraining programmes and sessions, and nutrition.DATE OF FIRST TEACHING:2010PREREQUISITES:No specific prior learning required. Minimum entry age 16.NUMBER OF UNITS/STRUCTURE:Seven mandatory units.ASSESSMENT METHOD:Internally assessed and externally moderated portfolio.GRADING SYSTEM:Pass mark for portfolio is 100%. Portfolio norm referenced.Qualification is not graded.QUALITY ASSURANCE:Internally assessed and externally moderated portfolio.PROGRESSION/ARTICULATION:Level 3 NVQ in Instructing Physical Exercise and Nutrition; Level3 Certificate in Fitness Management; Level 3 Award in AdaptingPhysical Activity for Antenatal and Postnatal Clients; any otherLevel 3 qualification in the Health and Fitness Industry; Level 4Higher Professional Diploma in Sport and RecreationManagement; Level 4 HNC Diploma in Sport; Level 5 HNDDiploma in Sport and Exercise Sciences.NCFE Award in Counselling Skillsand TheoryQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 3BACKGROUND:Introduces learners to the use of counselling skills in everyday lifeand work, and some of the approaches that underpin the use ofthese skills.DATE OF FIRST TEACHING:2009PREREQUISITES:No specific prior learning required. Minimum entry age 16.NUMBER OF UNITS/STRUCTURE:Four mandatory unitsASSESSMENT METHOD:Internally assessed and externally moderated portfolio plus anassignment.GRADING SYSTEM:Pass mark for portfolio is 100%. Portfolio norm referenced.Qualification is not gradedQUALITY ASSURANCE:Internally assessed and externally moderated portfolio.PROGRESSION/ARTICULATION:gLevel 3 Certificates in Workplace MentoringgLevel 3 and 4 NVQs in Advice and GuidancegLevel 3 and 4 qualifications in CounsellinggFoundation Degrees in, for example, Health and Social Care,Addictions Counselling, Care, Counselling and Working withYoung PeopleNCFE Diploma in CounsellingSkillsQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 3BACKGROUND:Provides learners with more in-depth knowledge of the use ofcounselling skills in everyday life and work and the approachesthat underpin the use of these skills.<strong>UK</strong> QUALIFICATIONS 111
<strong>Qualifications</strong> currently offeredDATE OF FIRST TEACHING:2011PREREQUISITES:No specific prior learning required. Minimum entry age 16.NUMBER OF UNITS/STRUCTUREFive mandatory unitsASSESSMENT METHOD:Internally assessed and externally moderated portfolioGRADING SYSTEM:Pass mark for portfolio is 100%. Portfolio norm referenced.Qualification is not gradedQUALITY ASSURANCE:Internally assessed and externally moderated portfolio.PROGRESSION/ARTICULATIONLevel 3 NVQ Certificate in Advice and GuidanceLevel 4 NVQ Diploma in Advice and GuidanceLevel 2 or 3 Diplomas in Health and Social Care (Adults) for EnglandNCFE Award in EmployabilitySkillsQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 3BACKGROUND:This qualification has been designed to allow learners to furtherdevelop and demonstrate a broad range of essential skills. Theseinclude job search techniques, personal preparation for employmentand improvement in skills required for the working environment.DATE OF FIRST TEACHING:2009PREREQUISITES:No specific prior learning required. Minimum entry age 16.NUMBER OF UNITS/STRUCTURE:Two mandatory units plus two optional units.ASSESSMENT METHOD:Internally assessed and externally moderated portfolio.GRADING SYSTEM:Pass mark for portfolio is 100%. Portfolio norm referenced.Qualification is not graded.QUALITY ASSURANCE:Internally assessed and externally moderated portfolio.PROGRESSION/ARTICULATION:gLevel 4 Key SkillsgLevel 3 or 4 vocational qualificationsNCFE Award in Job Search andInterview SkillsQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 3DATE OF FIRST TEACHING:2012PREREQUISITES:No specific prior learning required. Minimum entry age 16.NUMBER OF UNITS/STRUCTURE:Two mandatory units.ASSESSMENT METHOD:Internally assessed and externally moderated portfolio.GRADING SYSTEM:Pass mark for portfolio is 100%. Portfolio norm referenced.Qualification is not graded.QUALITY ASSURANCE:Internally assessed and externally moderated portfolio.PROGRESSION/ARTICULATION:NCFE level 3 Award and Certificate in Employability SkillsNCFE level 3 Award in Managing Diversity.NCFE Award in Learning to Learnfor Higher Level StudiesQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 3DATE OF FIRST TEACHING:2011PREREQUISITES:No specific prior learning required. Minimum entry age 16.NUMBER OF UNITS/STRUCTURE:One mandatory unit.ASSESSMENT METHOD:Internally assessed and externally moderated portfolio.GRADING SYSTEM:Pass mark for portfolio is 100%. Portfolio norm referenced.Qualification is not graded.QUALITY ASSURANCE:Internally assessed and externally moderated portfolio.PROGRESSION/ARTICULATION:A higher level study course in any sector.NCFE Award in ManagingDiversityQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 3BACKGROUND:This qualification aims to increase understanding of equality anddiversity concepts; and increase awareness of how these issuesimpact upon organisational processes, management and deliveryindividual and organisational diversity experiences, skills andpracticesDATE OF FIRST TEACHING:2010PREREQUISITES:No specific prior learning required. Minimum entry age 16.NUMBER OF UNITS/STRUCTURE:Three mandatory unitsASSESSMENT METHOD:Internally assessed and externally moderated portfolio.GRADING SYSTEM:Pass mark for portfolio is 100%. Portfolio norm referenced.Qualification is not graded.QUALITY ASSURANCE:Internally assessed and externally moderated portfolio.112 <strong>UK</strong> QUALIFICATIONS
<strong>Qualifications</strong> currently offeredPROGRESSION/ARTICULATION:gLevel 3 Certificate in Personnel PracticegLevel 3 Introductory Certificate in ManagementgLevel 3 National Diploma in Public ServicesgLevel 3 NVQ in Personnel SupportgLevel 3 NVQ in Police Supervisory ManagementgLevel 3 NVQ in Leisure ManagementgLevel 3 NVQ in Youth WorkNCFE Award in PracticalSupervision of Food Safety inCateringQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 3BACKGROUND:Aimed at owners and/or managers of independent cateringoutlets or managers in catering establishments which are part ofa chain and who have responsibility for maintaining food safetywithin the workplace.DATE OF FIRST TEACHING:2009NUMBER OF UNITS/STRUCTURE:One mandatory unitASSESSMENT METHOD:Internally assessed and externally moderated portfolioGRADING SYSTEM:Pass mark for portfolio is 100%. Portfolio norm referenced.Qualification is not gradedQUALITY ASSURANCE:Internally assessed and externally moderated portfolio.PROGRESSION/ARTICULATION:gLevel 3 Award in Food Safety Supervision for RetailgLevel 3 Certificate in Health and Safety in the WorkplacegLevel 3 National Diploma in HospitalitygLevel 3 Certificate in Food and Beverage ServicegLevel 3 NVQ in Food Service Advanced CraftgLevel 4 Award in Managing Food Safety in Catering.NCFE Award in Preparing toTeach in the Lifelong LearningSectorQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 3BACKGROUND:This programme is appropriate for all new entrants to teaching inthe lifelong sector, or for those who are required to work towardsachieving a recognised teaching status.DATE OF FIRST TEACHING:2011PREREQUISITES:Level 3 qualification or equivalent in their own area of specialism.Minimum entry age 19.NUMBER OF UNITS/STRUCTURE:One mandatory unit and seven optional unitsASSESSMENT METHOD:Internally assessed and externally moderated portfolio.GRADING SYSTEM:Pass mark for portfolio is 100%. Portfolio norm referenced.Qualification is not graded.QUALITY ASSURANCE:Internally assessed and externally moderated portfolio whichincludes a micro teaching session.PROGRESSION/ARTICULATION:Level 3 or 4 Certificate in Teaching in the Lifelong LearningSectorNCFE Certificate in EmployabilitySkillsQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 3BACKGROUND:This qualification has been designed to allow learners to furtherdevelop and demonstrate a broad range of essential skills. Theseinclude job search techniques, personal preparation foremployment and improvement in skills required for the workingenvironment.DATE OF FIRST TEACHING:2009PREREQUISITES:No specific prior learning required. Minimum entry age 16NUMBER OF UNITS/STRUCTURE:Three mandatory units plus seven optional unitsASSESSMENT METHOD:Internally assessed and externally moderated portfolio.GRADING SYSTEM:Pass mark for portfolio is 100%. Portfolio norm referenced.Qualification is not graded.QUALITY ASSURANCE:Internally assessed and externally moderated portfolioPROGRESSION/ARTICULATION:gLevel 4 Key SkillsgLevel 3 or 4 vocational qualifications.NCFE Certificate in PalliativeCareNATIONAL QUALIFICATIONS FRAMEWORK LEVEL:Level 3BACKGROUND:Aims to give those working in health care settings increasedknowledge and understanding of the issues related to palliativecare. It raises awareness of the range of needs a person mayhave and how they and their families/friends can be supported.DATE OF FIRST TEACHING:2007PREREQUISITES:No specific prior learning required. Minimum entry age 18.NUMBER OF UNITS/STRUCTURE:Four mandatory units.ASSESSMENT METHOD:Internally assessed and externally moderated portfolio.GRADING SYSTEM:Pass mark for portfolio is 100%. Portfolio norm referenced.<strong>UK</strong> QUALIFICATIONS 113
<strong>Qualifications</strong> currently offeredQualification is not graded.QUALITY ASSURANCE:Internally assessed and externally moderated portfolio.PROGRESSION/ARTICULATION:Level 2 NVQ in Health, level 3 NVQ in Health, level 3 NVQ inHealth and Social Care, level 3 Certificates in Health and/or SocialCare, Level 2 Certificate in Safe Handling of Medicines, Level 2Award in the Prevention and Control of Infection, Level 2Certificate in Dementia Awareness.NCFE Certificate in Working inthe Health SectorQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 3BACKGROUND:This qualification aims to give learners the opportunity toinvestigate a work role in the health sector and to provide theunderpinning knowledge needed to work effectively.DATE OF FIRST TEACHING:2009PREREQUISITES:No specific prior learning required. Minimum entry age 16.NUMBER OF UNITS/STRUCTURE:Six mandatory units.ASSESSMENT METHOD:Internally assessed and externally moderated portfolio.GRADING SYSTEM:Pass mark for portfolio is 100%. Portfolio norm referenced.Qualification is not graded.QUALITY ASSURANCE:Internally assessed and externally moderated portfolio.PROGRESSION/ARTICULATION:NVQ Level 3 in Health; NVQ Level 3 in Health and Social Care;Level 2 and 3 Diplomas in Society, Health and Development;Level 3 qualifications in Health; Level 3 qualifications in Healthand Social Care; a wide range of role/subject specificqualifications, eg Prevention and Control of Infection, DementiaAwareness, Moving and Handling, Mental Health etc.NCFE Certificate in SupportingTeaching and Learning inSchoolsQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 3BACKGROUND:This programme aims to enable learners to understand the rolesand responsibilities of those involved in supporting teaching andlearning in schools, and provides an opportunity to develop the skillsand knowledge required to do this effectively and in a self-directedway. It prepares learners to support the teacher and the delivery ofthe curriculum within a school, as well as developing skills to helpchildren and young people to develop self-esteem, independenceand skills for learning. It seeks to further develop professional andtechnical skills and knowledge, and an understanding of theimportance of positive relationships within a school.DATE OF FIRST TEACHING:2010PREREQUISITES:No specific prior learning required. Minimum entry age 16.NUMBER OF UNITS/STRUCTURE:Eleven mandatory unitsASSESSMENT METHOD:Internally assessed and externally moderated portfolio.GRADING SYSTEM:Pass mark for portfolio is 100%. Portfolio norm referenced.Qualification is not graded.QUALITY ASSURANCE:Internally assessed and externally moderated portfolio.PROGRESSION/ARTICULATION:Provides progression to the NVQ in Supporting Teaching andLearning in Schools and also provides progression intoemployment. Learners may also progress to achieve HLTA status.NCFE NVQ in Advice andGuidanceNATIONAL QUALIFICATIONS FRAMEWORK LEVEL:Level 3BACKGROUND:This qualification aims to provide recognition and accreditation foradvice and guidance practitioners working in a wide range ofcontexts. It is primarily aimed at practitioners working directlywith clients, providing advice and some level of guidance, andwho are working with information that is often interpreted byothers, and within some clear guidelines.DATE OF FIRST TEACHING:2008PREREQUISITES:No specific prior learning required. Minimum entry age 16.NUMBER OF UNITS/STRUCTURE:Three mandatory units plus three optional units.ASSESSMENT METHOD:Internally and externally verified portfolio.GRADING SYSTEM:Pass mark for portfolio is 100%. Portfolio norm referenced.Qualification is not graded.QUALITY ASSURANCE:Internally and externally verified portfolio.PROGRESSION/ARTICULATION:Further qualifications at NVQ Level 4 or HE in the same or relatedoccupational areas.NCFE NVQ Diploma in CustodialCare (new QCF version forJanuary 2011)QUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 3DATE OF FIRST TEACHING:2011PREREQUISITES:No specific prior learning required. Minimum entry age 18.NUMBER OF UNITS/STRUCTURE:Five mandatory units plus at least five optional units.114 <strong>UK</strong> QUALIFICATIONS
<strong>Qualifications</strong> currently offeredASSESSMENT METHOD:Internally and externally verified portfolio.GRADING SYSTEM:Pass mark for portfolio is 100%. Portfolio norm referenced.Qualification is not graded.QUALITY ASSURANCE:Internally and externally verified portfolio.PROGRESSION/ARTICULATION:gLevel 3 NVQ in Witness CaregLevel 3 and 4 NVQs in Community JusticegLevel 3 NVQ in PolicinggLevel 4 NVQ in PolicingNCFE Award in Preparing toTeach in the Lifelong LearningSectorQUALIFICATIONS FRAMEWORK LEVEL:Level 4DATE OF FIRST TEACHING:2011PREREQUISITES:Teaching Practice requirement. Minimum entry age 19.NUMBER OF UNITS/STRUCTURE:Ten optional units.ASSESSMENT METHOD:Internally assessed and externally moderated portfolio.GRADING SYSTEM:Pass mark for portfolio is 100%. Portfolio norm referenced.Qualification is not graded.QUALITY ASSURANCE:Internally assessed and externally moderated portfolio.PROGRESSION/ARTICULATION:Level 3 or 4 Certificate in Preparing to Teach in the LifelongLearning Sector if the student is working towards AssociateTeaching and Learning Status (ATLS) or the Level 5 Diploma inTeaching in the Lifelong Learning Sector if the student is in thefull teaching role and working towards the Qualified Teaching andLearning Status (QTLS).NCFE Certificate in Early YearsFoundation Stage PracticeQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 3BACKGROUND:This qualification has been designed to update practitioners onthe requirements of the Early Years Foundation Stage, and willsupport them through its implementation. It is appropriate forthose who work face-to-face with children from birth to five yearsin regulated settings in England. It is designed to build on theexisting learning and experience held by practitioners and thegood practice taking place in early years settings.DATE OF FIRST TEACHING:2009PREREQUISITES:No specific prior learning required. Minimum entry age 16.NUMBER OF UNITS/STRUCTURE:Three mandatory unitsASSESSMENT METHOD:Internally assessed and externally moderated portfolio.GRADING SYSTEM:Pass mark for portfolio is 100%. Portfolio norm referenced.Qualification is not graded.QUALITY ASSURANCE:Internally assessed and externally moderated portfolio.PROGRESSION/ARTICULATION:Level 3 or 4 NVQ in Children's Care, Learning and DevelopmentLevel 4 or 5 Early Years Foundation DegreeNCFE NVQ in Food ManufactureNATIONAL QUALIFICATIONS FRAMEWORK LEVEL:Level 3BACKGROUND:This qualification forms part of the Advanced Apprenticeship inFood Manufacturing.DATE OF FIRST TEACHING:2010PREREQUISITES:No specific prior learning required. Minimum entry age 16.NUMBER OF UNITS/STRUCTURE:One mandatory unit plus seven optional units.ASSESSMENT METHOD:Internally and externally verified portfolio.GRADING SYSTEM:Pass mark for portfolio is 100%. Portfolio norm referenced.Qualification is not graded.QUALITY ASSURANCE:Internally and externally verified portfolio.PROGRESSION/ARTICULATION:Team Leading and Management VRQ and NVQs.NCFE NVQ in Health and SocialCareNATIONAL QUALIFICATIONS FRAMEWORK LEVEL:Level 3BACKGROUND:This qualification provides recognition and accreditation for thoseworking in the health and social care sector whose roles involvethe provision of care and support to children, young people andadults in a range of contexts. This includes both within protectedenvironments such as private care homes as well as inindividual’s own houses.DATE OF FIRST TEACHING:2008PREREQUISITES:No specific prior learning required. Minimum entry age 16.NUMBER OF UNITS/STRUCTURE:Four mandatory units plus four optional units.ASSESSMENT METHOD:Internally and externally verified portfolio.<strong>UK</strong> QUALIFICATIONS 115
<strong>Qualifications</strong> currently offeredGRADING SYSTEM:Pass mark for portfolio is 100%. Portfolio norm referenced.Qualification is not graded.QUALITY ASSURANCE:Internally and externally verified portfolio.PROGRESSION/ARTICULATION:Level 4 NVQ in Health and Social CareLevel 3 NVQ in ManagementLevel 4 NVQ in ManagementLevel 4 NVQ in Leadership and Management in Care ServicesNCFE Certificate in LogisticsOperations (new QCF version for2011)QUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 3BACKGROUND:This qualification has been designed for those working in andlooking for progression from qualifications such as Level 2 NVQin Warehousing and Storage.DATE OF FIRST TEACHING:2011PREREQUISITES:No specific prior learning required. Minimum entry age 16.NUMBER OF UNITS/STRUCTURE:Three mandatory units plus five optional units.ASSESSMENT METHOD:Internally and externally verified portfolio.GRADING SYSTEM:Pass mark for portfolio is 100%. Portfolio norm referenced.Qualification is not graded.QUALITY ASSURANCE:Internally and externally verified portfolio.PROGRESSION/ARTICULATION:Management qualifications.NCFE NVQ in OccupationalHealth and SafetyNATIONAL QUALIFICATIONS FRAMEWORK LEVEL:Level 3BACKGROUND:This NVQ is ideal for those working in the area of occupationalhealth and safety. The qualification aims to provide recognition forpractitioners who meet the national standards in their work.DATE OF FIRST TEACHING:2009PREREQUISITES:No specific prior learning required. Minimum entry age 16NUMBER OF UNITS/STRUCTURE:Five mandatory units plus two optional units.ASSESSMENT METHOD:Internally and externally verified portfolio.QUALITY ASSURANCE:Internally and externally verified portfolio.PROGRESSION/ARTICULATION:Level 4 in the same or related areas of study.NCFE NVQ Certificate in WitnessCare (new QCF version for 2011)QUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 3DATE OF FIRST TEACHING:2011PREREQUISITES:No specific prior learning required. Minimum entry age 18.NUMBER OF UNITS/STRUCTURE:Four mandatory units plus three optional units.ASSESSMENT METHOD:Internally and externally verified portfolio.GRADING SYSTEM:Pass mark for portfolio is 100%. Portfolio norm referenced.Qualification is not graded.QUALITY ASSURANCE:Internally and externally verified portfolio.PROGRESSION/ARTICULATION:gLevel 3 NVQ in Community JusticegLevel 4 NVQ in Community JusticegLevel 3 NVQ in ManagementgLevel 4 NVQ in ManagementgLevel 3 NVQ in PolicinggLevel 4 NVQ in Policing.NCFE Certificate in Principles ofBusiness and AdministrationQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 3DATE OF FIRST TEACHING:2010PREREQUISITES:No specific prior learning required.NUMBER OF UNITS/STRUCTURE:Four mandatory units plus one optional unit.ASSESSMENT METHOD:Internally and externally verified portfolio.GRADING SYSTEM:Pass mark for portfolio is 100%. Portfolio norm referenced.Qualification is not graded.QUALITY ASSURANCE:Internally and externally verified portfolio.PROGRESSION/ARTICULATION:gLevel 3 NVQ suite in Business and AdministrationgLevel 4 NVQ suite in Business and AdministrationgLevel 3 NVQ Diploma in Customer ServiceGRADING SYSTEM:Pass mark for portfolio is 100%. Portfolio norm referenced.Qualification is not graded.116 <strong>UK</strong> QUALIFICATIONS
<strong>Qualifications</strong> currently offeredNCFE NVQ Certificate inManagementQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 3DATE OF FIRST TEACHING:2010PREREQUISITES:No specific prior learning required.NUMBER OF UNITS/STRUCTURE:Three mandatory units plus 11 credits from the optional units.ASSESSMENT METHOD:Internally and externally verified portfolio.GRADING SYSTEM:Pass mark for portfolio is 100%. Portfolio norm referenced.Qualification is not graded.QUALITY ASSURANCE:Internally and externally verified portfolio.PROGRESSION/ARTICULATION:gLevel 5 Diploma in ManagementgLevel 7 Diploma in ManagementNCFE NVQ Diploma in Businessand AdministrationQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 3DATE OF FIRST TEACHING:2010PREREQUISITES:No specific prior learning required. Minimum entry age 16.NUMBER OF UNITS/STRUCTURE:Four mandatory units plus a minimum of 14 credits from groupB, optional units and a maximum of 13 credits from group C,additional units.ASSESSMENT METHOD:Internally and externally verified portfolio.GRADING SYSTEM:Pass mark for portfolio is 100%. Portfolio norm referenced.Qualification is not graded.QUALITY ASSURANCE:Internally and externally verified portfolio.PROGRESSION/ARTICULATION:gLevel 3 NVQ in Customer ServicegLevel 3 NVQ in ManagementgLevel 4 NVQs in Business and AdministrationNCFE NVQ Certificate inBusiness and AdministrationQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 3DATE OF FIRST TEACHING:2010PREREQUISITES:No specific prior learning required. Minimum entry age 16.NUMBER OF UNITS/STRUCTURE:Four mandatory units plus a minimum of 11 credits from groupB, optional units and a maximum of six credits from group C,additional units.ASSESSMENT METHOD:Internally and externally verified portfolio.GRADING SYSTEM:Pass mark for portfolio is 100%. Portfolio norm referenced.Qualification is not graded.QUALITY ASSURANCE:Internally and externally verified portfolio.PROGRESSION/ARTICULATION:gLevel 3 NVQ Diploma in Business and AdministrationNCFE NVQ Diploma in CustomerServiceQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 3DATE OF FIRST TEACHING:2010PREREQUISITES:No specific prior learning required. Minimum entry age 16.NUMBER OF UNITS/STRUCTURE:Two mandatory units plus a further 30 credits to be achieved bycompleting a minimum of one unit from each Optional Group.ASSESSMENT METHOD:Internally and externally verified portfolio.GRADING SYSTEM:Pass mark for portfolio is 100%. Portfolio norm referenced.Qualification is not graded.QUALITY ASSURANCE:Internally and externally verified portfolio.PROGRESSION/ARTICULATION:gLevel 4 NVQ in Customer ServicegLevel 4 NVQ Certificate or Diploma in Business andAdministrationgLevel 3 NVQ in ManagementNCFE Award in Understandingthe Principles and Practices ofAssessmentQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 3DATE OF FIRST TEACHING:2010PREREQUISITES:No specific prior learning required. Minimum entry age 19.NUMBER OF UNITS/STRUCTURE:One mandatory unitASSESSMENT METHOD:Internally and externally verified portfolio.GRADING SYSTEM:Pass mark for portfolio is 100%. Portfolio norm referenced.Qualification is not graded.<strong>UK</strong> QUALIFICATIONS 117
<strong>Qualifications</strong> currently offeredQUALITY ASSURANCE:Internally and externally verified portfolio.PROGRESSION/ARTICULATION:gLevel 3 Award in Assessing Competence in the WorkEnvironmentgLevel 3 Award and Certificate in Assessing VocationallyRelated AchievementgLevel 4 Award in Understanding the Internal QualityAssurance of Assessment Processes and PracticegLevel 4 Award in the Internal Quality Assurance ofAssessment Processes and PracticegLevel 4 Certificate in Leading the Internal Quality Assuranceof Assessment Processes and PracticegLevel 4 Award in Understanding the External QualityAssurance of Assessment Processes and PracticegLevel 4 Award in Externally Assuring the Quality ofAssessment Processes and PracticegLevel 4 Certificate in Leading the External Quality Assuranceof Assessment Processes and PracticeNCFE Award in AssessingCompetence in the WorkEnvironmentQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 3DATE OF FIRST TEACHING:2010PREREQUISITES:No specific prior learning required. Minimum entry age 19.NUMBER OF UNITS/STRUCTURE:Two mandatory units.ASSESSMENT METHOD:Internally and externally verified portfolio.GRADING SYSTEM:Pass mark for portfolio is 100%. Portfolio norm referenced.Qualification is not graded.QUALITY ASSURANCE:Internally and externally verified portfolio.PROGRESSION/ARTICULATION:gLevel 3 Award and Certificate in Assessing VocationallyRelated AchievementgLevel 4 Award in Understanding the Internal QualityAssurance of Assessment Processes and PracticegLevel 4 Award in the Internal Quality Assurance ofAssessment Processes and PracticegLevel 4 Certificate in Leading the Internal Quality Assuranceof Assessment Processes and PracticegLevel 4 Award in Understanding the External QualityAssurance of Assessment Processes and PracticegLevel 4 Award in Externally Assuring the Quality ofAssessment Processes and PracticegLevel 4 Certificate in Leading the External Quality Assuranceof Assessment Processes and PracticeNCFE Award in AssessingVocationally RelatedAchievementQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 3DATE OF FIRST TEACHING:2010PREREQUISITES:No specific prior learning required. Minimum entry age 19.NUMBER OF UNITS/STRUCTURE:Two mandatory units.ASSESSMENT METHOD:Internally and externally verified portfolio.GRADING SYSTEM:Pass mark for portfolio is 100%. Portfolio norm referenced.Qualification is not graded.QUALITY ASSURANCE:Internally and externally verified portfolio.PROGRESSION/ARTICULATION:gLevel 3 Award in Assessing Competence in the WorkEnvironmentgLevel 4 Award in Understanding the Internal QualityAssurance of Assessment Processes and PracticegLevel 4 Award in the Internal Quality Assurance ofAssessment Processes and PracticegLevel 4 Certificate in Leading the Internal Quality Assuranceof Assessment Processes and PracticegLevel 4 Award in Understanding the External QualityAssurance of Assessment Processes and PracticegLevel 4 Award in Externally Assuring the Quality ofAssessment Processes and PracticegLevel 4 Certificate in Leading the External Quality Assuranceof Assessment Processes and PracticeNCFE Certificate in AssessingVocational AchievementQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 3DATE OF FIRST TEACHING:2010PREREQUISITES:No specific prior learning required. Minimum entry age 19.NUMBER OF UNITS/STRUCTURE:Three mandatory units.ASSESSMENT METHOD:Internally and externally verified portfolio.GRADING SYSTEM:Pass mark for portfolio is 100%. Portfolio norm referenced.Qualification is not graded.QUALITY ASSURANCE:Internally and externally verified portfolio.PROGRESSION/ARTICULATION:gLevel 4 Award in Understanding the Internal QualityAssurance of Assessment Processes and PracticegLevel 4 Award in the Internal Quality Assurance ofAssessment Processes and PracticegLevel 4 Certificate in Leading the Internal Quality Assuranceof Assessment Processes and PracticegLevel 4 Award in Understanding the External QualityAssurance of Assessment Processes and PracticegLevel 4 Award in Externally Assuring the Quality ofAssessment Processes and PracticegLevel 4 Certificate in Leading the External Quality Assuranceof Assessment Processes and Practice118 <strong>UK</strong> QUALIFICATIONS
<strong>Qualifications</strong> currently offeredNCFE Diploma for the Childrenand Young People’s WorkforceQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 3DATE OF FIRST TEACHING:2010PREREQUISITES:No specific prior learning required. Minimum entry age 16NUMBER OF UNITS/STRUCTURE:Learners must gain a minimum of 65 credits to achieve the Level3 Diploma for the Children and Young People’s Workforce.To do this they must achieve 27 credits from mandatory Group A.Learners must select one mandatory pathway from Groups C, Dor E.Learners selecting Group C (Early Learning and Childcare) mustachieve 22 credits. Learners selecting Group D (Social Care) mustachieve 13 credits. Learners selecting Group E (Learning,Development and Support Services) must achieve 13 credits. Theremaining credits must be achieved from Group F.ASSESSMENT METHOD:Internally and externally verified portfolio.GRADING SYSTEM:Pass mark for portfolio is 100%. Portfolio norm referenced.Qualification is not graded.QUALITY ASSURANCE:Internally and externally verified portfolio.PROGRESSION/ARTICULATION:It is anticipated that learners selecting Group B (Early Learningand Childcare) will progress to relevant Foundation/HonoursDegrees.NCFE Award in Understandingthe Internal Quality Assurance ofAssessment Processes andPracticeQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 4DATE OF FIRST TEACHING:2010PREREQUISITES:No specific prior learning required. Minimum entry age 19.NUMBER OF UNITS/STRUCTURE:One mandatory unit.ASSESSMENT METHOD:Internally and externally verified portfolio.GRADING SYSTEM:Pass mark for portfolio is 100%. Portfolio norm referenced.Qualification is not graded.QUALITY ASSURANCE:Internally and externally verified portfolio.PROGRESSION/ARTICULATION:gLevel 4 Award in the Internal Quality Assurance ofAssessment Processes and PracticegLevel 4 Certificate in Leading the Internal Quality Assuranceof Assessment Processes and PracticegggLevel 4 Award in Understanding the External QualityAssurance of Assessment Processes and PracticeLevel 4 Award in Externally Assuring the Quality ofAssessment Processes and PracticeLevel 4 Certificate in Leading the External Quality Assuranceof Assessment Processes and PracticeNCFE Award in the InternalQuality Assurance of AssessmentProcesses and PracticeQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 4DATE OF FIRST TEACHING:2010PREREQUISITES:No specific prior learning required. Minimum entry age 19.NUMBER OF UNITS/STRUCTURE:Two mandatory unitsASSESSMENT METHOD:Internally and externally verified portfolio.GRADING SYSTEM:Pass mark for portfolio is 100%. Portfolio norm referenced.Qualification is not graded.QUALITY ASSURANCE:Internally and externally verified portfolio.PROGRESSION/ARTICULATION:gLevel 4 Certificate in Leading the Internal Quality Assuranceof Assessment Processes and PracticegLevel 4 Award in Understanding the External QualityAssurance of Assessment Processes and PracticegLevel 4 Award in Externally Assuring the Quality ofAssessment Processes and PracticegLevel 4 Certificate in Leading the External Quality Assuranceof Assessment Processes and PracticeNCFE Certificate in Leading theInternal Quality Assurance ofAssessment Processes andPracticeQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 4DATE OF FIRST TEACHING:2010PREREQUISITES:No specific prior learning required. Minimum entry age 19.NUMBER OF UNITS/STRUCTURE:Three mandatory unitsASSESSMENT METHOD:Internally and externally verified portfolio.GRADING SYSTEM:Pass mark for portfolio is 100%. Portfolio norm referenced.Qualification is not graded.QUALITY ASSURANCE:Internally and externally verified portfolio.<strong>UK</strong> QUALIFICATIONS 119
<strong>Qualifications</strong> currently offeredPROGRESSION/ARTICULATION:gLevel 4 Award in Understanding the External QualityAssurance of Assessment Processes and PracticegLevel 4 Award in Externally Assuring the Quality ofAssessment Processes and PracticegLevel 4 Certificate in Leading the External Quality Assuranceof Assessment Processes and PracticeNCFE Award in Understandingthe External Quality Assurance ofAssessment Processes andPracticeQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 4DATE OF FIRST TEACHING:2010PREREQUISITES:No specific prior learning required. Minimum entry age 19.NUMBER OF UNITS/STRUCTURE:One mandatory unitASSESSMENT METHOD:Internally and externally verified portfolio.GRADING SYSTEM:Pass mark for portfolio is 100%. Portfolio norm referenced.Qualification is not graded.QUALITY ASSURANCE:Internally and externally verified portfolio.PROGRESSION/ARTICULATION:gLevel 4 Award in Externally Assuring the Quality ofAssessment Processes and PracticegLevel 4 Certificate in Leading the External Quality Assuranceof Assessment Processes and PracticeNCFE Award in ExternallyAssuring the Quality ofAssessment Processes andPracticeQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 4DATE OF FIRST TEACHING:2010PREREQUISITES:No specific prior learning required. Minimum entry age 19.NUMBER OF UNITS/STRUCTURE:Two mandatory units.ASSESSMENT METHOD:Internally and externally verified portfolio.GRADING SYSTEM:Pass mark for portfolio is 100%. Portfolio norm referenced.Qualification is not graded.QUALITY ASSURANCE:Internally and externally verified portfolio.PROGRESSION/ARTICULATION:Level 4 Certificate in Leading the External Quality Assurance ofAssessment Processes and PracticeNCFE Certificate in Leading theExternal Quality Assurance ofAssessment Processes andPracticeQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 4DATE OF FIRST TEACHING:2010PREREQUISITES:No specific prior learning required. Minimum entry age 19.NUMBER OF UNITS/STRUCTURE:Three mandatory units.ASSESSMENT METHOD:Internally and externally verified portfolio.GRADING SYSTEM:Pass mark for portfolio is 100%. Portfolio norm referenced.Qualification is not graded.QUALITY ASSURANCE:Internally and externally verified portfolio.PROGRESSION/ARTICULATION:Learners who have completed the NCFE Level 4 Certificate inLeading the External Quality Assurance of Assessment Processesand Practice may progress to further learning by undertaking aLevel 4 qualification in a related discipline.NCFE Diploma for Entry to theUniformed ServicesQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 3DATE OF FIRST TEACHING:2010PREREQUISITES:No specific prior learning required. Minimum entry age 16.NUMBER OF UNITS/STRUCTURE:Five mandatory units, three optional unitsASSESSMENT METHOD:Internally and externally verified portfolio.GRADING SYSTEM:Pass mark for portfolio is 100%. Portfolio norm referenced.Qualification is not graded.QUALITY ASSURANCE:Internally and externally verified portfolio.PROGRESSION/ARTICULATION:Learners who achieve this qualification could progress to:gggNCFE Level 3 Certificate in Professional Development for theOutdoor IndustryNCFE Level 3 Certificate in Personal Effectiveness at WorkFurther qualifications within the Public Services sectorNCFE Diploma in Managing aMusic Business EnterpriseQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 3DATE OF FIRST TEACHING:2010120 <strong>UK</strong> QUALIFICATIONS
<strong>Qualifications</strong> currently offeredPREREQUISITES:No specific prior learning required. Minimum entry age 16.ASSESSMENT METHOD:Internally and externally verified portfolio.GRADING SYSTEM:Pass mark for portfolio is 100%. Portfolio norm referenced.Qualification is not graded.QUALITY ASSURANCE:Internally and externally verified portfolio.PROGRESSION/ARTICULATION:Learners who achieve this qualification could progress to:gghigher or further educationemployment.NCFE Diploma in RadioProductionQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 3DATE OF FIRST TEACHING:2010PREREQUISITES:No specific prior learning required. Minimum entry age 16.ASSESSMENT METHOD:Internally and externally verified portfolio.GRADING SYSTEM:Pass mark for portfolio is 100%. Portfolio norm referenced.Qualification is not graded.QUALITY ASSURANCE:Internally and externally verified portfolio.PROGRESSION/ARTICULATION:Learners who achieve this qualification could progress toemployment in the radio industry.NCFE Diploma in HealthcareSupport ServicesQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 3DATE OF FIRST TEACHING:2011PREREQUISITES:No specific prior learning required. Minimum entry age 16.ASSESSMENT METHOD:Internally and externally verified portfolio.GRADING SYSTEM:Pass mark for portfolio is 100%. Portfolio norm referenced.Qualification is not graded.QUALITY ASSURANCE:Internally and externally verified portfolio.PROGRESSION/ARTICULATION:Learners who achieve this qualification could progress to:ggggNCFE level 3 Diploma in Clinical Healthcare Support ServicesLevel 3 Award in Managing DiversityLevel 4 NVQ Certificate in Business and AdministrationLevel 4 NVQ Diploma in Customer Service.NCFE Award in Employment andPersonal Learning Skills in HealthQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 3DATE OF FIRST TEACHING:2011PREREQUISITES:No specific prior learning required. Minimum entry age 16.ASSESSMENT METHOD:Internally and externally verified portfolio.GRADING SYSTEM:Pass mark for portfolio is 100%. Portfolio norm referenced.Qualification is not graded.QUALITY ASSURANCE:Internally and externally verified portfolio.PROGRESSION/ARTICULATION:Learners who achieve this qualification could progress to:gggFull Apprenticeship framework for Healthcare Support andClinical Healthcare Support at level 3NCFE level 3 Diploma in Healthcare Support ServicesNCFE level 3 Diploma in Clinical Healthcare Support.Certificate in Stroke CareManagementQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 3DATE OF FIRST TEACHING:2012PREREQUISITES:No specific prior learning required. Minimum entry age 16.ASSESSMENT METHOD:Internally and externally verified portfolio.GRADING SYSTEM:Pass mark for portfolio is 100%. Portfolio norm referenced.Qualification is not graded.QUALITY ASSURANCE:Internally and externally verified portfolio.PROGRESSION/ARTICULATION:Learners who achieve this qualification could progress to:ggggNCFE level 3 Certificate for Working in the Health SectorNCFE level 3 Diploma in Health and Social Care (Adults) forEnglandNCFE level 3 Diploma in Healthcare Support ServicesNCFE level 3 Diploma in Clinical Healthcare Support.NCFE Certificate in Working inEnd of Life CareQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 3DATE OF FIRST TEACHING:2012PREREQUISITES:No specific prior learning required. Minimum entry age 16.<strong>UK</strong> QUALIFICATIONS 121
<strong>Qualifications</strong> currently offeredASSESSMENT METHOD:Internally and externally verified portfolio.GRADING SYSTEM:Pass mark for portfolio is 100%. Portfolio norm referenced.Qualification is not graded.QUALITY ASSURANCE:Internally and externally verified portfolio.PROGRESSION/ARTICULATION:Learners who achieve this qualification could progress to:ggggNCFE level 3 Certificate for Working in the Health SectorNCFE level 3 Certificate in Preparing to Work in Adult SocialCareNCFE level 3 Certificate in Healthcare Support ServicesNCFE level 3 Award in Employment and Personal LearningSkills in Health.NCFE Award in IT User Skills(ITQ)QUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 3DATE OF FIRST TEACHING:2011PREREQUISITES:No specific prior learning required. There is no minimum entryage for this qualification.NUMBER OF UNITS/STRUCTURE:77 optional unitsASSESSMENT METHOD:Internally and externally verified portfolio.GRADING SYSTEM:Pass mark for portfolio is 100%. Portfolio norm referenced.Qualification is not graded.QUALITY ASSURANCE:Internally and externally verified portfolio.PROGRESSION/ARTICULATION:Learners who achieve this qualification could progress to:ggNCFE level 3 Certificate in IT User Skills (ITQ)NCFE level 3 Diploma in IT User Skills (ITQ).NCFE Award in SupportingTeaching and Learning in SchoolsQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 3DATE OF FIRST TEACHING:2010PREREQUISITES:No specific prior learning required. Minimum entry age 16.NUMBER OF UNITS/STRUCTURE:Four mandatory units.ASSESSMENT METHOD:Internally and externally verified portfolio.GRADING SYSTEM:Pass mark for portfolio is 100%. Portfolio norm referenced.Qualification is not graded.QUALITY ASSURANCE:Internally and externally verified portfolio.PROGRESSION/ARTICULATION:Learners who achieve this qualification could progress to:gggNCFE level 3 Certificate in Cover Supervision of Pupils inSchoolsNCFE level 3 Certificate in Supporting Teaching and Learningin SchoolsNCFE level 3 Diploma in Specialist Support for Teaching andLearning in Schools.NCFE Certificate in ContactCentre OperationsQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 3DATE OF FIRST TEACHING:2011PREREQUISITES:No specific prior learning required. Minimum entry age 16.NUMBER OF UNITS/STRUCTURE:Three mandatory units and 11 optional units.ASSESSMENT METHOD:Internally and externally verified portfolio.GRADING SYSTEM:Pass mark for portfolio is 100%. Portfolio norm referenced.Qualification is not graded.QUALITY ASSURANCE:Internally and externally verified portfolio.PROGRESSION/ARTICULATION:Learners who achieve this qualification could progress to:ggNCFE level 4 NVQ Diploma in Contact Centre OperationsNCFE level 4 Diploma in Customer Service.NCFE Certificate in IT User Skills(ITQ)QUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 3DATE OF FIRST TEACHING:2011PREREQUISITES:No specific prior learning required. There is no minimum entryage for this qualification.NUMBER OF UNITS/STRUCTURE:77 optional units.ASSESSMENT METHOD:Internally and externally verified portfolio.GRADING SYSTEM:Pass mark for portfolio is 100%. Portfolio norm referenced.Qualification is not graded.QUALITY ASSURANCE:Internally and externally verified portfolio.PROGRESSION/ARTICULATION:Learners who achieve this qualification could progress to:gNCFE level 3 Diploma in IT User Skills (ITQ).122 <strong>UK</strong> QUALIFICATIONS
<strong>Qualifications</strong> currently offeredNCFE Certificate in ManagementQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 3DATE OF FIRST TEACHING:2011PREREQUISITES:No specific prior learning required. Minimum entry age 16.NUMBER OF UNITS/STRUCTURE:Two mandatory units and 11 optional units.ASSESSMENT METHOD:Internally and externally verified portfolio.GRADING SYSTEM:Pass mark for portfolio is 100%. Portfolio norm referenced.Qualification is not graded.QUALITY ASSURANCE:Internally and externally verified portfolio.PROGRESSION/ARTICULATION:Learners who achieve this qualification could progress to:ggNCFE level 5 NVQ Diploma in ManagementNCFE level 7 NVQ Diploma in Management.NCFE Certificate in Principles ofCustomer ServiceQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 3DATE OF FIRST TEACHING:2011PREREQUISITES:No specific prior learning required. Minimum entry age 16.NUMBER OF UNITS/STRUCTURE:Three mandatory units.ASSESSMENT METHOD:Internally and externally verified portfolio.GRADING SYSTEM:Pass mark for portfolio is 100%. Portfolio norm referenced.Qualification is not graded.QUALITY ASSURANCE:Internally and externally verified portfolio.PROGRESSION/ARTICULATION:Learners who achieve this qualification could progress to:ggNCFE level 3 NVQ Diploma in Customer ServiceNCFE level 4 NVQ Diploma in Customer Service.NCFE Certificate in SupportingTeaching and Learning inSchoolsQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 3DATE OF FIRST TEACHING:2010PREREQUISITES:No specific prior learning required. Minimum entry age 16.NUMBER OF UNITS/STRUCTURE:11 mandatory units.ASSESSMENT METHOD:Competence based. Internally and externally verified portfolio.GRADING SYSTEM:Pass mark for portfolio is 100%. Portfolio norm referenced.Qualification is not graded.QUALITY ASSURANCE:Internally and externally verified portfolio.PROGRESSION/ARTICULATION:Learners who achieve this qualification could progress to:ggNCFE level 3 Certificate in Cover Supervision of Pupils inSchoolsNCFE level 3 Diploma in Specialist Support for Teaching andLearning in Schools.NCFE Diploma in IT User SkillsQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 3DATE OF FIRST TEACHING:2011PREREQUISITES:No specific prior learning required. There is no minimum entryage for this qualification.NUMBER OF UNITS/STRUCTURE:Three mandatory units and 87 optional units.ASSESSMENT METHOD:Competence based. Internally and externally verified portfolio.GRADING SYSTEM:Pass mark for portfolio is 100%. Portfolio norm referenced.Qualification is not graded.QUALITY ASSURANCE:Internally and externally verified portfolio.PROGRESSION/ARTICULATION:Learners who achieve this qualification could progress to furtherqualifications at level 3 or higher.NCFE Diploma in IT User Skills(ITQ)QUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 3DATE OF FIRST TEACHING:2011PREREQUISITES:No specific prior learning required. There is no minimum entryage for this qualification.NUMBER OF UNITS/STRUCTURE:One mandatory unit and 76 optional units.ASSESSMENT METHOD:Competence based. Internally and externally verified portfolio.GRADING SYSTEM:Pass mark for portfolio is 100%. Portfolio norm referenced.Qualification is not graded.QUALITY ASSURANCE:Internally and externally verified portfolio.<strong>UK</strong> QUALIFICATIONS 123
<strong>Qualifications</strong> currently offeredPROGRESSION/ARTICULATION:Learners who achieve this qualification could progress to furtherqualifications at level 3 in the same or related subject area.NCFE Diploma in SpecialistSupport for Teaching andLearning in SchoolsQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 3DATE OF FIRST TEACHING:2010PREREQUISITES:No specific prior learning required. Minimum entry age 16.NUMBER OF UNITS/STRUCTURE:11 mandatory units and 41 optional units.ASSESSMENT METHOD:Competence based. Internally and externally verified portfolio.GRADING SYSTEM:Pass mark for portfolio is 100%. Portfolio norm referenced.Qualification is not graded.QUALITY ASSURANCE:Internally and externally verified portfolio.PROGRESSION/ARTICULATION:Learners who achieve this qualification could progress to HigherLevel Teaching Assistant Status (HLTA).NCFE Certificate CoverSupervision of Pupils in SchoolsQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 3DATE OF FIRST TEACHING:2010PREREQUISITES:No specific prior learning required. Minimum entry age 18.NUMBER OF UNITS/STRUCTURE:11 mandatory units.ASSESSMENT METHOD:Competence based. Internally and externally verified portfolio.GRADING SYSTEM:Pass mark for portfolio is 100%. Portfolio norm referenced.Qualification is not graded.QUALITY ASSURANCE:Internally and externally verified portfolio.PROGRESSION/ARTICULATION:Learners who achieve this qualification could progress to:ggNCFE Level 3 Certificate in Supporting Teaching and Learningin SchoolsNCFE Level 3 Diploma in Specialist Support for Teaching andLearning in Schools.NCFE Certificate in Teaching inthe Lifelong Learning SectorQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 3DATE OF FIRST TEACHING:2011PREREQUISITES:30 hours of teaching practice. Minimum entry age 19.NUMBER OF UNITS/STRUCTURE:Two mandatory units and 41 optional units.ASSESSMENT METHOD:Competence based. Internally and externally verified portfolio.GRADING SYSTEM:Pass mark for portfolio is 100%. Portfolio norm referenced.Qualification is not graded.QUALITY ASSURANCE:Internally and externally verified portfolio.PROGRESSION/ARTICULATION:Learners who achieve this qualification could progress toDiplomas in Teaching in the Lifelong Learning Sector.NCFE Certificate in Teaching inthe Lifelong Learning SectorQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 4DATE OF FIRST TEACHING:2011PREREQUISITES:30 hours of teaching practice. Minimum entry age 19.NUMBER OF UNITS/STRUCTURE:Two mandatory units and 57 optional units.ASSESSMENT METHOD:Competence based. Internally and externally verified portfolio.GRADING SYSTEM:Pass mark for portfolio is 100%. Portfolio norm referenced.Qualification is not graded.QUALITY ASSURANCE:Internally and externally verified portfolio.PROGRESSION/ARTICULATION:Learners who achieve this qualification could progress toDiplomas in Teaching in the Lifelong Learning Sector.NCFE NVQ Diploma in Businessand AdministrationQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 4DATE OF FIRST TEACHING:2010PREREQUISITES:No specific prior learning required. Minimum entry age 18.NUMBER OF UNITS/STRUCTURE:Six mandatory units and 44 optional units.ASSESSMENT METHOD:Internally and externally verified portfolio.GRADING SYSTEM:Pass mark for portfolio is 100%. Portfolio norm referenced.Qualification is not graded.QUALITY ASSURANCE:Internally and externally verified portfolio.124 <strong>UK</strong> QUALIFICATIONS
<strong>Qualifications</strong> currently offeredPROGRESSION/ARTICULATION:Level 5 NVQ Diploma in Management.NCFE NVQ Diploma in ContactCentre OperationsQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 3DATE OF FIRST TEACHING:2011PREREQUISITES:No specific prior learning required. Minimum entry age 16.NUMBER OF UNITS/STRUCTURE:Two mandatory units and 47 optional units.ASSESSMENT METHOD:Internally and externally verified portfolio.GRADING SYSTEM:Pass mark for portfolio is 100%. Portfolio norm referenced.Qualification is not graded.QUALITY ASSURANCE:Internally and externally verified portfolio.PROGRESSION/ARTICULATION:Level 4 NVQ Diploma in Contact Centre Operations.NCFE NVQ Diploma in ContactCentre OperationsQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 4DATE OF FIRST TEACHING:2011PREREQUISITES:No specific prior learning required. Minimum entry age 18.NUMBER OF UNITS/STRUCTURE:Two mandatory units and 34 optional units.ASSESSMENT METHOD:Internally and externally verified portfolio.GRADING SYSTEM:Pass mark for portfolio is 100%. Portfolio norm referenced.Qualification is not graded.QUALITY ASSURANCE:Internally and externally verified portfolio.PROGRESSION/ARTICULATION:Level 5 NVQ Diploma in Management.NCFE NVQ Diploma in CustomerServiceQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 4DATE OF FIRST TEACHING:2010PREREQUISITES:No specific prior learning required. Minimum entry age 18.NUMBER OF UNITS/STRUCTURE:Two mandatory and 31 optional units.ASSESSMENT METHOD:Internally and externally verified portfolio.GRADING SYSTEM:Pass mark for portfolio is 100%. Portfolio norm referenced.Qualification is not graded.QUALITY ASSURANCE:Internally and externally verified portfolio.PROGRESSION/ARTICULATION:Level 4 NVQ in Management.NCFE NVQ Certificate inSpectator SafetyQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 3BACKGROUND:This programme aims to provide a nationally recognised,competence-based qualification that is appropriate to the work ofstewards and marshals in spectator events, especially eventstaking place within sports stadia and relating directly to theNational Occupational Standards developed by SkillsActive.DATE OF FIRST TEACHING:2011PREREQUISITES:No specific prior learning required. Minimum entry age 18.NUMBER OF UNITS/STRUCTURE:Four mandatory units plus two optional units.ASSESSMENT METHOD:Internally and externally verified portfolio.GRADING SYSTEM:Pass mark for portfolio is 100%. Portfolio norm referenced.Qualification is not graded.QUALITY ASSURANCE:Internally and externally moderated portfolio.PROGRESSION/ARTICULATION:gLevel 4 NVQ in Spectator Safety ManagementgLevel 4 NVQ in ManagementgAlso provides a sound base for progression into employmentwithin the spectator safety industry as well as a tool to progresswithin different aspects of the leisure and service sector.NCFE NVQ Diploma in SpectatorSafety ManagementQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 4BACKGROUND:This programme aims to provide a nationally recognised,competence-based qualification that is appropriate to thoseworking at spectator events, especially events taking place withinsports stadiums.It is for those working in the match-day and events stewardingindustry. It can be achieved by candidates working in supervisorypositions at sports events, concerts or carnivals, where the safetyof spectators is paramount.DATE OF FIRST TEACHING:2011<strong>UK</strong> QUALIFICATIONS 125
<strong>Qualifications</strong> currently offeredPREREQUISITES:No specific prior learning required. Minimum entry age 18.NUMBER OF UNITS/STRUCTURE:Seven mandatory units plus two optional units.ASSESSMENT METHOD:Internally and externally verified portfolio.GRADING SYSTEM:Pass mark for portfolio is 100%. Portfolio norm referenced.Qualification is not graded.QUALITY ASSURANCE:Internally and externally moderated portfolio.PROGRESSION/ARTICULATION:gLevel 5 NVQ Diploma in ManagementgThe qualification also provides a sound base for progressioninto employment within the spectator safety industry as wellas a tool to progress within different aspects of the leisureand service sector.NCFE Certificate in LeisureManagementQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 3BACKGROUND:This qualification is suitable for learners looking to develop theunderpinning knowledge and skills for working in the sport, leisureand recreation sector in a managerial or supervisory capacity. It’salso suitable for those already working in the sector, wishing toprogress to managerial or supervisory roles or to gain recognitionof knowledge and skills already held through working at that level.DATE OF FIRST TEACHING:2011PREREQUISITES:No specific prior learning required. Minimum entry age 16.NUMBER OF UNITS/STRUCTURE:Six mandatory units plus one optional unit.ASSESSMENT METHOD:Internally and externally moderated portfolio.GRADING SYSTEM:Pass mark for portfolio is 100%. Portfolio norm referenced.Qualification is not graded.QUALITY ASSURANCE:Internally and externally moderated portfolio.PROGRESSION/ARTICULATION:gLevel 3 NVQ Diploma in Leisure ManagementgOr to further education courses in marketing, business,events management, management and leadership.NCFE NVQ Diploma in LeisureManagementQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 3BACKGROUND:This qualification is suitable for learners looking to develop theskills, competence, knowledge and understanding for working inthe sport, leisure and recreation sector in a managerial orsupervisory capacity.DATE OF FIRST TEACHING:2011PREREQUISITES:No specific prior learning required. Minimum entry age 16.NUMBER OF UNITS/STRUCTURE:Eleven mandatory units plus a minimum of seven credits from the17 optional units.ASSESSMENT METHOD:Internally and externally moderated portfolio.GRADING SYSTEM:Pass mark for portfolio is 100%. Portfolio norm referenced.Qualification is not graded.QUALITY ASSURANCE:Internally and externally moderated portfolio.PROGRESSION/ARTICULATION:gHuman resource managementgMarketinggEvents managementgManagement and leadershipgBusiness.NCFE Diploma in OutdoorLearningQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 3BACKGROUND:This qualification is ideal for learners with some experience in theoutdoor industry, with a high level of commitment to a career inthe outdoor industry and evidence of prolonged participation inone or more of the expected outdoor activities.DATE OF FIRST TEACHING:2011PREREQUISITES:No specific prior learning required. Minimum entry age 18.NUMBER OF UNITS/STRUCTURE:Six mandatory units.ASSESSMENT METHOD:Internally and externally moderated portfolio.GRADING SYSTEM:Pass mark for portfolio is 100%. Portfolio norm referenced.Qualification is not graded.QUALITY ASSURANCE:Internally and externally moderated portfolio.PROGRESSION/ARTICULATION:gNCFE Level 3 NVQ Diploma in Outdoor ProgrammesgMLT<strong>UK</strong> Mountain Leader Award and other National GoverningBody Awards.NCFE NVQ Diploma in OutdoorProgrammesQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 3BACKGROUND:This qualification is ideal for learners with some previousexperience of working in the outdoor sector, with a high level ofcommitment to a career in the outdoor industry, looking to furtherdevelop their skills, competence, knowledge and understanding ofthe outdoors sector.126 <strong>UK</strong> QUALIFICATIONS
<strong>Qualifications</strong> currently offeredDATE OF FIRST TEACHING:2012PREREQUISITES:No specific prior learning required. Minimum entry age 18.NUMBER OF UNITS/STRUCTURE:A minimum of 39 credits is required depending on the chosenpathway.ASSESSMENT METHOD:Internally and externally moderated portfolio.GRADING SYSTEM:Pass mark for portfolio is 100%. Portfolio norm referenced.Qualification is not graded.QUALITY ASSURANCE:Internally and externally moderated portfolio.PROGRESSION/ARTICULATION:gRelevant NGB qualificationsgTeaching qualificationsgHigher level management qualifications.NCFE Certificate in TravelServicesQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 3BACKGROUND:This qualification is the technical certificate and is part of theApprenticeship framework for the level 3 NVQ Diploma in TravelServices. The Apprenticeship will suit candidates who are workingor looking to work within the travel and tourism industry as atravel consultant, overseas representative, tour operator orworking in the head office of a tour operator.DATE OF FIRST TEACHING:2011PREREQUISITES:No specific prior learning required. Minimum entry age 16.NUMBER OF UNITS/STRUCTURE:One mandatory unit and a minimum of seven credits from theoptional units required, depending on the chosen pathway.ASSESSMENT METHOD:Internally and externally moderated portfolio.GRADING SYSTEM:Pass mark for portfolio is 100%. Portfolio norm referenced.Qualification is not graded.QUALITY ASSURANCE:Internally and externally moderated portfolio.PROGRESSION/ARTICULATION:gEmployment in the travel services or a related sectorgLevel 3 NVQ Diploma in Travel ServicesgLevel 4 qualifications, eg in travel and tourism or travelplanning and management.NCFE NVQ Diploma in TravelServicesQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 3BACKGROUND:This qualification is aimed at those already working in or seekingto start a career in travel services and can be taken whilst in theworkplace to allow hands-on experience as training occurs.This qualification has been developed in association with People1st, the Sector Skills Council for Hospitality, Leisure, Travel andTourism, and is based on the national occupational standards forthe industry.DATE OF FIRST TEACHING:2011PREREQUISITES:No specific prior learning required. Minimum entry age 16.NUMBER OF UNITS/STRUCTURE:Three mandatory units and a minimum of 24 credits from theoptional units required depending on the chosen pathway.ASSESSMENT METHOD:Internally and externally moderated portfolio.GRADING SYSTEM:Pass mark for portfolio is 100%. Portfolio norm referenced.Qualification is not graded.QUALITY ASSURANCE:Internally and externally moderated portfolio.PROGRESSION/ARTICULATION:gLevel 3 NVQ Diploma in Travel ServicesgLevel 2 NVQ Certificate in Team LeadinggLevel 3 NVQ Certificate in Management.NCFE NVQ Diploma in PersonalTrainingQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 3BACKGROUND:This qualification is designed to provide learners with theknowledge, understanding and skills to work unsupervised as apersonal trainer in sport and active leisure.Learners who successfully complete this qualification will beeligible for registration with the Register of Exercise Professionals(REPs) as a level 3 personal trainer.DATE OF FIRST TEACHING:2011PREREQUISITES:No specific prior learning required. Minimum entry age 16.NUMBER OF UNITS/STRUCTURE:Nine mandatory units and one additional unit.ASSESSMENT METHOD:Internally and externally moderated portfolio.GRADING SYSTEM:Pass mark for portfolio is 100%. Portfolio norm referenced.Qualification is not graded.QUALITY ASSURANCE:Internally and externally moderated portfolio.PROGRESSION/ARTICULATION:Learners who successfully complete this qualification are likely togo on to work as personal trainers in the sport and active leisureindustry.NCFE Certificate in Retail Skills(Management)QUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 3<strong>UK</strong> QUALIFICATIONS 127
<strong>Qualifications</strong> currently offeredBACKGROUND:This qualification aims to provide learners with the skills andknowledge needed to work in the retail sector, covering: selling,service, team working, health and safety, dealing with theft, andproduct knowledge.DATE OF FIRST TEACHING:2012NUMBER OF UNITS/STRUCTURE:Qualification consists of one mandatory unit and 22 optionalunits. Candidates must achieve 31 credits of which 10 creditsmust come from the mandatory group. Candidates must alsocomplete a minimum of 21 credits from the optional units.ASSESSMENT METHOD:Internally assessed and externally moderated portfolio.GRADING SYSTEM:Pass mark for portfolio 100%. Portfolio norm referenced.Qualification is not graded.QUALITY ASSURANCE:Internal and external moderation of portfolio.PROGRESSION/ARTICULATION:gLevel 3 Diploma in Retail Skills (Visual Merchandising)gLevel 3 Diploma in Retail Skills (Sales Professional)gLevel 3 Diploma in Retail Skills (Management)gLevel 3 Certificate in Retail KnowledgegLevel 3 Employability qualificationsgLevel 3 Customer Service qualifications.NCFE Certificate in Retail Skills(Visual Merchandising)QUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 3BACKGROUND:This qualification aims to provide learners with the skills andknowledge needed to work in the retail sector, covering: selling,service, team working, health and safety, dealing with theft, andproduct knowledge.DATE OF FIRST TEACHING:2012NUMBER OF UNITS/STRUCTURE:Candidates must achieve 31 credits of which: 10 credits mustcome the mandatory units and a minimum of 21 units from theoptional groups (a maximum of 11 credits may come from thelevel 2 units and 10 credits must come from the level 3 units).ASSESSMENT METHOD:Internally assessed and externally moderated portfolio.GRADING SYSTEM:Pass mark for portfolio 100%. Portfolio norm referenced.Qualification is not graded.QUALITY ASSURANCE:Internal and external moderation of portfolio.PROGRESSION/ARTICULATION:Learners who achieve this qualification could progress to:ggggggLevel 3 Diploma in Retail Skills (Visual Merchandising)Level 3 Diploma in Retail Skills (Sales Professional)Level 3 Diploma in Retail Skills (Management)Level 3 Certificate in Retail KnowledgeLevel 3 Employability qualificationsLevel 3 Customer Service qualifications.NCFE Certificate in Retail Skills(Sales Professional)QUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 3BACKGROUND:This qualification aims to provide learners with the skills andknowledge needed to work in the retail sector, covering: selling,service, team working, health and safety, dealing with theft, andproduct knowledge.DATE OF FIRST TEACHING:2012NUMBER OF UNITS/STRUCTURE:Candidates must achieve 31 credits; 10 credits from groupthe mandatory units; and 21 credits from the optional units(a minimum of 21 credits must be achieved at level 3).ASSESSMENT METHOD:Internally assessed and externally moderated portfolio.GRADING SYSTEM:Pass mark for portfolio 100%. Portfolio norm referenced.Qualification is not graded.QUALITY ASSURANCE:Internal and external moderation of portfolio.PROGRESSION/ARTICULATION:gLevel 3 Diploma in Retail Skills (Visual Merchandising)gLevel 3 Diploma in Retail Skills (Sales Professional)gLevel 3 Diploma in Retail Skills (Management)gLevel 3 Certificate in Retail KnowledgegLevel 3 Employability qualificationsgLevel 3 Customer Service qualifications.NCFE Diploma in Retail Skills(Visual Merchandising)QUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 3BACKGROUND:This qualification aims to provide learners with the skills andknowledge needed to work in the retail sector, covering: selling,service, team working, health and safety, dealing with theft, andproduct knowledge.DATE OF FIRST TEACHING:2012NUMBER OF UNITS/STRUCTURE:Candidates must achieve a minimum of 53 credits. A minimum of43 credits must be at level 3 of which 10 credits must comefrom the mandatory group and a minimum of 32 credits from theoptional group B. A maximum of 11 credits from level 2 or level 3units can come from Group C.ASSESSMENT METHOD:Internally assessed and externally moderated portfolio.GRADING SYSTEM:Pass mark for portfolio 100%. Portfolio norm referenced.Qualification is not graded.QUALITY ASSURANCE:Internal and external moderation of portfolio.PROGRESSION/ARTICULATION:gLevel 3 Diploma in Retail Skills (Sales Professional)gLevel 3 Diploma in Retail Skills (Management)gLevel 3 Certificate in Retail KnowledgegLevel 3 Employability qualificationsgLevel 3 Customer Service qualifications.128 <strong>UK</strong> QUALIFICATIONS
<strong>Qualifications</strong> currently offeredNCFE Diploma in Retail Skills(Management)QUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 3BACKGROUND:This qualification aims to provide learners with the skills andknowledge needed to work in the retail sector, covering: selling,service, team working, health and safety, dealing with theft, andproduct knowledge.DATE OF FIRST TEACHING:2012NUMBER OF UNITS/STRUCTURE:Candidates must achieve a minimum of 53 credits. A minimum of43 credits must be at level 3 of which 10 credits must comefrom Group A and a minimum of 32 credits from Group B. Amaximum of 11 credits from level 2 or level 3 units can comefrom Group C.ASSESSMENT METHOD:Internally assessed and externally moderated portfolio.GRADING SYSTEM:Pass mark for portfolio 100%. Portfolio norm referenced.Qualification is not graded.QUALITY ASSURANCE:Internal and external moderation of portfolio.PROGRESSION/ARTICULATION:gLevel 3 Diploma in Retail Skills (Sales Professional)gLevel 3 Diploma in Retail Skills (Visual Merchandising)gLevel 3 Certificate in Retail KnowledgegLevel 3 Employability qualificationsgLevel 3 Customer Service qualifications.NCFE Diploma in Retail Skills(Sales Professional)QUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 3BACKGROUND:This qualification aims to provide learners with the skills andknowledge needed to work in the retail sector, covering: selling,service, team working, health and safety, dealing with theft, andproduct knowledge.DATE OF FIRST TEACHING:2012NUMBER OF UNITS/STRUCTURE:Candidates must achieve a minimum of 43 credits. A minimum of33 credits must be at level 3 of which 10 credits must comefrom group A and a minimum of 23 credits from group B. Amaximum of 10 credits from level 2 or level 3 units can comefrom group C.ASSESSMENT METHOD:Internally assessed and externally moderated portfolio.GRADING SYSTEM:Pass mark for portfolio 100%. Portfolio norm referenced.Qualification is not graded.QUALITY ASSURANCE:Internal and external moderation of portfolio.PROGRESSION/ARTICULATION:gLevel 3 Diploma in Retail Skills (Management)gLevel 3 Diploma in Retail Skills (Visual Merchandising)gggLevel 3 Certificate in Retail KnowledgeLevel 3 Employability qualificationsLevel 3 Customer Service qualifications.NCFE Certificate in RetailKnowledgeQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 3BACKGROUND:This qualification aims to provide learners with the skills andknowledge needed to work in the retail sector, covering: selling,service, team working, health and safety, dealing with theft, andproduct knowledge.DATE OF FIRST TEACHING:2012NUMBER OF UNITS/STRUCTURE:To be awarded the NCFE level 3 Certificate in Retail Knowledge,learners are required to successfully complete four mandatoryunits (achieving 10 credits) and at least two optional units(achieving at least six credits).ASSESSMENT METHOD:Internally assessed and externally moderated portfolio.GRADING SYSTEM:Pass mark for portfolio 100%. Portfolio norm referenced.Qualification is not graded.QUALITY ASSURANCE:Internal and external moderation of portfolio.PROGRESSION/ARTICULATION:gLevel 3 Diploma in Retail KnowledgegLevel 3 Award, Certificate or Diploma in Retail SkillsgNCFE level 3 Employability qualificationsgNCFE level 3 Customer Service qualifications.Oxford, Cambridge and RSAExaminationsOCR is the unitary awarding body established by the Universityof Cambridge Local Examinations Syndicate (UCLES, nowCambridge Assessment) and RSA Examinations Board (RSAEB).From 1 October 1998, OCR took responsibility in the <strong>UK</strong> for allqualifications offered by the Midland Examining Group (MEG), theOxford and Cambridge Examinations and Assessment Council(OCEAC) and RSA. This includes MEG Certificates of Achievementand GCSE syllabuses, OCEAC A levels/AS and RSAEB’s NVQs andvocational qualifications. OCR also offers a range of ‘stand-alone’qualifications in Information Technology, Business Skills and othervocationally orientated subjects. In 2003, OCR introduced theOCR Nationals, a suite of vocationally related qualifications atlevels 1, 2 and 3.Since 2004, OCR has offered the Asset Languages assessmentscheme for language learners of all ages and abilities.OCR offers the complete range of qualifications, examinationsand assessment services required by schools, colleges, trainingproviders and employers throughout the <strong>UK</strong>. These services areprovided in a comprehensive and coherent manner at all levelsfrom Entry to level 5 in all areas of the National <strong>Qualifications</strong>Framework and <strong>Qualifications</strong> and Credit Framework.Prior to October 1998, OCR’s GCSE syllabuses were offered by theMidland Examining Group (MEG) and RSAEB. MEG operated as aunified body within UCLES under a constitution which took effect on1 October 1993. The former East Midlands Regional Examinations<strong>UK</strong> QUALIFICATIONS 129
<strong>Qualifications</strong> currently offeredBoard and the West Midlands Examinations Board, Oxford andCambridge Schools Examination Board and the SouthernUniversities Board, which were part of the original federation of MEGBoards, have ceased to operate as examining bodies.The Oxford and Cambridge Examinations and AssessmentCouncil (OCEAC) was responsible for the GCE A levelexaminations before October 1998. OCEAC previously offeredA level examinations under the names of the Oxford andCambridge Schools Examination Board (OCSEB), the University ofOxford Delegacy of Local Examinations (UODLE) and Oxford. From1996 to 1998, all <strong>UK</strong> A level/AS examinations of these boardswere certificated by OCEAC.International A level and AS results are certificated, as before, byUCLES (now Cambridge Assessment).The alliance between UCLES and RSAEB has been superseded bythe formation of OCR.For further information and advice on OCR GCE A level and AS,AVCE and GCSE qualifications and Entry level Certificates, contactthe Cambridge office. For information on OCR Nationals, KeySkills, NVQs and vocationally related schemes, contact theCoventry office (see Appendix A).OCR National Award andCertificate in ScienceNATIONAL QUALIFICATIONS FRAMEWORK LEVEL:Level 2BACKGROUND:These qualifications have been developed to provide learners withthe opportunity to gain underpinning knowledge and skills tosupport entry into work or further studies by taking a practical,task-based approach to learning. Using this approach learnerswill develop knowledge and understanding of science, scientificprocedures and commercial applications of science.In addition to offering thorough coverage of the Key Stage 4Programme of Study for Science, learners have the opportunity toexplore specialist areas such as the science of construction,science in sport, and food science.The units are practically based and can be certificated individuallyor combined to gain a full qualification; thus individual units canbe offered alongside other programmes of learning and learnershave the option of achieving as many or as few units as areappropriate for their needs.Both the Award and the Certificate contribute to the Level 2National Performance Threshold (40% and 80% respectively) aswell as contributing to the Science Indicator in the School andCollege Achievement and Attainment Tables.DATE OF FIRST TEACHING:September 2008NUMBER OF UNITS/STRUCTURE:OCR level 2 National Award (3 units)(180 Guided Learning Hours)To be awarded the OCR Level 2 National Award, candidates mustachieve a minimum Pass grade for:ggtwo mandatory unitsone optional unit.Each unit is of equal size and is based on approximately 60guided learning hours.OCR level 2 National Certificate (6 units)(360 Guided Learning Hours)To be awarded the OCR level 2 National Certificate, candidatesmust achieve a minimum Pass grade for:ggfour mandatory unitstwo optional units.The OCR level 2 National Certificate contains a career planningunit and a work experience unit. Only one of these units maycount towards achievement of the full certificate.Each unit is of equal size and is based on approximately 60Guided Learning Hours.ASSESSMENT METHOD:All units are internally assessed and externally moderated by OCR.Internal assessment involves candidates producing a portfolio ofevidence showing that they can meet all the assessmentobjectives. Portfolios of work must be produced independently.They are made available, together with witness statements andany other supporting documentation, to the OCR visitingmoderator when required. Centres are able to enter candidates’work for external moderation at any time during the year.DATE OF RESULT PUBLICATION:Certification is on demand.GRADING SYSTEM:The units that make up these qualifications are graded Pass,Merit or Distinction and, depending on a candidate’sachievements at unit level, an overall grade of Pass, Merit orDistinction is allocated to each full qualification.QUALITY ASSURANCE:Quality assurance and control is implemented through:gggggqualification specifications which define requirements andprovide additional guidancecentre approval process that ensures centres meet specifiedquality criteriaexternal moderation of internally assessed units to ensurenational standards are maintainedtraining events for centresmoderator training, standardisation and monitoring/feedback.PROGRESSION/ARTICULATION:Progression options available to candidates who have gainedthese qualifications are:ggenter employment at an operative/practitioner/trainee leveland undertake further job related training eg anApprenticeship or occupational qualification appropriate totheir job roleundertake additional level 2 and/or level 3 qualificationspart-time or full-time in further education.OCR Asset LanguagesNATIONAL QUALIFICATIONS FRAMEWORK LEVEL:Entry level, level 1, level 2, level 3BACKGROUND:OCR Asset Languages is an assessment scheme designed tosupport the Department for Education’s National LanguagesStrategy by providing recognition of language proficiency.Attainment is measured against the Languages Ladder, which is amulti-stage learning programme that uses ‘can do’ statements todescribe the typical behaviour of language learners at each stage.The scheme is designed as a measure of proficiency and thus isnot associated with any particular programme of study. Thequalifications provide candidates with the opportunity to130 <strong>UK</strong> QUALIFICATIONS
<strong>Qualifications</strong> currently offereddemonstrate competence in one or more of the four skills(listening, speaking, reading, writing) and are available in thefollowing languages: Arabic, Bengali, Chinese (Mandarin andCantonese), Cornish, French, German, Modern Greek, Gujarati,Hindi, Irish, Italian, Japanese, Panjabi, Polish, Portuguese, Russian,Somali, Spanish, Swedish, Tamil, Turkish, Urdu, Welsh and Yoruba.DATE OF FIRST TEACHING:2004 (Entry level, levels 1 and 2)2005 (level 3).DATE OF FIRST AWARD:2005 (Entry level, levels 1 and 2)2006 (level 3).PREREQUISITES:There are no formal entry requirements for these qualifications. Forlevels 1–3 candidates should normally have attained the levelrepresented by achievement of a qualification below the level forwhich they are entered. These qualifications may be studied as partof lifelong learning for many reasons, both recreational and/orvocational. They serve as an end in themselves for candidates whowish to develop their use of language or they may be used as abasis for progression up the Languages Ladder.NUMBER OF UNITS/STRUCTURE:Each qualification comprises one unit, each assessing asingle skill.ASSESSMENT METHOD:Listening, reading and writing are externally assessed. Speakingis internally assessed and between 70% (Entry level) through60% (level 1 and level 2) and 100% (level 3) is externallymoderated.EXAMINATION TIMING:There are four testing series during the academic year and eachseries is designed to give maximum flexibility with regard totimetabling of tests for Entry level to level 3.DATE OF RESULT PUBLICATION:January, April, June and August depending on the series entered.GRADING SYSTEM:Each qualification is awarded in the following way:Entry level = Breakthrough grades 1–3level 1 = Preliminary grades 4–6level 2 = Intermediate grades 7–9level 3 = Advanced grades 10–12Asset Languages Advanced StageUCAS Tariff pointsGrade 12 Grade 11 Grade 10Speaking 28 20 12Listening 25 18 11Reading 25 18 11Writing 25 18 11QUALITY ASSURANCE:Listening, reading and writing are externally assessed andspeaking is internally assessed and externally moderated by OCRto ensure accuracy and consistency of centre marking. Theassessment methodology for listening and reading up to level 3 isbased on an item-banking approach and is designed to provide arigorous basis for comparison across languages and levels. Itrelies on item data analysis to ensure that papers are statisticallycomparable. Speaking and writing are assessed on a criteriabasedapproach and training in the standards is provided forteachers as well as for examiners and moderators.OCR Certificate/Diploma foriMedia UsersNATIONAL QUALIFICATIONS FRAMEWORK LEVEL:Level 3BACKGROUND:The OCR level 3 Certificate/Diploma for iMedia Users has beendesigned for those who already possess intermediate skills (atlevel 2 or equivalent) and who wish to further develop their skillsand ability.It is suitable for those in employment who wish to develop skillsin one or more specialist areas in order to meet the requirementsof their workplace situation and dynamic job role. It is alsoappropriate for those following part-time courses for skilldevelopment or recreational purposes and those in full-timeeducation who have some skills in this area, but wish togain more specialist skills in order to gain access to theiMedia industry.The target group is likely to include individuals working in, orpreparing for, roles/work activities such as the following:Web design, graphic art, multimedia production, flash animation,3D animation, sound design and editing, special effects, videoproduction, logo/titles design, desktop publishing, gamesdesign, storyboarding.DATE OF FIRST TEACHING:2006PREREQUISITES:Although there are no formal entry requirements for the level 3Certificate and Diploma, it is anticipated that, before embarkingon this programme, potential candidates will be able to:gggshow evidence of creativitydemonstrate basic IT literacy and show an interest indeveloping their skills furtherdemonstrate skills and knowledge at or above level 2 in theKey Skills areas of Communication and Working with Others.NUMBER OF UNITS/STRUCTURE:The qualification contains nine units.Unit 1: Digital graphicsUnit 2: Web authoringUnit 3: Digital animationUnit 4: Interactive multimedia designUnit 5: Digital sound editingUnit 6: Digital video editingUnit 7: 3D modellingUnit 8: 3D game enginesUnit 9: Game design.ASSESSMENT METHOD:All units are internally assessed and externally moderated.GRADING:The OCR level 3 Certificate/Diploma for iMedia Users has beenawarded the following UCAS Tariff points with effect from 2008entry to higher education:Grade UCAS Tariff pointsOCR level 3 Certificate for iMedia Users Pass 40OCR level 3 Diploma for iMedia Users Pass 66QUALITY ASSURANCE:The evidence produced is locally assessed within the centresbefore being externally moderated by OCR to ensure accuracyand consistency of centre marking. All scripts are retained forquality assurance purposes and the decisions made by<strong>UK</strong> QUALIFICATIONS 131
<strong>Qualifications</strong> currently offeredmoderators are standardised by the scheme chief for consistencywithin OCR.PROGRESSION/ARTICULATION:Candidates who are successful in achieving the OCR level 3Certificate/Diploma for iMedia Users will be able to progressdirectly to other related qualifications. Those candidates who wishto extend their skills at level 3 will be able to progress to differentoptional units.OCR Certificate/Diploma for ITProfessionalsNATIONAL QUALIFICATIONS FRAMEWORK LEVEL:Level 3BACKGROUND:The OCR level 3 Certificate/Diploma for IT Professionals has beendesigned to provide accreditation for the full breadth of essentialknowledge, understanding and skills that would be needed by acompetent employee engaged in the process of supporting ICTsystems or software development. It is a VRQ designed to developknowledge, understanding and skills in the full range of functionsinvolved in system support and software creation includingservice delivery, planning and control, the installation of networksand operating systems, the installation and maintenance ofapplications, the testing of systems, design of software andtesting of software and the production of customer supportmaterials. The qualification provides opportunities for learners tofollow a generic pathway or to study towards system and networkmanagement along the ICT Systems Support endorsed pathwayor for learners to specialise in one or more specific programminglanguages along the Software Development endorsed pathway. Allpathways provide the opportunity for learners to take units thatare vendor specific.DATE OF FIRST TEACHING:2004PREREQUISITES:There are no formal entry requirements for this qualification. It isaimed at those who already possess basic knowledge andunderstanding of ICT systems or software and who wish toextend their knowledge and skills. It is suitable for those who arealready employed in professional roles in the IT industry and whowish to develop further knowledge and skills to support and/orextend their work activities. The qualification will also meet theneeds of those who are studying in preparation for roles that willinvolve system support or software development activities.NUMBER OF UNITS/STRUCTURE:The qualification contains 45 units.The combination of Unit 34: Creating software components –Fundamentals of Java and Unit 44: Introduction to Java, is notallowed.CertificateTo achieve the OCR level 3 Certificate for IT Professionals thecandidate must achieve a total of six units: mandatory Unit 1 andUnit 3, Unit 29 and three optional units from the remaining units.A specialist endorsement of Software Development is available tocandidates taking this qualification if they achieve mandatory Unit1 and Unit 29 and any four of the optional units from theSoftware Development specialist pathway, Units 30 to 45.An endorsement will appear on the full award certificate asfollows: OCR level 3 Certificate for IT Professionals (SoftwareDevelopment).A specialist endorsement of ICT Systems Support is available tocandidates taking this qualification if they achieve mandatoryUnit 1, and Unit 3, Unit 8 and any three of the optional units fromthe ICT Systems Support specialist pathway, Units 2 to 28.An endorsement will appear on the full award certificate asfollows: OCR level 3 Certificate for IT Professionals (ICT SystemsSupport).DiplomaTo achieve the OCR level 3 Diploma for IT Professionals,candidates must achieve eight units: mandatory Unit 1 and Unit3, Unit 29 and five optional units from the remaining units.A specialist endorsement of Software Development is availableto candidates taking this qualification if they achieve mandatoryUnit 1 and Unit 29 and any six of the optional units from theSoftware Development specialist pathway, Units 30 to 45.An endorsement will appear on the full award certificate asfollows: OCR level 3 Diploma for IT Professionals (SoftwareDevelopment).A specialist endorsement of ICT Systems Support is availableto candidates taking this qualification if they achieve mandatoryUnit 1, and Unit 3, Unit 8 and any five of the optional units fromthe ICT Systems Support specialist pathway, units 2 to 28.An endorsement will appear on the full award certificateas follows: OCR level 3 Diploma for IT Professionals (ICT SystemsSupport).However, each unit represents a worthwhile achievement in itsown right and certification is also available at unit level.Candidates have the option of achieving either the fullqualification or one or more individual units, depending upon theirown learning needs or employment situation.There is no requirement for candidates to work towards the unitsin any particular order and tutors/trainers may tailor learningprogrammes to meet individual needs. Individual units may beachieved and certificated separately. Centres may incorporateindividual units into a range of different learning programmes asappropriate to the needs of their candidates and theirprogrammes of study.Thirty units are offered in partnership with vendors, includingMicrosoft, Cisco and CompTIA.ASSESSMENT METHOD:Combination of internally assessed and externally moderatedassessments, externally set and assessed assignment andelectronic tests set by vendors.GRADING:The OCR level 3 Certificate/Diploma for IT Professionals has beenawarded the following UCAS Tariff points with effect from 2008entry to higher education:OCR level 3 Certificate for IT ProfessionalsGradeUCAS Tariff pointsPass 80OCR level 3 Diploma for IT ProfessionalsGradeUCAS Tariff pointsPass 100QUALITY ASSURANCE:The evidence produced by Units 1, 29 and 31 is externallyassessed by OCR via postal arrangements. Evidence produced byUnits 2–10, 30, 32, 33 is locally assessed within the centresbefore being externally moderated by OCR to ensure accuracy132 <strong>UK</strong> QUALIFICATIONS
<strong>Qualifications</strong> currently offeredand consistency of centre marking. Units 11–28 and 34–45 areassessed under controlled conditions using electronic testsproduced by either Microsoft, Cisco and CompTIA.PROGRESSION/ARTICULATION:Level 4 NVQ for IT Professionals.OCR Level 3 Certificate inMathematics for EngineeringNATIONAL QUALIFICATIONS FRAMEWORK LEVEL:Level 3BACKGROUND:The OCR Level 3 Certificate in Mathematics for Engineering issuitable for learners wishing to gain a Level 3 qualification tosupport further study in FE and HE in the engineering sector, orfor learners who wish to gain a Level 3 qualification to supportfurther study in FE and HE in any other sector or subject area.The target group is likely to include individuals who are studyingfor employment in the engineering sector at technician level.DATE OF FIRST TEACHING:2008PREREQUISITES:It is advisable that anyone embarking upon this course shouldpreviously have studied GCSE Mathematics at higher tier orequivalent and/or be fully familiar with such mathematicalcontent.NUMBER OF UNITS/STRUCTURE:Candidates must complete the two components of the single unitin the same examination series.ASSESSMENT METHOD:The unit is assessed by independent external assessment in theform of two examination components.GRADING:GradeUCAS Tariff pointsA* to be confirmedA 90B 75C 60D 45E 30Points came into effect for entry to higher education from 2011onwards.QUALITY ASSURANCE:Both examinations are marked externally, in accordance with theOfqual Code of Practice.PROGRESSION/ARTICULATION:A candidate achieving a Level 3 Certificate in Mathematics forEngineering may:gggundertake additional level 3 qualifications part-time or full-timein further education, eg OCR Level 3 Principal Learning inEngineering, Diploma in Engineering, Diploma in Manufacturing,Diploma in Construction and the Built Environmentaccess degrees and other qualifications in further and highereducationprogress into employment, eg into engineering at technicianlevel.OCR level 5 Certificate inTeaching Learners with SpecificLearning DifficultiesQUALIFICATIONS CREDIT FRAMEWORK:Level 5BACKGROUND:The OCR level 5 Certificate in Teaching Learners with SpecificLearning Difficulties has been developed to recognise candidates’skills, knowledge and understanding of the Special EducationalNeeds sector and their ability to deliver effective teachingsessions to learners with specific learning difficulties (dyslexia)affecting literacy and numeracy.Whilst recognising that learners with dyslexia may experience avariety of difficulties in addition to the acquisition of fluent, ageappropriateword-level skills, educators working with this groupshould know how to address intransigent difficulties with learningto read and spell single words as well as problems arising at laterstages of literacy development and with other aspects of learning.This qualification is designed primarily to provide a route forcontinued professional development for teachers working withlearners with specific learning difficulties in literacy and numeracyacquisition. These difficulties may also affect communicationand interaction.The qualification would be appropriate for teachers and otherprofessionals working within one phase of educational provision –primary, secondary or adult (post-16) – who support learnersexperiencing significant difficulties with the acquisition anddevelopment of literacy and (basic) numeracy skills.DATE OF FIRST TEACHING:2011PREREQUISITES:This qualification is designed primarily for qualified and practisingteachers and other professionals who hold recognisedprofessional qualifications. Although OCR promotes open accessto all qualifications, in practice, candidates who do not have aprofessional background in providing learning support may find itdifficult to access opportunities to generate the full range ofevidence required to achieve the full qualification. Candidatesshould possess an appropriate level of learning supportexperience and should have unrestricted access to appropriateteaching and assessment practice.It is anticipated that candidates will have a high level of skill andbe working at or above the equivalent of level 3 in the followingKey Skill areas: Application of number, Communication, Improvingown learning, IT, Problem solving and Working with others.NUMBER OF UNITS/STRUCTURE:Unit 1: Understanding special educational needs policy andcontext in relation to dyslexia/specific learning difficulties; Unit 2:Accessing the needs of individuals with dyslexia/specific learningdifficulties; Unit 3: Planning and teaching learning programmesfor individuals with dyslexia/specific learning difficulties; Unit 4:Evaluation of teaching and learning programmes for individualswith dyslexia/specific learning difficulties. Learners mustcomplete all units to achieve the full qualification.ASSESSMENT METHOD:All units are locally assessed, internally verified by the centre andexternally verified by OCR.<strong>UK</strong> QUALIFICATIONS 133
<strong>Qualifications</strong> currently offeredQUALITY ASSURANCE:Assessment of all units, which reflect the practices of NVQassessment, is centre-based. The assessment decisions areexternally verified by OCR.Candidates must demonstrate that they have achieved all of theperformance criteria and knowledge and understandingrequirements of the units in the way specified in the evidencerequirements. Portfolios presented for assessment must includeall of the evidence specified by OCR.PROGRESSION/ARTICULATION:OCR level 7 Certificate and/or Diploma in Assessing and TeachingLearners with Dyslexia/Specific Learning Difficulties, OCR level 4Certificates in Teaching in the Lifelong Learning Sector.OCR National Certificates,Diplomas and ExtendedDiplomasNATIONAL QUALIFICATIONS FRAMEWORK LEVEL:Level 3(note: accreditation of OCR National qualifications on the NQF hasbeen extended until 2011)BACKGROUND:These qualifications cover a range of sectors, eg art and design,business, health, social care and early years, media, publicservices, travel and tourism, and sport. They prepare learners forentry into employment or progression and continuation of study inthe vocational area through FE or HE. They are unit-basedqualifications covering the key knowledge and practical skillsrequired in the vocational sector. Each unit requires approximately60 guided learning hours. Units are signposted to Key Skills andmapped to relevant national occupational standards. Thequalifications are gained through a combination of mandatoryand optional units which are all centre-assessed andexternally moderated.The OCR level 3 National Certificate is a six-unit qualificationoffering learners the opportunity to gain core skills and knowledgerelevant to a particular sector. OCR level 3 National Certificates aretypically delivered over a one-year programme of study.The OCR level 3 National Diploma is a 12-unit qualification offeringlearners the opportunity to specialise, if they wish, in specific areasthrough the choice of optional pathway units. OCR level 3 NationalDiplomas may be delivered over a one- or two-year programme.The OCR level 3 National Extended Diploma is an 18-unitqualification designed to promote breadth and add enrichment tothe learning experience. It demands breadth of knowledge andskills ensuring learners have a comprehensive understanding ofthe sector. OCR level 3 National Extended Diplomas are typicallydelivered over a two-year programme of study.OCR Nationals are suitable for 16-19-year-olds or more maturelearners considering a career change or return to work, or thosewishing to find a vocational route into further study.DATE OF FIRST TEACHING:Business, Health, Social Care and Early Years and Sport from2003. Art and Design, Media, Public Services and Travel andTourism from 2004. ICT from 2008.NUMBER OF UNITS/STRUCTURE:OCR level 3 National Certificate (six units) (360 guided learninghours)To be awarded the OCR level 3 National Certificate, candidatesmust achieve a minimum Pass grade for:gfour mandatory unitsgtwo optional units.The OCR level 3 National Certificate contains a career planningunit and a work experience unit. Only one of these units maycount towards achievement of the full certificate.OCR level 3 National Diploma (12 units) (720 guidedlearning hours)To be awarded the OCR level 3 National Diploma, candidates must:gachieve a minimum Pass grade for all four mandatory unitsgcomplete eight optional units and achieve at least six ofthese. A maximum of five non-specialist units may be chosengachieve a minimum of 12 points for all units completed (seeCompensation).Specialist pathways within the OCR level 3 National DiplomaIf a candidate achieves a minimum Pass grade for at least fourof the eight optional units from any one specialist pathway, theOCR level 3 National Diploma will be endorsed with the pathwayspecialism. If candidates achieve a minimum Pass grade for fouroptional units from one specialist pathway and a minimum Passgrade for a further four optional units from another specialistpathway, their OCR level 3 National Diploma will be endorsed withboth pathway specialisms.OCR level 3 National Extended Diploma (18 units) (1,080guided learning hours)To be awarded the OCR level 3 National Extended Diploma,candidates must:gachieve a minimum Pass grade for all four mandatory unitsgcomplete 14 optional units and achieve at least 12 of these.A maximum of six non-specialist units may be chosengachieve a minimum of 18 points for all units completed (seeCompensation).The structure of the OCR level 3 National Extended Diploma hasbeen designed to provide breadth of knowledge, understandingand skills across a sector. This ensures that successfulcandidates will have achieved a suitable mix of units acrossoptional units to adequately prepare them for employment orfurther study within the sector. Due to the broad areas ofknowledge and skills required to achieve this qualification, nospecialist endorsement is applicable.CompensationCandidates must complete the required number of units. However,compensation is available for candidates who might fail one ortwo optional units but achieve Distinction or Merit grades forsome other units.Each unit is based on approximately 60 guided learning hours.ASSESSMENT METHOD:All units are internally assessed and externally moderated by OCR.Internal assessment involves candidates producing a portfolio ofevidence showing that they can meet all the assessment objectives.Portfolios of work must be produced independently. They willneed to be made available, together with witness statements andany other supporting documentation, to the OCR visitingmoderator when required. Centres are able to enter candidates’work for external moderation at any time during the year.DATE OF RESULT PUBLICATION:Certification is on demand.GRADING SYSTEM:The units that make up these qualifications are graded Pass,Merit or Distinction and, depending on a candidate’sachievements at unit level, an overall grade of Pass, Merit orDistinction is allocated to each full qualification.134 <strong>UK</strong> QUALIFICATIONS
<strong>Qualifications</strong> currently offeredOCR allocates points to each unit grade achieved by a candidateas follows:Fail = 0 points, Pass = 1 point, Merit = 2 points, Distinction =3 points.Compensation allows an OCR level 3 National Diploma or OCRlevel 3 National Extended Diploma candidate to fail a maximum oftwo optional units, but still achieve the full qualification if theirtotal points equal at least:g12 points for the OCR level 3 National Diplomag18 points for the OCR level 3 National Extended Diploma.As there are broad overall grades for OCR Nationals, for the purposesof the UCAS Tariff, grades/bands within each Pass, Merit andDistinction grade for the OCR level 3 National Diploma (12 units) andOCR level 3 National Extended Diploma (18 units) will be reported.OCR has undertaken to communicate these reporting grades/bandsto both their centres and candidates and also to transmit thereporting grade/band, along with the overall grade, to UCAS forconfirmation and Clearing. The points allocated are as follows.OCR NATIONAL CERTIFICATE (SIX UNITS)Grade OCR Points Reporting Grade UCAS Tariff pointsDistinction 14-18 D 120Merit 10-13 M 80Pass 6-9 P 40OCR NATIONAL DIPLOMA (12 UNITS)Grade OCR Points Reporting Grade UCAS Tariff pointsDistinction 28-36 D 240Merit 20-22 M2 16023-27 M1 200Pass 12-14 P3 8015-17 P2 12018-19 P1 160OCR NATIONAL EXTENDED DIPLOMA (18 UNITS)Grade OCR Points Reporting Grade UCAS Tariff pointsDistinction 42 D2 32043-54 D1 360Merit 30-34 M3 24035-36 M2 28037-41 M1 320Pass 18-21 P3 12022-26 P2 16027-29 P1 200QUALITY ASSURANCE:Quality assurance and control is implemented through:gggggqualification specifications which define requirements andprovide additional guidancecentre approval process that ensures centres meet specifiedquality criteriaexternal moderation of internally assessed units to ensurenational standards are maintainedtraining events for centresmoderator training, standardisation and monitoring/feedback.PROGRESSION/ARTICULATION:Progression is available from the six-unit OCR level 3 NationalCertificate to the 12-unit OCR level 3 National Diploma or 18-unitOCR level 3 National Extended Diploma respectively. In addition,candidates could progress to further study in FE or HE at level 4,or into employment and undertake an NVQ at a level appropriateto their job role.OCR Level 3 CambridgeTechnical Certificates,Introductory Diplomas,Subsidiary Diplomas, Diplomas,Extended Diplomas (QCF)ABBREVIATION:OCR Cambridge TECQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 3BACKGROUND:These qualifications are part of a suite available at levels 2 and 3which cover a range of sectors, eg business, IT, and health andsocial care. They provide a theoretical background to the sectorand relevant practical skills that will prepare learners for entryinto employment or progression and continuation of study in thevocational area through FE or HE. They are unit-basedqualifications. Units are 10 credits and qualifications are 30, 60,90, 120 or 180 credits.OCR Cambridge Technical qualifications are suitable for 16-19-year-olds or more mature learners considering a career changeor return to work, or those wishing to find a vocational route intofurther study.DATE OF FIRST TEACHING:2012NUMBER OF UNITS/STRUCTURE:<strong>Qualifications</strong> are achieved through achieving a specified amountof credit from mandatory and optional units.OCR Level 3 Cambridge Technical Certificates are 30 credits(180 guided learning hours)OCR Level 3 Cambridge Technical Introductory Diplomas are60 credits (360 guided learning hours)OCR Level 3 Cambridge Technical Subsidiary Diplomas are90 credits (540 guided learning hours)OCR Level 3 Cambridge Technical Diplomas are 120 credits(720 guided learning hours)OCR Level 3 Cambridge Technical Extended Diplomas are180 credits (1080 guided learning hours)ASSESSMENT METHOD:All units are internally assessed and externally moderated byOCR. Internal assessment involves candidates producing aportfolio of evidence which shows they have met specifiedoutcomes.Portfolios of work must be produced independently. They willneed to be available, together with any witness statements andother supporting documentation, to the OCR visiting moderatorwhen required. Centres are able to enter candidates’ work forexternal moderation at any time during the year.DATE OF RESULT PUBLICATION:On demand.GRADING SYSTEM:Each unit is graded Pass, Merit or Distinction.Each qualification will have an overall grade consisting of Pass,Merit, Distinction or Distinction* grades, as below:OCR level 3 Cambridge Technical Certificates, 30 creditsGrade UCAS pointsD* 70D 60M 40P 20<strong>UK</strong> QUALIFICATIONS 135
<strong>Qualifications</strong> currently offeredOCR level 3 Cambridge Technical Certificates, 30 creditsGrade UCAS pointsD* 70D 60M 40P 20OCR level 3 Cambridge Technical Introductory Diplomas,60 creditsGrade UCAS pointsD* 70D 60M 40P 20OCR level 3 Cambridge Technical Subsidiary Diplomas, 90 creditsGrade UCAS pointsD*D* 210D*D 200DD 180DM 160MM 120MP 100PP 60OCR level 3 Cambridge Technical Diplomas, 120 creditsGrade UCAS pointsD*D* 280D*D 260DD 240DM 200MM 160MP 120PP 80OCR level 3 Cambridge Technical Extended Diplomas, 180 creditsGrade UCAS pointsD*D*D* 420D*D*D 400D*DD 380DDD 360DDM 320DMM 280MMM 240MMP 200MPP 160PPP 120QUALITY ASSURANCE:Quality assurance and control is implemented through:gggqualification specifications which define requirements andprovide additional guidancecentre approval process that ensures centres meet specifiedquality criteriaexternal moderation of internally assessed units to ensurenational standards are maintained.PROGRESSION/ARTICULATION:Candidates can progress through the Cambridge Technicalqualifications, topping up from one size of qualification to the nextif that suits their needs. Or they can progress to further study inFE or HE at level 4, or into employment and further careerprogression by undertaking other vocational qualifications at thelevel appropriate to their job role.OCR Level 3 Diploma for theChildren and Young People’sWorkforceQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 3BACKGROUND:The OCR Level 3 Diploma for the Children and Young People’sWorkforce has been developed as a credit-based vocational,competence-based qualification. This means that it recognises alearner’s skills, knowledge and understanding of children andyoung people. It also recognises, within a work situation, thelearner’s ability to demonstrate competence in engaging andsupporting children and young people. The qualification isrecognised by employers in relation to the Children and YoungPeople’s Workforce in England only.The qualification is designed primarily for those who work withinthe children and young people’s workforce and it is based on thenational occupational standards developed by the Sector SkillsCouncil, Skills for Care and Development. This means thatlearners will gain the sector-relevant knowledge that is highlysought after by employers. Individuals will have demonstratedthat they have taken responsibility and exercised autonomy andmade judgements subject to overall direction and guidance. Theywill also have demonstrated an appropriate knowledge of theapplication of the appropriate legislation.DATE OF FIRST TEACHING:2010PREREQUISITES:There are no prerequisites for this qualification. The qualificationis open to learners from the age of 16 onwards, of either gender,and there are no entry barriers on grounds of race, creed orprevious academic attainment or learning. However, the learnersmust be working, and demonstrating competence in the field ofcaring for children and young people, in order to access thequalification’s requirements.NUMBER OF UNITS/STRUCTURE:The qualification comprises five unit groupings: one core group ofmandatory units (Group A) consisting of 11 units; three ‘pathway’groups of mandatory units (Groups B, C and D) consisting of 5, 3and 3 units respectively; and one group of optional units (GroupE) consisting of 41 units.To achieve this qualification, learners must gain a total of 65credits made up from:gthe 11 mandatory units which comprise Group A , plusgone mandatory pathway from a choice of either Group B, Cor D, plusga selection from the optional units of Group E.ASSESSMENT METHOD:All units are locally assessed by the centre against the set ofassessment criteria detailed in the unit.Candidates must demonstrate that they have evidenced andachieved all the assessment criteria as specified in the unit.Portfolios presented for assessment must include all the evidencerequired by OCR.GRADING SYSTEM:Pass/FailQUALITY ASSURANCE:Assessment decisions taken by the centre are internally verified,and then externally verified by OCR.PROGRESSION/ARTICULATION:Progression routes are in the following areas:136 <strong>UK</strong> QUALIFICATIONS
<strong>Qualifications</strong> currently offeredHealth and Social CaregLevel 5 Diploma in Health and Social CareLearning, Development and Support ServicesgLevel 4 Diploma in Leadership and Management for CareServicesgLevel 4 Diploma in Learning, Development and SupportServices for Children and Young People and those thatsupport themManagementgLevel 5 Diploma in Management (NVQ)Teaching/TraininggLevel 4 Award in Preparing to Teach in the Lifelong LearningSectorgLevel 4 Certificate in Teaching in the Lifelong Learning SectorgLevel 5 Additional Diploma in Teaching English (Literacy) inthe Lifelong Learning SectorgLevel 5 Additional Diploma in Teaching Mathematics(Numeracy) in the Lifelong Learning SectorgLevel 5 Diploma in Teaching English (Literacy) in the LifelongLearning SectorgLevel 5 Diploma in Teaching in the Lifelong Learning SectorOCR Preparing to Teach in theLifelong Learning Sector (PTLLS)AwardNATIONAL QUALIFICATIONS FRAMEWORK LEVEL:Levels 3 and 4BACKGROUNDThe OCR levels 3 and 4 Preparing to Teach in the LifelongLearning Sector (PTLLS) awards have been developed incollaboration with Lifelong Learning <strong>UK</strong> and provide a basicminimum standard for all those entering the teaching professionfrom September 2007. This is an introductory qualification for allnew teachers in the Lifelong Learning sector.The awards confer a threshold licence to teach. From September2007 all new teachers must gain a Licence to Practise at thestart of their career – this is mandatory for anyone who teachesin publicly funded provision. The PTLLS awards are one way ofgaining a licence to practise.The awards are available at two levels to reflect different entrylevels of future teachers, tutors and trainers. Each level is madeup of one six-credit unit and involves an initial assessment ofliteracy, numeracy and ICT needs, 60 hours of learning in totalwith at least 30 guided learning hours, observed practice ormicro teaching sessions and mentoring support.The awards are appropriate for those who wish to start a careerin teaching or training and help the learner to understand theirown role, responsibilities and boundaries in relation to teachingand understand appropriate teaching and learning approaches intheir specialist area. In addition, learners will be able todemonstrate session planning skills, understand how to deliverinclusive sessions which motivate learners and understandthe use of different assessment methods and the need forrecord keeping.DATE OF FIRST TEACHING:September 2007PREREQUISITES:There are no formal entry requirements for this qualificationalthough it is expected that someone enrolling on an initial awardwill normally possess at least a minimum level 3 qualification inhis/her own area of specialism.PROGRESSION/ARTICULATION:OCR levels 3 and 4 Certificates in Teaching in the LifelongLearning Sector.OCR Certificate in Teaching inthe Lifelong Learning SectorNATIONAL QUALIFICATIONS FRAMEWORK LEVEL:Levels 3 and 4BACKGROUNDThe OCR levels 3 and 4 Certificates in Teaching in the LifelongLearning Sector have been developed in collaboration withLifelong Learning <strong>UK</strong> and are aimed at those in an associateteacher role from September 2007.An associate teacher is someone who will teach predominantlyfrom packs or pre-prepared materials, and therefore has fewerresponsibilities in the design of a curriculum and materialsgenerally when compared with a full teacher role. They mightteach or tutor on a one-to-one basis and will normally bedelivering on a programme confined to a particular level, subjector type of learner. They might also be a teacher who only deliversshort courses.The OCR levels 3 and 4 Certificates in Teaching in the LifelongLearning Sector are part of the initial teaching qualificationswhich have been developed for existing and new teachers whoare involved in teaching in the Lifelong Learning Sector.The certificates are made up of three mandatory units worth18 credits and optional units at least to the value of six credits,making a total of minimum 24 credits. Mandatory units includePreparing to teach in the lifelong learning sector, Planning andenabling learning and Principles and practice of assessment.The OCR levels 3 and 4 Certificates in Teaching in the LifelongLearning Sector include at least 30 hours of teaching practice.There are a minimum of three teaching observations totalling aminimum of three hours.DATE OF FIRST TEACHING:September 2007PREREQUISITESThere are no formal entry requirements for this qualification.However, candidates will need to have followed programmes ofstudy at level 3 (or above) and have relevant and appropriateexperience or qualifications in the subject/vocational area thatthey are teaching.Sevenoaks School Certificate(SSC)BACKGROUND:Sevenoaks School Certificate: English Literature is exclusive toSevenoaks School. It replaces the GCSE qualification, which wasfelt by staff to be insufficiently inspiring and not the bestpreparation for the IB. The new school-based certificate demandsa wide range of skills, exposes students to a broad andinternational range of literature, as well as covering a variety ofgenres and historical periods. A more interdisciplinary approach isencouraged in the teaching and learning, while independentcreativity and critical thinking are key concepts of the course.DATE OF FIRST TEACHING:2010<strong>UK</strong> QUALIFICATIONS 137
<strong>Qualifications</strong> currently offeredDATE OF FIRST AWARD: :2012PREREQUISITES:The course is undertaken in Year 10 and Year 11 by allSevenoaks students.NUMBER OF UNITS/STRUCTURE:The Sevenoaks School Certificate in English Literature is taughtalongside IGCSE English Language. In the Michaelmas term ofYear 10, students study a modern play, engage in creative writingand study world literature short stories, delivering formal oralpresentations on the latter; they also have an introduction tocritical essay writing skills. In the Lent term, the focus is oncomparative poetry, and students also undertake unseen poetryanalysis. In the summer term, a Shakespeare text is studied;there is further unseen analysis and creative writing, andstudents begin looking at a substantial pre-1914 text. In Year 11,pupils complete the pre-1914 text, finalise their writtencoursework folders, and prepare for the final examinations, whichcomprise one closed-text paper on a modern novel and a secondpaper assessing unseen poetry analysis skills.ASSESSMENT METHOD:A range of assessment methods is employed, including a portfolioof written coursework (40%), oral assessment (10%), andterminal examination (50%).EXAMINATION TIMING:The terminal examinations take place in June of Year 11, withregular and scheduled opportunities for written and oralassessment throughout the two years of the course.DATE OF RESULT PUBLICATION:Sevenoaks publishes the SSC results at the same time as therelease of GCSE and IGCSE results in August of Year 11.GRADING SYSTEM:The school awards grades A* - U, in common with (I)GCSE, A*being the highest grade, and U representing an unclassifiedgrade. The standard is intended to be at least as high as theequivalent (I)GCSE grade, though comparison is not whollymeaningful as the aims and objectives of the course, as well assome of the skills demanded, differ from the national standardqualification.QUALITY ASSURANCE:Each course is internally examined and moderated, but finalmoderation is undertaken by an independent external specialist,and there is a re-mark facility involving a second external marker,with a separate appeals process available for students andparents.PROGRESSION/ARTICULATION:The chief aim of the Sevenoaks School Certificate is to helpprepare students for the IB Diploma and to equip them with therelevant knowledge, understanding and skills required in the sixthform. As such, it is coherent in design, rigorous in assessment,and promotes the values of intellectual enquiry in the student.Sports Leaders <strong>UK</strong> level 3Certificate in Higher SportsLeadership (QCF)QUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 3BACKGROUND:The level 3 Certificate in Higher Sports Leadership is a nationallyrecognised qualification that enables successful candidates tolead unsupervised groups of people in sport and recreationalactivities.The level 3 Certificate in Higher Sports Leadership is a vitalbridge to employment, further training and volunteering, andbuilds upon the skills and experience gained through the SportsLeadership <strong>UK</strong> level 1 and 2 qualifications.The qualification teaches generic leadership skills such asorganisation, planning, communication and teamwork through themedium of sport.Higher Sports Leaders are valued for the independentcontribution they make to organised sport in schools, collegesand universities, and provide a valuable resource in theorganisation of sports days, tournaments and community events.PREREQUISITES:Level 2 Award in Community Sports Leadership/Level 2 Award inSports LeadershipNUMBER OF UNITS/STRUCTURE:The level 3 Certificate in Higher Sports Leadership consists ofeight units of work and takes 107 hours to deliver, of which 30hours have to show practical application to leadership.ASSESSMENT METHOD:Internally Assessed and Externally VerifiedGRADING SYSTEM:Pass/FailGrade UCAS Tariff pointsPass 30QUALITY ASSURANCE:Accredited by Sports Leaders <strong>UK</strong>. For more information visitwww.sportsleaders.orgPROGRESSION:Sports Leaders <strong>UK</strong> awards and qualifications enhance academicdegree programmes. They add value to foundation andundergraduate courses through vocational experience andprovide training for students seeking volunteering experience.The level 3 Certificate in Higher Sports Leadership is a bridge toemployment, demonstrating that Higher Sports Leaders possessexperience and skills that go far beyond leading sport.Technical CertificateBACKGROUND:Technical Certificates are vocational qualifications identified bysector bodies (eg SSCs) and awarding bodies that provide theunderpinning knowledge and understanding relevant to an NVQas part of an Apprenticeship framework.They:ggggare capable of delivery through a taught programmeof learningpermit a structured approach to the teaching andassessment of the underpinning knowledge andunderstanding of an NVQensure that the theoretical knowledge required to achieve anApprenticeship is clearly demonstratedretain their original qualification title.The technical certificate will support the learning required for theNVQ and provide a basis for progression.138 <strong>UK</strong> QUALIFICATIONS
<strong>Qualifications</strong> currently offeredNUMBER OF UNITS/STRUCTURE:The size of a technical certificate can vary, depending on therelevant occupational sector and NTO advice.ASSESSMENT METHOD:All qualifications accredited in the National <strong>Qualifications</strong>Framework or <strong>Qualifications</strong> and Credit Framework must includea form of independent assessment or an alternative approved bythe regulatory authorities. Independent assessment is defined asassessment of a candidates’ work that is carried out byassessors who do not have a vested interest in the outcome. Oneform of independent assessment is external assessment, whereassessment tasks are set, and candidates’ work assessed, by theawarding body. External assessment can consist of case studywork, multiple choice items, centrally set projects or assignmentsor written tests, for example.Trinity College LondonFrom the conduct of its first examinations in the 1870s until itsindependent establishment in 1992 Trinity’s examinations wereconducted from within Trinity College of Music, one of the major<strong>UK</strong> conservatoires. Trinity College London (hereafter referred to as‘Trinity’) still maintains a close association with Trinity College ofMusic, now integrated with Laban as Trinity Laban, which is thelargest conservatoire in Europe for the study of music andcontemporary dance.Trinity offers examinations and teaching qualifications in music,speech, drama, dance, ESOL and TESOL within the UnitedKingdom, across Europe and world-wide. In the last year fullyreported, candidates across the subject range totalled almost halfa million.Trinity is an awarding organisation recognised in the UnitedKingdom by the Office of <strong>Qualifications</strong> Examinations Regulation(Ofqual) in England, the Welsh Assembly Government, and theNorthern Ireland Council for Curriculum, Examinations andAssessment. Trinity’s qualifications are accredited by theseauthorities within the <strong>Qualifications</strong> Framework.Trinity Guildhall Associate andLicentiate Diplomas in Dramaand SpeechQUALIFICATION ABBREVIATION:ATCL and LTCLQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:ATCL Diplomas are accredited in level 4LTCL Diplomas are accredited in level 6BACKGROUND:Available in:ATCL Diploma in Performing (Speech and Drama), LTCL Diplomain Performing (Speech and Drama), ATCL Diploma in Performing(Musical Theatre), LTCL Diploma in Performing (Musical Theatre),ATCL Diploma in Performing (Performance Arts), ATCL Diploma inCommunication Skills (Public Speaking), LTCL Diploma inCommunication Skills (Public Speaking), LTCL Diploma inPerforming (Performance Arts), ATCL Diploma in Teaching(Speech and Drama), LTCL Diploma in Teaching (Speech andDrama), ATCL Diploma in Teaching (Theatre Arts), LTCL Diplomain Teaching (Musical Theatre), LTCL Diploma in Teaching(Performance Arts), LTCL Diploma in Teaching (Applied Drama),ATCL Diploma in Teaching (Communication Skills), LTCL Diplomain Teaching (Communication Skills).Detailed information can be obtained from Trinity College (seeAppendix A for contact details).Candidates for Licentiate-level diplomas may opt to be awardedeither the letters LTCL (Licentiate of Trinity College London) orLGSMD (Licentiate of Guildhall School of Music & Drama) on theircertificate.DATE OF FIRST TEACHING:2003DATE OF FIRST AWARD:2004PREREQUISITES:There are no formal prerequisites for the ATCL diploma butcandidates are advised to gain Grade 8 in Speech andDrama/Musical Theatre or equivalent.For entry to the LTCL diploma, candidates should be at astandard equivalent to ATCL.NUMBER OF UNITS/STRUCTURE:Trinity qualifications are unitised according to discipline and level.ASSESSMENT METHOD:100% external assessment conducted by Trinity examiners.EXAMINATION TIMING:Examinations are available all year round.DATE OF RESULT PUBLICATION:Results are confirmed by issue of a Certificate.GRADING SYSTEM:Distinction, Pass, Below Pass. Outcome statements and criteriadescribing the various levels of achievement required for eachattainment band are included in the syllabuses.QUALITY ASSURANCE:Marks are analysed at Trinity’s head office before results areconfirmed by issue of a Certificate. A significant proportion ofwritten examinations are double marked and some performanceexaminations are recorded for the purpose of monitoring.Examiners are standardised annually and observed regularly by asenior examiner.Trinity Guildhall Associate andLicentiate Diplomas in MusicQUALIFICATION ABBREVIATION:ATCL/AMusTCL or LTCL/LMusTCLQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:ATCL Diplomas are accredited in level 4LTCL Diplomas are accredited in level 6BACKGROUND:These diplomas have a wider remit than Trinity’s traditionalqualifications, and embrace non-Western music, jazz, commercial andpopular music sectors, as well as vocational and analytical aspects.The following awards are available:ATCL Diploma in Music Performance (ATCL Recital), LTCL Diplomain Music Performance (LTCL Recital), ATCL Diploma in Pro-MusicPerformance, LTCL Diploma in Pro-Music Performance, AMusTCLDiploma in Music Literacy, LMusTCL Diploma in Music Literacy,LTCL Diploma in Music Composition, ATCL Diploma in Principles ofInstrumental/Vocal Teaching, LTCL Diploma in Instrumental/VocalTeaching, LTCL Diploma in Music Teaching.Detailed information can be obtained from Trinity College (seeAppendix A for contact details).<strong>UK</strong> QUALIFICATIONS 139
<strong>Qualifications</strong> currently offeredDATE OF FIRST TEACHING:1877DATE OF FIRST AWARD:1877PREREQUISITES:Equivalent standard to NQF level 3 for entry to ATCL. Equivalentstandard to ATCL for entry to LTCL.NUMBER OF UNITS/STRUCTURE:Trinity qualifications are unitised.ASSESSMENT METHOD:100% external assessment conducted by Trinity examiners.EXAMINATION TIMING:Examinations are available all year round.DATE OF RESULT PUBLICATION:Results are confirmed by issue of a Certificate.GRADING SYSTEM:Distinction, Pass, Below Pass. Outcome statements and criteriadescribing the various levels of achievement required for eachattainment band are included in the syllabuses.QUALITY ASSURANCE:Marks are analysed at Trinity’s head office before results areconfirmed by issue of a Certificate.Performance examinations are recorded.A proportion of written examinations are double-marked.Examiners are standardised annually and observed regularly by asenior examiner.Trinity Guildhall FellowshipDiplomas in Drama and SpeechQUALIFICATION ABBREVIATION:FTCLQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 7BACKGROUND:Available in:FTCL Diploma in Performing (Speech and Drama), FTCL Diplomain Performing (Musical Theatre), FTCL Diploma in Performing(Performance Arts), FTCL Diploma in Directing (Speech andDrama), FTCL Diploma in Directing (Musical Theatre), FTCLDiploma in Directing (Performance Arts), FTCL Diploma inEducation Studies (Speech and Drama), FTCL Diploma inEducation Studies (Musical Theatre), FTCL Diploma in EducationStudies (Performance Arts), FTCL Diploma in Education Studies(Communication Skills), FTCL Diploma in Education Studies(Applied Drama).Detailed information can be obtained from Trinity College (seeAppendix A for contact details).DATE OF FIRST TEACHING:1918DATE OF FIRST AWARD:1918PREREQUISITES:LTCL Performing (Speech and Drama or Musical Theatre) orequivalent.NUMBER OF UNITS/STRUCTURE:Trinity qualifications are unitised.ASSESSMENT METHOD:100% external assessment conducted by Trinity examiners.EXAMINATION TIMING:Examinations are available all year round.DATE OF RESULT PUBLICATION:Results are confirmed by issue of a Certificate.GRADING SYSTEM:Pass, Below Pass. Outcome statements and criteria describingthe level of achievement required are included in the syllabus.QUALITY ASSURANCE:Marks are analysed at Trinity’s head office before results areconfirmed by issue of a Certificate.A significant proportion of written examinations are doublemarked and some performance examinations are recorded forthe purpose of monitoring.Examiners are standardised annually and observed regularly by asenior examiner.Trinity Guildhall FellowshipDiplomas in MusicQUALIFICATION ABBREVIATION:FTCL/FMusTCLQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 7BACKGROUND:These diplomas demand higher level skills, including publicconcert standard performance, planning, development andpromotional abilities, and critical reflection.They are available in the following subjects:FTCL Diploma in Music Performance (FTCL Recital), FMusTCLDiploma in Music Literacy, FTCL Diploma in Music Composition,FTCL Diploma in Music Education.Detailed information can be obtained from Trinity College (seeAppendix A for contact details).DATE OF FIRST TEACHING:1877DATE OF FIRST AWARD:1877PREREQUISITES:Candidates are advised that they should ideally be at anequivalent standard to LTCL before entering for the FTCLDiploma.Candidates must provide evidence that they have performed inpublic over a period of at least two years.NUMBER OF UNITS/STRUCTURE:Trinity qualifications are unitised.ASSESSMENT METHOD:100% external assessment conducted by Trinity examiners.EXAMINATION TIMING:Examinations are available all year round.DATE OF RESULT PUBLICATION:Results are confirmed by issue of a Certificate.140 <strong>UK</strong> QUALIFICATIONS
<strong>Qualifications</strong> currently offeredGRADING SYSTEM:Pass, Below Pass. Outcome statements and criteria describingthe level of achievement required are included in the syllabus.QUALITY ASSURANCE:Marks are analysed at Trinity’s head office before results areconfirmed by issue of a Certificate.Examiners are standardised annually and observed regularly by asenior examiner.Trinity College London GradedExaminations in CommunicationSkills (Grades 1 to 8)QUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Grades 1–3 = level 1, Grades 4–5 = level 2, Grades 6–8 = level 3BACKGROUND:Trinity Guildhall graded examinations in communication skills aredesigned to allow candidates to develop and refine expertise indifferent registers of communication through spoken English.These examinations assess a candidate’s ability to engage withanalytical and critical concepts, to persuade, to negotiate, tosummarise and to communicate information, ideas and opinionsin a variety of contexts.DATE OF FIRST TEACHING:1918DATE OF FIRST AWARD:1918PREREQUISITES:None, but the syllabus is cumulative and entry assumes masteryof the previous grade.NUMBER OF UNITS/STRUCTURE:Each grade comprises one unit.ASSESSMENT METHOD:100% external assessment conducted by a Trinity examiner.EXAMINATION TIMING:Examinations are available all year round.DATE OF RESULT PUBLICATION:Results are confirmed by issue of a Certificate.GRADING SYSTEM:Distinction, Merit, Pass, Below Pass. Outcome statements andcriteria describing the various levels of achievement required foreach attainment band are included in the syllabuses.QUALITY ASSURANCE:Marks entered onto report forms are analysed at Trinity’s headoffice before results are confirmed by issue of a Certificate.Examiners are standardised annually and are observed regularlyby a senior examiner. A proportion of examinations are recordedfor the purpose of monitoring.Trinity Guildhall GradedExaminations in IndividualActing Skills, Acting in Pairs,Shakespeare, Musical Theatre,Performance ArtsQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Grades 1–3 = Level 1, Grades 4–5 = Level 2, Grades 6–8 =Level 3BACKGROUND:Trinity’s graded examinations in drama are designed toencourage candidates from all countries and cultures to engagewith as wide a variety of performance activities and materials aspossible while developing their skills within an integratedframework of assessment.They offer candidates opportunities to demonstrate performanceskills appropriate to their individual interests and aspirations.Graded examinations in drama are available as individual, pairand group assessments (group option is not accredited by Ofqual)in acting, shakespeare, musical theatre, performance arts andworld dramatists.DATE OF FIRST TEACHING:1918DATE OF FIRST AWARD:1918PREREQUISITES:None, but the syllabus is cumulative and entry assumes masteryof the previous grade.NUMBER OF UNITS/STRUCTURE:Each grade comprises one unit.ASSESSMENT METHOD:100% external assessment conducted by a Trinity examiner.EXAMINATION TIMING:Examinations are available all year round.DATE OF RESULT PUBLICATION:Results are confirmed by issue of a Certificate.GRADING SYSTEM:Distinction, Merit, Pass, Below Pass. Outcome statements andcriteria describing the various levels of achievement required foreach attainment band are included in the syllabuses.QUALITY ASSURANCE:Marks entered onto report forms are analysed at Trinity’s headoffice before results are confirmed by issue of a Certificate.Examiners are standardised annually and are observed regularlyby a senior examiner. A proportion of examinations are recordedfor the purpose of monitoring.Trinity Guildhall GradedExaminations in MusicLiteracy/TheoryQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Grades 1–3 = level 1, Grades 4–5 = level 2, Grades 6–8 = level 3BACKGROUND:Graded examinations in theory of music aim to provide a solidfoundation in music literacy: the conventions of Western musicnotation, melody, rhythm and harmony. At the higher levels, these<strong>UK</strong> QUALIFICATIONS 141
<strong>Qualifications</strong> currently offeredqualifications also assess basic knowledge of musical history,form and instrumental capabilities (eg range).DATE OF FIRST TEACHING:1877DATE OF FIRST AWARD:1877DATE OF LAST AWARD:CurrentPREREQUISITES:None, but the syllabus is cumulative and entry assumes masteryof the previous grade.NUMBER OF UNITS/STRUCTURE:Each grade comprises one unit.ASSESSMENT METHOD:100% external assessment conducted by Trinity examiners – allpapers are double marked.EXAMINATION TIMING:Examinations are available in May and November.DATE OF RESULT PUBLICATION:Results are confirmed by issue of a Certificate.GRADING SYSTEM:Distinction, Merit, Pass, Below Pass. Outcome statements andcriteria describing the various levels of achievement required foreach attainment band are included in the syllabuses.GradeUCAS Tariff pointsGrade 8 (Distinction) 30Grade 8 (Merit) 25Grade 8 (Pass) 20Grade 7 (Distinction) 20Grade 7 (Merit) 15Grade 7 (Pass) 10Grade 6 (Distinction) 15Grade 6 (Merit) 10Grade 6 (Pass) 5QUALITY ASSURANCE:Marks are analysed at Trinity’s head office before results areconfirmed by issue of a Certificate.Examiners are standardised annually and are observed regularlyby a senior examiner.Trinity Guildhall GradedExaminations in MusicPerformanceQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Grades 1–3 = level 1, Grades 4–5 = level 2, Grades 6–8 = level 3BACKGROUND:Trinity’s graded examinations in music are offered in 45instruments covering keyboard, strings, woodwind, brass,percussion and voice. They span eight grades and the schemesof assessment are based upon a clearly defined syllabus ofincremental standards and repertoire.Trinity also offers the Performer’s Certificate as a post-grade 8qualification.DATE OF FIRST TEACHING:1877DATE OF FIRST AWARD:1877PREREQUISITES:None, but the syllabus is cumulative and entry assumes masteryof the previous grade.NUMBER OF UNITS/STRUCTURE:Each grade comprises one unit.ASSESSMENT METHOD:100% external assessment conducted by a Trinity examiner.EXAMINATION TIMING:Examinations are available all year round.DATE OF RESULT PUBLICATION:Results are confirmed by issue of a Certificate.GRADING SYSTEM:Distinction, Merit, Pass, Below Pass. Outcome statements andcriteria describing the various levels of achievement required foreach attainment band are included in the syllabuses.GradeUCAS Tariff pointsGrade 8 (Distinction) 75Grade 8 (Merit) 70Grade 8 (Pass) 55Grade 7 (Distinction) 60Grade 7 (Merit) 55Grade 7 (Pass) 40Grade 6 (Distinction) 45Grade 6 (Merit) 40Grade 6 (Pass) 25QUALITY ASSURANCE:Marks entered onto report forms are analysed at Trinity’s headoffice before results are confirmed by issue of a Certificate.Examiners are standardised annually and are observed regularlyby a senior examiner. A proportion of examinations are recordedfor the purpose of monitoring.PROGRESSION/ARTICULATION:These qualifications facilitate progression to level 2 of the QCF,including Grades 4 and 5.Trinity Guildhall GradedExaminations in Rock & PopQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Grades 1–3 = level 1, Grades 4–5 = level 2, Grades 6–8 = level 3BACKGROUND:Trinity’s graded examinations in rock & pop are offered for bass,drums, guitar, keyboards and vocals. They span eight grades andthe schemes of assessment are based upon a clearly definedsyllabus of incremental standards and repertoire.DATE OF FIRST TEACHING:2012DATE OF FIRST AWARD:2012PREREQUISITES:None, but the syllabus is cumulative and entry assumes masteryof the previous grade.NUMBER OF UNITS/STRUCTURE:Each grade comprises one unit.ASSESSMENT METHOD:100% external assessment conducted by a Trinity examiner.EXAMINATION TIMING:Examinations are available all year round.142 <strong>UK</strong> QUALIFICATIONS
<strong>Qualifications</strong> currently offeredDATE OF RESULT PUBLICATION:Results are confirmed by issue of a certificate.GRADING SYSTEM:Distinction, Merit, Pass, Below Pass. Outcome statements andcriteria describing the various levels of achievement required foreach attainment band are included in the syllabuses.Rock & Pop has been submitted to UCAS for inclusion in theTariff.QUALITY ASSURANCE:Marks entered onto report forms are analysed at Trinity’s headoffice before results are confirmed by issue of a certificate.Examiners are standardised annually and are observed regularlyby a senior examiner. A proportion of examinations are recordedfor the purpose of monitoring.PROGRESSION/ARTICULATION:These qualifications facilitate progression to level 2 of the QCF,including Grades 4 and 5.Trinity Guildhall GradedExaminations in Performing TextQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Grades 1–3 = level 1, Grades 4–5 = level 2, Grades 6–8 = level 3BACKGROUND:The aim of Trinity’s graded examinations in speech is to providean alternative to the speech and drama syllabus for developingperformance skills with candidates who do not wish todemonstrate specific skills in acting. These examinationsconcentrate on performance of verse and prose, and preparedand unprepared reading. They do not require acting orimprovisation but allow for the development of interpretation andpresentation skills. (Trinity also offers graded examinations inchoral speaking, which are not accredited by Ofqual as theyinvolve group assessments).DATE OF FIRST TEACHING:1918DATE OF FIRST AWARD:1918PREREQUISITES:None, but the syllabus is cumulative and entry assumes masteryof the previous grade.NUMBER OF UNITS/STRUCTURE:Each grade comprises one unit.ASSESSMENT METHOD:100% external assessment conducted by a Trinity examiner.EXAMINATION TIMING:Examinations are available all year round.DATE OF RESULT PUBLICATION:Results are confirmed by issue of a Certificate.GRADING SYSTEM:Distinction, Merit, Pass, Below Pass. Outcome statements andcriteria describing the various levels of achievement required foreach attainment band are included in the syllabuses.QUALITY ASSURANCE:Marks entered onto report forms are analysed at Trinity’s headoffice before results are confirmed by issue of a Certificate.Examiners are standardised annually and are observed regularlyby a senior examiner. A proportion of examinations is recorded forthe purpose of monitoring.Trinity Guildhall GradedExaminations in Speechand DramaQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Grades 1–3 = level 1, Grades 4–5 = level 2, Grades 6–8 = level 3BACKGROUND:The aim of Trinity’s graded examinations in speech and dramais to provide a scheme of assessment against whichcandidates, teachers and parents may measure progress anddevelopment, whether towards professional training or as aleisure activity.DATE OF FIRST TEACHING:1918DATE OF FIRST AWARD:1918PREREQUISITES:None, but the syllabus is cumulative and entry assumes masteryof the previous grade.NUMBER OF UNITS/STRUCTURE:Each grade comprises one unit.ASSESSMENT METHOD:100% external assessment conducted by a Trinity examiner.EXAMINATION TIMING:Examinations are available all year round.DATE OF RESULT PUBLICATION:Results are confirmed by issue of a Certificate within eight weeksof the examination.GRADING SYSTEM:Distinction, Merit, Pass, Below Pass. Outcome statements andcriteria describing the various levels of achievement required foreach attainment band are included in the syllabuses.From 2008 Grades 6–8 carry UCAS Tariff points as follows:GradeUCAS Tariff pointsGrade 8 (Distinction) 65Grade 8 (Merit) 60Grade 8 (Pass) 45Grade 7 (Distinction) 55Grade 7 (Merit) 50Grade 7 (Pass) 35Grade 6 (Distinction) 40Grade 6 (Merit) 35Grade 6 (Pass) 20QUALITY ASSURANCE:Marks entered onto report forms are analysed at Trinity’s headoffice before results are confirmed by issue of a Certificate.Examiners are standardised annually and are observed regularlyby a senior examiner. A proportion of examinations is recorded forthe purpose of monitoring.Trinity College London NationalCertificates in ProfessionalActing and Professional Dance(Classical Ballet), (ContemporaryDance)QUALIFICATION ABBREVIATION:DaDA Certificates (Dance and Drama Awards)<strong>UK</strong> QUALIFICATIONS 143
<strong>Qualifications</strong> currently offeredDATE OF FIRST TEACHING:2006DATE OF FIRST AWARD:2006PREREQUISITES:None, but the syllabus is cumulative and entry assumes masteryof the previous level.NUMBER OF UNITS/STRUCTURE:Entry 3 and Level 1 comprises one unit, Level 2 and Level 3comprise two units.ASSESSMENT METHOD:Internal assessment externally moderated by Trinity.EXAMINATION TIMING:Assessments are available all year round.DATE OF RESULT PUBLICATION:Results are confirmed by issue of a Certificate.GRADING SYSTEM:Pass, Below Pass. Outcome statements and criteria describingthe various levels of achievement required for each level areincluded in the syllabus.QUALITY ASSURANCE:Internal assessments are externally moderated by Trinity. Externalmoderation is conducted by trained Trinity moderators who arestandardised annually.Trinity College London Certificatein Safe and Effective DancePracticeQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 5BACKGROUND:This qualification/certification ensures that candidates have goodknowledge of all the elements that make up safe and effective dancepractice. These include basic anatomy and physiology, nutrition, injurymanagement, appropriate resources, etc. Upon completion of thiscertificate, a dance practitioner (eg teacher, director, choreographer)will be able to apply the principles of safe and effective dancepractice to the design and delivery of a dance session.DATE OF FIRST TEACHING:2009DATE OF FIRST AWARD:2009PREREQUISITES:None, but most candidates will have had professional dancetraining and/or professional dance experience, for example as adance teacher, rehearsal director, professional dancer orcommunity dance practitioner.NUMBER OF UNITS/STRUCTURE:This qualification comprises two units.ASSESSMENT METHOD:This qualification is 100% externally assessed.EXAMINATION TIMING:Examinations are available all year round.DATE OF RESULT PUBLICATION:Results are confirmed by issue of a Certificate.GRADING SYSTEM:Distinction, Merit, Pass, Below Pass. Outcome statements andcriteria describing the level of achievement required are includedin the syllabus.QUALITY ASSURANCE:External assessment is conducted by trained Trinity assessorswho are standardised annually.Trinity College London Diplomain Teaching in the LifelongLearning Sector (Dance)QUALIFICATION ABBREVIATION:DTLLS (Dance)QUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 5BACKGROUND:The Diploma in Teaching in the Lifelong Learning Sector (DTLLS)in Dance is designed to qualify teachers working in institutionswhich offer dance education and training to young people andadults in post-compulsory education. It gives Qualified TeacherStatus in Learning and Skills (QTLS).DATE OF FIRST TEACHING:2008DATE OF FIRST AWARD:2008PREREQUISITES:Those who have successfully completed the level 4 Units and metall the required learning outcomes will gain 60 credits at level 4and will then be able to join any DTLLS programme at level 5.Before candidates are accepted on the DTLLS, there should bean initial assessment of their suitability for the proposed course ofstudy. This must review:gggggggglevel and relevance of existing academic orvocational/professional qualifications – eg through a CVlevel of understanding of dance practice (where necessary apractical dance assessment is recommended)level of personal language, literacy, numeracy and ICT skillsand qualifications (see above)study skills support needsprevious teaching experience and subjects taughtmotivation, needs, goals and time available for studyaccess and other individual support needs, including theinvolvement of colleagues from different subject specialismswhere requiredCriminal Record Bureau checks where required.NUMBER OF UNITS/STRUCTURE:This qualification comprises a number of mandatory units andone optional unit.ASSESSMENT METHOD:This qualification involves a combination of internal and externalassessment. Internal assessments are externally moderated byTrinity.EXAMINATION TIMING:Ongoing assessment during course .DATE OF RESULT PUBLICATION:Varies depending on the timing of the course.GRADING SYSTEM:Pass, Below Pass. Outcome statements and criteria describingthe level of achievement required are included in the syllabus.<strong>UK</strong> QUALIFICATIONS 145
<strong>Qualifications</strong> currently offeredQUALITY ASSURANCE:Internal assessments are externally moderated by Trinity.External assessment is conducted by trained Trinity assessorswho are standardised annually.Trinity College London Diplomain Teaching in the LifelongLearning Sector (ESOL)QUALIFICATION ABBREVIATION:DTLLS (ESOL)QUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 5BACKGROUND:This qualification is a requirement for ESOL teachers working in afull teaching role within the lifelong learning sector.DATE OF FIRST TEACHING:2008DATE OF FIRST AWARD:2008PREREQUISITES:See syllabus.NUMBER OF UNITS/STRUCTURE:This qualification comprises a number of mandatory units andone optional unit.ASSESSMENT METHOD:This qualification involves a combination of internal and externalassessment. Internal assessments are externally moderated byTrinity.EXAMINATION TIMING:Ongoing assessment during courseDATE OF RESULT PUBLICATION:Varies depending on the timing of the course.GRADING SYSTEM:Pass, Below Pass. Outcome statements and criteria describingthe level of achievement required are included in the syllabus.QUALITY ASSURANCE:Internal assessments are externally moderated by Trinity.External assessment is conducted by trained Trinity examinerswho are standardised annually.Trinity College London Diplomain Teaching English (ESOL) in theLifelong Learning SectorQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 5BACKGROUND:This qualification is designed for candidates who wish to obtainrelevant qualifications for working as full role ESOL teachers inthe lifelong learning sector.It is also suitable as a stand-alone qualification for candidateswho already possess a relevant generic teaching qualification (egPGCE) or those wishing to take it as part of a larger qualificationDATE OF FIRST TEACHING:2008DATE OF FIRST AWARD:2008PREREQUISITES:See syllabus.NUMBER OF UNITS/STRUCTURE:This qualification comprises two mandatory units and oneoptional unit selected from a group of two.ASSESSMENT METHOD:This qualification involves a combination of internal and externalassessment. Internal assessments are externally moderated byTrinity.EXAMINATION TIMING:Ongoing assessment during course.DATE OF RESULT PUBLICATION:Varies depending on the timing of the course.GRADING SYSTEM:Pass, Below Pass. Outcome statements and criteria describingthe level of achievement required are included in the syllabus.QUALITY ASSURANCE:Internal assessments are externally moderated by Trinity.External assessment is conducted by trained Trinity examinerswho are standardised annually.Trinity College London Award inPreparing to Teach in the LifelongLearning SectorQUALIFICATION ABBREVIATION:PTLLSQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 4BACKGROUND:This qualification provides a threshold licence to teach, allowingindividuals to apply for full teaching roles as ESOL teachers in thelifelong learning sector.DATE OF FIRST TEACHING:2008DATE OF FIRST AWARD:2008PREREQUISITES:See syllabus.NUMBER OF UNITS/STRUCTURE:This is a single unit qualification.ASSESSMENT METHOD:This qualification is internally assessed and externally moderatedby Trinity.EXAMINATION TIMING:Ongoing assessment during courseDATE OF RESULT PUBLICATION:Varies depending on the timing of the course.GRADING SYSTEM:Pass, Below Pass. Outcome statements and criteria describingthe level of achievement required are included in the syllabus.QUALITY ASSURANCE:Internal assessments are externally moderated by Trinity.External moderation is conducted by trained Trinity examinerswho are standardised annually.146 <strong>UK</strong> QUALIFICATIONS
<strong>Qualifications</strong> currently offeredTrinity College London Certificatein Teaching English to Speakersof Other LanguagesQUALIFICATION ABBREVIATION:Cert TESOLQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 5BACKGROUND:This qualification is designed for the trainee with little or noexperience of teaching English in the contemporary ESOLclassroom but with a high level of competence in spoken andwritten English, whether English is the first, second or a foreignlanguage for the trainee. It equips him or her with the most basicskills and knowledge needed to take up a post as a TESOLteacher and give him or her a firm foundation for self-evaluationand further professional development.DATE OF FIRST TEACHING:1980DATE OF FIRST AWARD:1980PREREQUISITES:gas a minimum, qualifications for entry to higher education inthe <strong>UK</strong> or applicant’s own education systemsgcompetence in written and spoken English appropriate to ateacher of English, whether English is applicant’s first,second or foreign language: the varieties of written andspoken English deemed appropriate for a teacher of Englishinclude regional and world varieties as well as BritishStandard English and Received Pronunciation, but successfulapplicant’s levels of competence in English must be of astandard sufficient to enable them to perform the function ofrole models as language teachersgan awareness of the significance of the structure andfunctions of English in teaching the languagegwillingness to work cooperatively as a member of the wholetraining group and respond constructively to feedback onpersonal performancegpotential for combined study including language analysis andpractical training that is rigorous and demanding of time,energy and emotional stamina: full-time intensive and parttimeextensive courses make rather different demands ontrainees in this respectgany other areas of experience or competence, demonstratedthrough tests or tasks not specified by Trinity.NUMBER OF UNITS/STRUCTURE:This qualification comprises five units.ASSESSMENT METHOD:This qualification is internally assessed and externally moderatedby Trinity.EXAMINATION TIMING:Ongoing assessment during course.DATE OF RESULT PUBLICATION:Results are confirmed by issue of a Certificate.GRADING SYSTEM:Pass, Below Pass. Outcome statements and criteria describingthe level of achievement required are included in the syllabus.QUALITY ASSURANCE:Internal assessments are externally moderated by Trinity.External moderation is conducted by trained Trinity moderatorswho are standardised annually.Trinity College London LicentiateDiploma in Teaching English toSpeakers of Other LanguagesQUALIFICATION ABBREVIATION:LTCL Dip TESOLQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 7BACKGROUND:The LTCL Diploma TESOL is designed to encourage theacquisition and development of professional knowledge andexpertise, as well as the refinement of practical teaching skills.The aims of the Diploma are as follows:ggggggto enhance teachers’ knowledge of contextual issuesconcerning the teaching of English to speakers of otherlanguagesto refine and extend their ability to employ a variety ofpractical skillsto develop their knowledge and skills to a point where theybecome effective practitioners in a range of known andunpredicted TESOL teaching situations without supervisionto recognise and confirm their achievements in the aboveareasto extend their motivation and inform their strategies forcontinuing professional developmentto contribute to the development internationally of TESOL asa mature, qualified and regulated profession and act as abenchmark for employers and others with concern for thequality of TESOL.DATE OF FIRST TEACHING:1975DATE OF FIRST AWARD:1976PREREQUISITES:gcandidates for the LTCL Diploma TESOL examinations musthave a degree or equivalent. This could be another type ofqualification which shows evidence of sustained academicstudy which would potentially enable the candidate to copesuccessfully with the requirements of the LTCL Diploma.(Applicants who do not possess a degree, but rather ‘anequivalent’ must be tested more stringently at interview, andan enhanced written task submitted as an Appendix)gan initial formal TESOL training (eg CertTESOL or equivalent)is highly recommended, but not essentialglanguage skills — candidates should demonstrate anawareness of, and interest in, language and have a high levelof competence in English, in listening, speaking, reading andwriting skills, that is appropriate to fully qualified teachers ofEnglish and which will enable them to follow the coursesuccessfullygcandidates should demonstrate an interest in, and aptitudefor, the development of teaching ability at an advanced levelwith a wide range of learners, and the capacity for advancedstudy of the principles underlying language acquisition,learning and teachinggthe LTCL Diploma TESOL examinations lead to qualificationswhich are intended for experienced and (normally) practisingESOL teachers. The ESOL teaching experience requirementprior to the course start is two years full-time. In the case ofpart-time teachers the same minimum quantity of teachingexperience may be accumulated over a longer periodgall claimed ESOL teaching experience must have occurredwithin the five years prior to the interview for the course.<strong>UK</strong> QUALIFICATIONS 147
g<strong>Qualifications</strong> currently offeredgthe candidate must have had no more than one year’s breakfrom ESOL teaching immediately prior to the start of thecoursea minimum of 75% of claimed teaching experience must bewith classes. 25% may have been with one-to-one learners.Candidates with recent experience predominantly of one-tooneteaching, not exceeding 25% of total teachingexperience claimed, are advised that the examinationsinvolve the teaching of classes and that they must thereforerefresh or develop their full-class teaching skills beforeattempting the course.NUMBER OF UNITS/STRUCTURE:This qualification comprises four units.ASSESSMENT METHOD:Units 1 and 3 are externally assessed by Trinity. Units 2 and 4 areinternally assessed and externally moderated by Trinity.EXAMINATION TIMING:Ongoing assessment during course – external assessmentconducted by Trinity according to each unit.DATE OF RESULT PUBLICATION:Varies depending on approach to study.GRADING SYSTEM:Distinction, Merit, Pass, Below Pass. Outcome statements andcriteria describing the level of achievement required are includedin the syllabus.QUALITY ASSURANCE:Internal assessments are externally moderated by Trinity.External assessment is conducted by trained Trinity examinerswho are standardised annually.Trinity College LondonFellowship Diploma in TESOLEducation Studies (FTCL)QUALIFICATION ABBREVIATION:FTCL TESOLQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 7BACKGROUND:The qualification aims to encourage candidates in the followingand assess their achievement:gggto describe and contextualise the design and implementationof an appropriate project in a structured and principledmanner, giving consideration to the immediate and widereducational contexts, recent and relevant theoretical issuesand current practice; the project should be either one beingimplemented at the present time or implemented during thefour years prior to registration with Trinityto reflect critically on the work undertaken and proposeadaptations as relevantto contribute to the documented archive of the Englishlanguage profession in a way that is developmental andstimulating for other participants.DATE OF FIRST TEACHING:2008LTCL Diploma TESOL or equivalent qualification (eg C.ESOLDELTA, PGCE with specialisation in TESOL), MA in TESOL, AppliedLinguistics, Language and Education.)orminimum of three years’ experience of appropriate subjectarea(s) at a senior level – eg:ggggggggsenior teacher and/or trainer in a language teaching school,college or universityuniversity lecturer in appropriate subject areascurriculum/syllabus designerqualifications designercourse designer (language or training)manager of accreditation in an educational organisationinspector on an educational inspection schemeacademic or business manager, or chief examiner, with anawarding body/examinations board.2) Working experience:gminimum of two years’ full-time English language teachingor equivalent in part-time teaching, of appropriate classes;one-to-one teaching not included in this minimumand in additiongminimum of three years’ working experience to includesignificant duties over and above English language teaching(this requirement may have already been offered bycandidates in lieu of any of the qualifications listed in 2.1 butcould be of lesser responsibility).3) English language skills:Applicants must have a level of English language competence inspeaking, listening, reading and writing equivalent to that of aneducated (degree level) speaker of English as a first language orfor those for whom English is a second or foreign language, oneor more of the following:gTrinity Graded Examinations in Spoken English: grade 10gTrinity Integrated Skills in English: Level IIIgCambridge ESOL: Certificate of Proficiency in English,Certificate in Advanced EnglishgCambridge ESOL IELTS: minimum band 7.0 in all skillsgCity and Guilds Advanced ESOL examinationgTOEFL: minimum score 650.NUMBER OF UNITS/STRUCTURE:This qualification comprises two units.ASSESSMENT METHOD:100% external assessment conducted by Trinity examiners.EXAMINATION TIMING:Assessments are available all year round.DATE OF RESULT PUBLICATION:Results are confirmed by issue of a Certificate.GRADING SYSTEM:Merit, Pass, Below Pass. Outcome statements and criteriadescribing the level of achievement required are included in thesyllabus.QUALITY ASSURANCE:External assessment is conducted by trained Trinity examinerswho are standardised annually.DATE OF FIRST AWARD:N/APREREQUISITES:1) Academic qualifications/alternative relevant experience:148 <strong>UK</strong> QUALIFICATIONS
<strong>Qualifications</strong> currently offeredTCL Level 6 Diploma in DanceTeaching and Learning (Childrenand Young People)QUALIFICATION ABBREVIATION:DDTAL (CYP)QUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 6BACKGROUND:The Diploma is designed to be flexible to meet the needs ofteachers of dance to children and young people at differentstages of their careers. It is recognised that there will be manypeople who might be interested in taking this qualification forwhom a training course is not relevant given their previousexperience and existing qualifications. Some people may,however, choose to undertake the qualification as part of acontinuing professional development (CPD) programme. It isdesigned to address all these needs.The Diploma in Dance Teaching and Learning can be undertakenin any dance style from Contemporary to Hip Hop and from Balletto Bharatanatyam.DATE OF FIRST TEACHING:2010DATE OF FIRST AWARD:2010PREREQUISITES:There are no formal prerequisite qualifications. However, it islikely the candidate will have completed dance trainingcommensurate with a degree-level education in Dance thatensures that dance knowledge, performance and technical skillsare at a high level. This does not preclude any candidate withsignificant experience in dance but no formal qualifications.The minimum age for undertaking this qualification is 18. Thereis no maximum age limit.NUMBER OF UNITS/STRUCTURE:This qualification consists of four mandatory units which must bepassed for successful completion of the diploma.ASSESSMENT METHOD:In order to pass each unit, the candidate must successfullydemonstrate their knowledge of the learning outcomes in relationto their own practice and style of dance, or a style of dance thatthey are interested in. Each unit is assessed by a combination ofcoursework, oral examination, portfolio of evidence and practicalexamination.To be awarded the Diploma, all units must be passed within threeyears of passing their first submitted unit of the qualification. It isa requirement that Units 1-3 are successfully completed beforeundertaking Unit 4.EXAMINATION TIMING:Each unit is assessed in relation to the learning outcomes and theirrelated assessment criteria. Examination is available all year round.DATE OF RESULT PUBLICATION:On passing a unit the candidate will get notification of this passalong with a transcript which states the name of the unit, thecredit value and level. On achieving the whole qualification thecandidate will receive a certificate and a completed transcriptwith full details of their award.GRADING SYSTEM:Pass/Merit/Distinction. The Pass mark is 50%; Merit is 65% andDistinction is 75% and over.QUALITY ASSURANCE:Marks are analysed at Trinity’s head office before results areconfirmed by issue of a Certificate. All assessors for this Diplomaare highly qualified. The assessors have knowledge in danceteaching and learning at post-graduate level or equivalent. Theyare fully trained and standardised at an annual standardisationevent, which all assessors have to attend in order to continuetheir work on this Diploma.University of West London<strong>Qualifications</strong>/London College ofMusic ExaminationsLondon College of Music (LCM) has offered examinations inmusic and in speech, drama and communication for over 100years. In 1991 it became part of Thames Valley University (TVU),which was renamed University of West London (UWL) in 2011.LCM Examinations are awarded and certificated by University ofWest London <strong>Qualifications</strong> (UWLQ).LCM Examinations offers qualifications in a wide range of subjects,including piano, voice, organ, orchestral instruments, electronickeyboard and organ, jazz instruments, music theatre, popularmusic vocals, percussion and a selection of speech, drama andcommunication options; and validates the acoustic, rock, electricand bass guitar examinations of the Registry of Guitar Tutors.LCM Examinations caters for candidates of all levels: fromintroductory ‘Steps’ examinations for beginners, through eightgrades, to professional diplomas. Diplomas are available for bothperformers and teachers, and are offered at four levels: Diplomaof the London College of Music (DipLCM), Associate of theLondon College of Music (ALCM), Licentiate of the LondonCollege of Music (LLCM) and Fellow of the London College ofMusic (FLCM). Diploma holders are entitled to append theappropriate letters after their names.The grades range from level 1 to level 3 of the <strong>Qualifications</strong> andCredit Framework, and are assessed against strict criteria atthree levels: Pass, Merit and Distinction. The DipLCM is pitched atHE level 1, the ALCM at HE level 2, the LLCM at HE level 3, andthe FLCM at HE level M.LCM’s graded examinations, and diplomas in music performanceand teaching, are accredited by Ofqual.Accredited qualifications at Grade 6 –8 offered by LCMExaminations attract UCAS Tariff points.Further information is available on the LCM Examinations websitewww.uwl.ac.uk/lcmexams.UWLQ Associate of the LondonCollege of Music in PerformanceQUALIFICATION ABBREVIATION:ALCMQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 5 (music subjects only)BACKGROUND:Subjects: piano, jazz piano, pipe organ, electronic keyboard,electronic organ, flute, clarinet, oboe, bassoon, recorder, classicalsaxophone, jazz flute, jazz clarinet, jazz saxophone, French horn,trumpet, cornet, flugelhorn, trombone, tuba, jazz trumpet, jazztrombone, violin, viola, cello, double bass, classical guitar,percussion, singing, Irish traditional music, Scottish traditionalmusic, church music, speech and drama, acting, reading recital,<strong>UK</strong> QUALIFICATIONS 149
<strong>Qualifications</strong> currently offeredverse speaking, public speaking, communication, spoken Englishin religion, music theatre.PREREQUISITES:Music subjects: depends on option chosen.Drama and communication subjects: Grade 8.ASSESSMENT METHOD:Practical examination, plus written submission for certain options(all external).EXAMINATION TIMING:Examinations are held throughout the year.GRADING SYSTEM:Pass (75%)UWLQ Associate of the LondonCollege of Music in TeachingQUALIFICATION ABBREVIATION:ALCM (TD)QUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 5 (music subjects only)BACKGROUND:Subjects: piano, pipe organ, electronic keyboard, electronic organ,flute, clarinet, oboe, bassoon, recorder, classical saxophone,French horn, trumpet, cornet, flugelhorn, trombone, tuba, violin,viola, cello, double bass, classical guitar, electric guitar,percussion, singing, Irish traditional music, Scottish traditionalmusic, speech and drama, music theatre.PREREQUISITES:Music Subjects: depends on option chosen.Drama and communication subjects: Grade 8.ASSESSMENT METHOD:Practical examination and written submission (all external).EXAMINATION TIMING:Examinations are held throughout the year.GRADING SYSTEM:Pass (75%)UWLQ Diploma of the LondonCollege of Music in PerformanceQUALIFICATION ABBREVIATION:DipLCMQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 4 (music subjects only)BACKGROUND:Subjects: piano, jazz piano, pipe organ, electronic keyboard,electronic organ, flute, clarinet, oboe, bassoon, recorder, classicalsaxophone, jazz flute, jazz clarinet, jazz saxophone, French horn,trumpet, cornet, flugelhorn, trombone, tuba, jazz trumpet, jazztrombone, violin, viola, cello, double bass, classical guitar,percussion, singing, Irish traditional music, Scottish traditionalmusic, music theatre, speech and drama, verse speaking, acting,spoken English in religion, reading aloud, oral communication,personal and professional communication.EXAMINATION TIMING:Examinations are held throughout the year.GRADING SYSTEM:Pass (75%)UWLQ Diploma of the LondonCollege of Music in TeachingQUALIFICATION ABBREVIATION:DipLCM (TD)QUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 4 (music subjects only)BACKGROUND:Subjects: piano, jazz piano, pipe organ, electronic keyboard,electronic organ, flute, clarinet, oboe, bassoon, recorder, classicalsaxophone, jazz flute, jazz clarinet, jazz saxophone, French horn,trumpet, cornet, flugelhorn, trombone, tuba, jazz trumpet, jazztrombone, violin, viola, cello, double bass, classical guitar, electricguitar, percussion, singing, Irish traditional music, Scottishtraditional music, speech and drama, music theatre.PREREQUISITES:Grade 5 Theory of MusicASSESSMENT METHOD:Practical examination (all external).EXAMINATION TIMING:Examinations are held throughout the year.GRADING SYSTEM:Pass (75%)UWLQ Fellowship of the LondonCollege of Music in PerformanceQUALIFICATION ABBREVIATION:FLCMQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 7 (music subjects only)BACKGROUND:Subjects: piano, jazz piano, pipe organ, electronic keyboard,electronic organ, flute, clarinet, oboe, bassoon, recorder, classicalsaxophone, jazz flute, jazz clarinet, jazz saxophone, French horn,trumpet, cornet, flugelhorn, trombone, tuba, jazz trumpet, jazztrombone, violin, viola, cello, double bass, classical guitar,percussion, singing, Irish traditional music, Scottish traditionalmusic, church music, speech and drama.PREREQUISITES:LLCMASSESSMENT METHOD:Practical examination (all external).EXAMINATION TIMING:Examinations are held throughout the year.GRADING SYSTEM:Approved/Not Approved.PREREQUISITES:Music subjects: Grade 5 Theory of Music.Drama and Communication subjects: Grade 8 Practical.ASSESSMENT METHOD:Practical examination (all external).150 <strong>UK</strong> QUALIFICATIONS
<strong>Qualifications</strong> currently offeredUWLQ Graded Examination inDramaQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Grades 1–3 (Acting, Music Theatre) = level 1Grades 4–5 (Acting, Music Theatre) = level 2Grades 6–8 (Acting, Music Theatre) = level 3BACKGROUND:Subjects: acting, duologue, group performance, music theatre.ASSESSMENT METHOD:Practical examination (all external)EXAMINATION TIMING:Examinations are held throughout the year.GRADING SYSTEM:Pass (65%), Merit (75%), Distinction (85%).GradeUCAS Tariff pointsGrade 8 (Distinction) 65Grade 8 (Merit) 60Grade 8 (Pass) 45Grade 7 (Distinction) 55Grade 7 (Merit) 50Grade 7 (Pass) 35Grade 6 (Distinction) 40Grade 6 (Merit) 35Grade 6 (Pass) 20UWLQ Graded Examination inMusic LiteracyQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Grades 1–3 = level 1Grades 4–5 = level 2Grades 6–8 = level 3BACKGROUND:Subjects available: theory of music, popular music theory.ASSESSMENT METHOD:Written examination (all external).GRADING SYSTEM:Pass (65%), Merit (75%), Distinction (85%).GradeUCAS Tariff pointsGrade 8 (Distinction) 30Grade 8 (Merit) 25Grade 8 (Pass) 20Grade 7 (Distinction) 20Grade 7 (Merit) 15Grade 7 (Pass) 10Grade 6 (Distinction) 15Grade 6 (Merit) 10Grade 6 (Pass) 5UWLQ Graded Examination inMusic PerformanceQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Grades 1–3 = level 1Grades 4–5 = level 2Grades 6–8 = level 3BACKGROUND:Subjects: piano, jazz piano, electronic keyboard, electronic organ,flute, clarinet, oboe, bassoon, recorder, classical saxophone, jazzflute, jazz clarinet, jazz saxophone, French horn, trumpet, cornet,flugelhorn, trombone, tuba, jazz trumpet, jazz trombone, violin,viola, cello, double bass, classical guitar, electric guitar, bassguitar, acoustic guitar, rock guitar, drum kit, tuned percussion,timpani, singing, popular music vocals, Irish traditional music,Scottish traditional music, church music.ASSESSMENT METHOD:Practical examination (all external)EXAMINATION TIMING:Examinations are held throughout the year.GRADING SYSTEM:Pass (65%), Merit (75%), Distinction (85%).GradeUCAS Tariff pointsGrade 8 (Distinction) 75Grade 8 (Merit) 70Grade 8 (Pass) 55Grade 7 (Distinction) 60Grade 7 (Merit) 55Grade 7 (Pass) 40Grade 6 (Distinction) 45Grade 6 (Merit) 40Grade 6 (Pass) 25UWLQ Graded Examinationin SpeechQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Grades 1–3 = level 1Grades 4–5 = level 2Grades 6–8 = level 3BACKGROUND:Subjects available: verse speaking, reading aloud, oralcommunication.ASSESSMENT METHOD:Practical examination (all external).EXAMINATION TIMING:Examinations are held throughout the year.GRADING SYSTEM:Pass (65%), Merit (75%), Distinction (85%)GradeUCAS Tariff pointsGrade 8 (Distinction) 65Grade 8 (Merit) 60Grade 8 (Pass) 45Grade 7 (Distinction) 55Grade 7 (Merit) 50Grade 7 (Pass) 35Grade 6 (Distinction) 40Grade 6 (Merit) 35Grade 6 (Pass) 20UWLQ Graded Examination inSpeech and DramaQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Grades 1–3 = level 1Grades 4–5 = level 2Grades 6–8 = level 3ASSESSMENT METHOD:Practical examination (all external)EXAMINATION TIMING:Examinations are held throughout the year.<strong>UK</strong> QUALIFICATIONS 151
<strong>Qualifications</strong> currently offeredGRADING SYSTEM:Pass (65%), Merit (75%), Distinction (85%)GradeUCAS Tariff pointsGrade 8 (Distinction) 65Grade 8 (Merit) 60Grade 8 (Pass) 45Grade 7 (Distinction) 55Grade 7 (Merit) 50Grade 7 (Pass) 35Grade 6 (Distinction) 40Grade 6 (Merit) 35Grade 6 (Pass) 20UWLQ Licentiate of the LondonCollege of Music in PerformanceQUALIFICATION ABBREVIATION:LLCMQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 6 (music subjects only)BACKGROUND:Subjects: piano, jazz piano, pipe organ, electronic keyboard,electronic organ, flute, clarinet, oboe, bassoon, recorder, classicalsaxophone, jazz flute, jazz clarinet, jazz saxophone, French horn,trumpet, cornet, flugelhorn, trombone, tuba, jazz trumpet, jazztrombone, violin, viola, cello, double bass, classical guitar,percussion, singing, Irish traditional music, Scottish traditionalmusic, church music, speech and drama, acting, public speaking,verse speaking, reading recital, spoken English in religion, musictheatre.PREREQUISITES:ALCMASSESSMENT METHOD:Music subjects: practical examination (all external).Drama and communication subjects: practical examination andwritten submission (all external).EXAMINATION TIMING:Examinations are held throughout the year.GRADING SYSTEM:Pass (75%)UWLQ Licentiate of the LondonCollege of Music in TeachingQUALIFICATION ABBREVIATION:LLCM (TD)QUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 6 (music subjects only)BACKGROUND:Subjects: piano, pipe organ, electronic keyboard, electronic organ,flute, clarinet, oboe, bassoon, recorder, classical saxophone,French horn, trumpet, cornet, flugelhorn, trombone, tuba, violin,viola, cello, double bass, classical guitar, electric guitar,percussion, singing, Irish traditional music, Scottish traditionalmusic, speech and drama, music theatre.PREREQUISITES:Music subjects: ALCM or ALCM (TD).Drama and communication subjects: ALCM in Teaching.ASSESSMENT METHOD:Practical examination and written submission (all external).EXAMINATION TIMING:Examinations are held throughout the year.GRADING SYSTEM:Pass (75%).Vocationally Related <strong>Qualifications</strong>QUALIFICATION ABBREVIATION:VRQsNQF/QCF LEVEL:Levels 1, 2 and 3BACKGROUND:VRQs are available in a wide variety of vocational areas.Qualification suites include Health, Public Services andCare/Science and Mathematics; Agriculture, Horticulture andAnimal Care/Engineering and ManufacturingTechnologies/Construction, Planning and the BuiltEnvironment/ICT/Retail and Commercial Enterprise/Leisure, Traveland Tourism/Arts, Media and Publishing/History, Philosophy andTheology/Social Sciences/Languages, Literature andCulture/Education and Training/Preparing for Life andWork/Business, Administration and Law. More than 100 awardingorganisations offer VRQs including AQA, City & Guilds, Edexcel,EDI, NCFE, NOCN, OCNW and OCR. Full details of all accreditedqualifications and awarding organisations can be found at theRegister of Regulated <strong>Qualifications</strong> (http://register.ofqual.gov.uk)The subject matter of the units and the qualification must supportthe qualification’s purpose. It must:ggggspecify the knowledge, skills and/or understanding required,giving a clear indication of coverage and depthbe expressed in terms of what a successful candidate willhave learned or will be able to do (outcomes)refer to any relevant National Occupational Standards or toprofessional standards if it is employment related or atteststo competence in an occupation or professioncomply with subject/sector criteria where these exist and beaccurate and up-to-date.PREREQUISITES:Generally, there are no entry requirements laid down (eg formalqualifications from school or further education) but in certaincases, a minimum level of basic education or language may berequired – in some cases the awarding body may expect acandidate to have achieved the (equivalent of the) level belowthat which is being applied for prior to entry.NUMBER OF UNITS/STRUCTURE:<strong>Qualifications</strong> vary in size – usually defined by a recommendednumber of guided learning hours (GLH) for NQF qualifications,and a specified number of credits for QCF qualifications. There isno limit to the number of units in a qualification, but practicalitiesand common sense determine a sensible amount.Most VRQs are defined as Awards/Certificates/Diplomas at eachlevel and the structure can be all mandatory or made up of a setof mandatory units and a set of optional units from which tochoose the rest.ASSESSMENT METHOD:All VRQs must include a form of independent assessment or analternative approved by the regulatory authorities and all methodsused must be appropriate to the qualification type. They must:gbe fit for purpose in that they provide a valid measure of therequired skills, knowledge and understanding and/orcompetence152 <strong>UK</strong> QUALIFICATIONS
g<strong>Qualifications</strong> currently offeredgprovide opportunities for candidates to demonstrate theirabilities to meet a full range of requirementsalso be manageable and cost-effective as well as being freefrom covert or overt discrimination in wording or content.EXAMINATION TIMING:Most qualifications are available on demand, with some fixed-dateassessment sessions. This depends on individual centres, manyof which are colleges and may have specific times of the year forassessment. Online assessment is becoming more and morecommon and this can be done at any time in any place. As withall assessment it must be appropriate to the qualification itself.DATE OF RESULT PUBLICATION:OngoingGRADING SYSTEM:<strong>Qualifications</strong> and their composite units are graded.QUALITY ASSURANCE:Ofqual evaluates qualifications and the organisations that awardthem against nationally established criteria. It formally recognisesawarding organisations by checking they have adequateresources to award their qualifications. Ofqual also runs anaccreditation system that ensures the qualifications awarded byrecognised bodies meet specific criteria.PROGRESSION/ARTICULATION:All suites of qualifications offer clear progression routes, whereappropriate, to further education or training and/or employmentopportunities. They are also supported by the appropriateStandards Setting Body/Council where one exists.Welsh Baccalaureate AdvancedDiplomaQUALIFICATION ABBREVIATION:WBAD/WBQNATIONAL QUALIFICATIONS FRAMEWORK LEVEL:Level 3. (note: there is also a Welsh Baccalaureate IntermediateDiploma at level 2 and a Welsh Baccalaureate FoundationDiploma at level 1).BACKGROUND:The Welsh Baccalaureate Advanced Diploma is an overarchingqualification that gives parity of esteem to vocational andacademic routes. It is accredited at level 3, level 2 and level 1 forpost-16 students. It may be taken through the medium of eitherEnglish or Welsh.DATE OF FIRST TEACHING:2003DATE OF FIRST AWARD:2005PREREQUISITES:Candidates embarking on the WBAD should have achieved ageneral education level commensurate with their intendedprogrammes of study in the Options.Credit is given to those experiences already undertaken andqualifications already gained which form part of the requirementsof the WBAD.NUMBER OF UNITS/STRUCTURE:The minimum requirement for award of the WBAD is achievementof the Welsh Baccalaureate Core Certificate and Optionsrequirements.World; Work-Related Education, Personal and Social Education.Candidates must achieve at least three Key/Essential Skills Walesqualifications at level 3 and three at level 2.The Options are qualifications which are accredited at level 3,such as AS/A levels, NVQs, BTEC Nationals or Principal LearningWales. In order to be awarded the WBAD, candidates mustachieve a maximum of three qualifications at level 3 which total720 GLH or 108 credits or 100% of the level 3 threshold orPrincipal Learning (level 3) and Extended Project Qualification(level 3).ASSESSMENT METHOD:For the Core, candidates are assessed through:ggggKey/Essential Skills Wales portfoliosan Individual Investigation at level 3, based on issues arisingfrom the Core and/or Options (or a pass in level 3 ExtendedProject)component diary/records showing how the curriculumrequirements have been metverification and evaluation statements relating to thecandidate’s attainments arising from Working with Employersand Community Participation.For the Options, candidates are assessed in the normal way forthe qualification concerned.EXAMINATION TIMING:Dependent on the national timetable for Option subjects/programmes and Key/Essential Skills Wales.DATE OF RESULT PUBLICATION:March and August.GRADING SYSTEM:Core: Pass/Fail.The Welsh Baccalaureate Advanced Diploma has beenincorporated in the UCAS Tariff with an allocation of 120 pointsfor the Core.The Principal Learning Wales component of the WelshBaccalaureate Advanced Diploma carries UCAS Tariff points witheffect for entry to higher education from 2011 as follows:GradeTariff pointsA* 210A 180B 150C 120D 90E 60As part of the Review of <strong>Qualifications</strong> (see the section on Wales),it has been decided that the Welsh Baccalaureate AdvancedDiploma Core will be graded for courses commencingSeptember <strong>2013</strong>.QUALITY ASSURANCE:The WBAD is evaluated internally by the WJEC and monitored bythe regulatory authority DfES.PROGRESSION/ARTICULATION:WBAD can be recognised by <strong>UK</strong> HEIs as fulfilling the minimummatriculation requirements for entry.Further information on the Welsh Baccalaureate can be found atwww.wbq.org.uk.The Core comprises a common curriculum for candidates,including: Key/Essential Skills Wales; Wales, Europe and the<strong>UK</strong> QUALIFICATIONS 153
Skills/EnrichmentAdult Literacy and AdultNumeracyNATIONAL QUALIFICATIONS FRAMEWORK LEVEL:Levels 1-2 and Entry levels 1, 2 and 3BACKGROUND:The National Certificates in Adult Literacy and Adult Numeracy atlevels 1 and 2 provide an accreditation route for adults wishing tohave their achievements against the National Standards and CoreCurricula for Adult Literacy and Adult Numeracy recognised.National Certificates in Adult Literacy and Adult Numeracy arealso available at Entry levels 1, 2 and 3.These qualifications at level 1 and 2 will be taking lastenrollments by 31 August 2012 as they reach their operationalend date. People who have enrolled on these courses by this datewill have until 31 August 2014 to complete their qualification,which is the certification end date.DATE OF FIRST TEACHING:2001DATE OF FIRST AWARD:2001NUMBER OF UNITS/STRUCTURE:Each Adult Literacy and Adult Numeracy qualification at levels 1and 2 is a one-unit qualification consisting of a test comprising40 multiple-choice questions each worth one mark. The NationalCertificate in Literacy lasts one hour and the National Certificatein Adult Numeracy lasts one hour and 15 minutes. At Entry levels1, 2 and 3 assessment is dependent on the regime adopted bythe Awarding Body, but it is generally through an assignmentor task.ASSESSMENT METHOD:Externally set and marked test.EXAMINATION TIMING:On demand and available in e-assessment format in the case oflevels 1 and 2.DATE OF RESULT PUBLICATION:On demand: Results within seven to 10 working days (wheree-assessment is used this may be immediate), certificationavailable within 30 working days.Monthly: as with on demand, but may vary according toawarding body.PROGRESSION/ARTICULATION:The Certificates in Adult Literacy and Adult Numeracy at levels 1and 2 use the same tests as those for Key Skills in Communicationand Application of Number at those levels. Success in theCertificates in Adult Literacy and Adult Numeracy will act as a proxyfor the associated Key Skills tests in Communication and Applicationof Number at the same levels. The Certificate in Adult Literacy testat levels 1 and 2 also provides assessment of reading as part ofESOL (English for Speakers of Other Languages) qualifications atlevels 1 and 2 accredited from September 2005. Certificates in AdultLiteracy and Adult Numeracy are necessary for success in educationand training in general, and enhance employment opportunities.GRADING SYSTEM:Pass/FailASDAN Certificate of PersonalEffectivenessQUALIFICATION ABBREVIATION:ASDAN CoPENATIONAL QUALIFICATIONS FRAMEWORK LEVEL:Level 3 (CoPE is also available as an approved qualification atlevels 1 and 2)BACKGROUND:In April 2005, QCDA accredited the ASDAN Certificate of PersonalEffectiveness into the National <strong>Qualifications</strong> Framework as afully approved qualification from 1 September 2005, followinga successful pilot. This certificate incorporates the UniversitiesAward at level 3. CoPE at levels 1, 2 and 3 provides a meansof accrediting a wide range of personal, social and healtheducation (PSHE), citizenship and work-related activity alongwith the development of personal effectiveness skills. Thequalification provides a model for the Government 14-19 agendaespecially in relation to developing skills for learning, skills foremployment and skills for life. ASDAN CoPE is a core feature to aHEFCE-funded Aimhigher project seeking to develop autonomouslearning.DATE OF FIRST TEACHING:2003DATE OF FIRST AWARD:2004DATE OF LAST AWARD:2014 (to be extended)NUMBER OF UNITS/STRUCTURE:Six units:ggggggPlanning and carrying out a piece of researchCommunication through discussionPlanning and giving an oral presentationIntroduction to working with othersIntroduction to improving own learning and performanceIntroduction to problem solving.ASSESSMENT METHOD:Portfolio evidence, internally assessed and externally moderated.EXAMINATION TIMING:Opportunities for portfolio moderation are made available at leastthree times a year.DATE OF RESULT PUBLICATION:Ongoing assessmentGRADING SYSTEM:Pass/Fail.UCAS Tariff points:Grade UCAS Tariff pointsPass 70The CoPE units cover approximately three-quarters of the contentof each of the Wider Key Skills and the Communication Key Skill,which, if offered in combination, will result in double counting ofpoints. To recognise achievement in both CoPE and the Key Skills,higher education institutions may wish to consider using thefollowing equation: 70 points for CoPE, plus five points for eachof the full four Key Skills units that have been achieved.154 <strong>UK</strong> QUALIFICATIONS
Skills/EnrichmentQUALITY ASSURANCE:Assessment against CoPE standards, which reflect QCDA KeySkills Standards, demonstrated through the completion of a rangeof activities within different contexts.PROGRESSION/ARTICULATION:Entry to HE.VARIANTS:The CoPE qualification can now offer certificates that indicate thecontext through which the skills are developed, eg CoPE throughscience, technology, engineering and maths, CoPE throughcitizenship etc. The Universities Award has been available for anumber of years and remains available as a separate enrichmentprogramme or as a significant part of the CoPE qualification.In Northern Ireland, CoPE at level 3 is offered by the AwardingBody CCEA, by agreement with ASDAN, which continues to offerlevels 1 and 2.ASDAN Award of PersonalEffectivenessQUALIFICATION ABBREVIATION:ASDAN AoPENATIONAL QUALIFICATIONS FRAMEWORK LEVEL:Level 3 (AoPE is also available as an approved qualification atlevels 1 and 2)BACKGROUND:Ofqual accredited the ASDAN Award of Personal Effectivenessinto the <strong>Qualifications</strong> and Credit Framework (QCF) as a fullyapproved qualification from 1 September 2011. AoPE at levels 1,2 and 3 provides a means of accrediting a wide range ofpersonal, key and employability skills, leading to personaleffectiveness. AoPE is a smaller, QCF version of the ASDAN level3 CoPE (Certificate of Personal Effectiveness) .DATE OF FIRST TEACHING:2011DATE OF FIRST AWARD:2012DATE OF LAST AWARD:UnspecifiedNUMBER OF UNITS/STRUCTURE:Award requires nine credits, approximately 70-80 Guided LearningHours, from at least three of the seven optional units listed below:gggggggResearch skillsImproving skills in preparing and presenting informationTeam workingPlanning and reviewing learningTackling problemsLearning through work experienceCareer exploration.ASSESSMENT METHOD:Portfolio evidence, internally assessed and externally moderated.EXAMINATION TIMING:Opportunities for portfolio moderation are made available at leastthree times a year.DATE OF RESULT PUBLICATION:Ongoing assessment and publication of results.GRADING SYSTEM:Pass/Fail.UCAS Tariff points:Grade UCAS Tariff pointsPass 30QUALITY ASSURANCE:Assessment against AoPE standards, demonstrated andevidenced through the completion of a range of activities withindifferent contexts.PROGRESSION/ARTICULATION:Development of skills at level 3 support entry to HE. The units arevaluable for providing skills, knowledge and understanding forpersonal development and more effective performance within HE,and within and outside employment.ASDAN Certificate in CareerPlanningNATIONAL QUALIFICATIONS FRAMEWORK LEVEL:Levels 1, 2 and 3BACKGROUND:The Certificate in Career Planning has been developed in linewith national guidance on Careers Education. It:gggggprovides a framework for the development and assessmentof student learning in careers education and preparation forworking lifeprepares students for the challenge of flexible career pathsprovides clear evidence of delivery of Careers Education andGuidanceis deliverable either through personal, social and healtheducation/tutorial programmes or alongside other academicand vocational qualifications in a wide range of educationalcontextscontributes to the development of individual Key Skills units.DATE OF FIRST TEACHING:2002DATE OF FIRST AWARD:2003DATE OF LAST AWARD:2012NUMBER OF UNITS/STRUCTURE:Three units:gggSelf developmentCareer explorationCareer management.ASSESSMENT METHOD:Although certification of individual units is available, to gain thefull Career Planning qualification, candidates need to complete allthree units.QUALITY ASSURANCE:Assessed through a portfolio of evidence: each candidatedemonstrates their competence in each unit by presenting aportfolio of evidence which clearly shows their ability to meet thestandards. There are externally set questions to checkunderpinning knowledge and understanding. The portfolio isinternally assessed and externally moderated.ASDAN Level 3 Award andCertificate in EmployabilityQUALIFICATIONS AND CREDIT FRAMEWORK:Level 3 (Employability Awards and Certificates are also availableas approved qualifications at levels 1 and 2)<strong>UK</strong> QUALIFICATIONS 155
Skills/EnrichmentBACKGROUNDThe aim of these qualifications is to provide a range ofopportunities for learners to develop their personal andemployability skills in gaining a national qualification. At level 3units include Research Skills, Project Management, ProblemSolving, Career Exploration, Planning and Reviewing Learning,and Team Working.DATE OF FIRST TEACHING:2008DATE OF FIRST AWARD:2009DATE OF LAST AWARD:2016NUMBER OF UNITS/STRUCTURE:Award – 8 credits. 80 Guided Learning Hours. Candidates taketwo mandatory units plus optional units.Certificate – 13 credits. 120 Guided Learning Hours. Candidatestake two mandatory units plus optional units.ASSESSMENT METHOD:Portfolio of evidence.GRADING SYSTEM:Pass/Fail.PROGRESSION/ARTICULATION:These qualifications provide opportunities for learners whodemonstrate these skills at level 3 to be well placed to progresstowards HE and a range of sector qualifications, as well asemployment. The units are valuable for providing skills,knowledge and understanding for personal development andmore effective performance within HE, and within and outsideemployment.ASDAN Level 3 Award andCertificate in CommunityVolunteeringQUALIFICATIONS AND CREDIT FRAMEWORK LEVEL:Level 3 (CVQ Awards and Certificates are also available at levels1 and 2)BACKGROUND:The aim of these qualifications is to help learners develop skillswithin volunteering settings. It is assumed that learners whodemonstrate skills at level 3 will be well placed to progresstowards relevant sector qualifications and national occupationalstandards.DATE OF FIRST TEACHING:2008DATE OF FIRST AWARD:2009DATE OF LAST AWARD:2016NUMBER OF UNITS/STRUCTURE:Award – 8 credits. 80 Guided Learning Hours. Candidates taketwo mandatory units plus two or three optional units.Certificate – 13 credits. 130 Guided Learning Hours. Candidatestake two mandatory units plus four or five optional units.ASSESSMENT METHOD:Portfolio of evidence.GRADING SYSTEM:Pass/Fail.Both the award and the certificate carry UCAS Tariff points forentry to higher education from 2011 onwards as follows:Tariff pointsCertificate 50Award 30PROGRESSION/ARTICULATION:These qualifications provide opportunities for learners whodemonstrate these skills at level 3 to be well placed to progresstowards relevant sector qualifications and national occupationalstandards. The units are valuable for providing skills, knowledgeand understanding not only for volunteering but also maximisingopportunities for staff development, more effective performanceand promotion within and outside employment.ASDAN Universities AwardThe Universities Award provides a portfolio-based framework forcertificating student achievement across a broad range ofcurriculum enrichment and extra-curricular activities including:sports and arts activities, careers work, community placements,adventure activities, work experience, enterprise projects, PSHEand citizenship, international links, mentoring and leadership, andmany valuable activities.Students gain credits for their achievements, demonstrate theircompetence in a range of essential skills, and use the UniversitiesAward to enhance career paths and UCAS applications.Over 100 universities around the <strong>UK</strong> acknowledge the value ofthe Universities Award in relation to the development andassessment of personal skills, and a number of these universitiestake it into consideration when making offers to applicants.The Universities Award can be used to wrap around the sixthform experience and provide a straightforward way of certificatingstudent experience. It can also provide a route to achieving theCoPE (Certificate of Personal Effectiveness) qualification atlevel 3.Cambridge ESOL ExaminationsCambridge ESOL offers a range of qualifications for learners andteachers of English, taken by over 3.5 million people in 130countries. They help people gain entrance to university or college,improve job prospects or measure progress in English. More than12,500 universities, employers and government bodies worldwiderecognise Cambridge ESOL qualifications.Cambridge ESOL offers a number of qualifications that areapproved by the <strong>UK</strong> Border Agency for Tier 4 student visas andthat are suitable for candidates wishing to study in highereducation in the <strong>UK</strong>:<strong>Qualifications</strong> accredited at NQF Level 3 (Common EuropeanFramework of Reference for Languages (CEFR) level C2)Certificate of Proficiency in English (CPE) Grades A – CCertificate in Advanced English (CAE) Grade ABusiness English Certificates Higher (BEC H) Grade A<strong>Qualifications</strong> accredited at NQF Level 2 (CEFR level C1)Certificate in Advanced English (CAE) Grades B and CFirst Certificate in English (FCE) Grade ABusiness English Certificates Higher (BEC H) Grades B and C156 <strong>UK</strong> QUALIFICATIONS
Skills/EnrichmentThe qualifications are accredited by the exams regulator for the<strong>UK</strong> government, Ofqual, and have been mapped to the National<strong>Qualifications</strong> Framework (NQF) for England, Wales and NorthernIreland.UCAS Tariff points for Cambridge ESOL examinations are shownin the following table.GradeTariffpointsCertificate of Proficiency in English Certificate in Advanced EnglishA 140B 110C A 70Cambridge ESOL exam results can be verified online using a freeResults Verification Service:http://verification.cambridge.ESOLonline.orgMore detailed information on these qualifications can be found atthe following links:www.cambridgeesol.orghttp://register.ofqual.gov.ukCSV Learning Together andStudent Community PartnershipsCSV Learning Together and Student Community Partnershipsenable university and college students to play an active part intheir local community through volunteering or as part of theirassessed coursework.CSV Learning Together is a student tutoring programme aimedat raising the aspirations and achievements of young people.Student tutoring projects currently run in most universities andcolleges throughout the <strong>UK</strong> and involve thousands of HE studentsannually. Students volunteer for up to 20 weeks and work withschool pupils on a one-to-one or group basis, providing a positiverole model, helping to improve their educational achievementsand encouraging them to continue in further and higher education.Students meanwhile acquire the habit of good citizenship anddevelop their communication, organisation and problem-solvingskills. Some students tutor for credit, and various certificationand assessment mechanisms are used at different universities.Many HEIs now provide opportunities for their students to beinvolved in positive community action as part of their assessedcoursework through Student Community Partnerships. Suchpartnerships enhance students’ skills development whilepotentially meeting a wide range of community needs. Studentsare given the responsibility, under academic supervision, ofnegotiating a project, carrying out research and producing a clearand readable report for a local charity or community organisation.In the process they not only draw on their theoretical learning, butalso put into practice a range of skills, including problem solving,communication, use of information technology and, whereappropriate, teamwork.Both schemes provide the opportunity for students to acquirekey skills and certification or accreditation through learning inthe community.Ascentis Level 3 Certificate inPersonal Development forProgression (formerly known asthe Curriculum EnrichmentProgramme)NATIONAL QUALIFICATIONS FRAMEWORK LEVEL:Level 3BACKGROUND:This qualification is intended to help learners to gain recognitionfor their project management and teamwork skills. It promotesthe development of communication, negotiation and presentationskills, and provides the skills required in higher education and inmany careers.In order to successfully achieve the qualification, learners need todemonstrate skills such as:gggggteam workproject managementeffective communicationworking independentlypresentation skills.Learners are required to plan a project, complete a logbook, takepart in a group presentation, contribute towards the production ofa group report and a final product, and complete 11 statementsexplaining their role within the project. Achievement of theassessment criteria is monitored through a portfolio. This couldinclude evidence such as written questions and answers, a groupreport or presentation, a reflective log or witness statements.The course specification also offers opportunities to develop andgenerate evidence for the generic and wider Key Skills.DATE OF FIRST TEACHING:2008 (the Curriculum Enrichment Programme was offered from1987).DATE OF FIRST AWARD:2008NUMBER OF UNITS/STRUCTURE:One unit.ASSESSMENT METHOD:Portfolio of evidence, including a logbook.EXAMINATION TIMING:No examination.GRADING SYSTEM:Pass/FailQUALITY ASSURANCE:External moderation by Ascentis.The Duke of Edinburgh’s AwardBACKGROUND:The Duke of Edinburgh’s Award is a programme of personaldevelopment for all young people between the ages of 14 and 25.Undertaken on a voluntary basis, the Award offers personalisedlevels of challenge and achievement through a balancedprogramme of activity in four areas: volunteering, skills, physicalfitness and an expedition.The Award Programme complements and enriches post-16 studiesoffering a nationally recognised accreditation of achievement. At awider level, it assists young people in developing and showing<strong>UK</strong> QUALIFICATIONS 157
Skills/Enrichmentevidence of the personal qualities and skills which will contributeto their success in HE through:ggggtaking responsibility for their own learning and developmentdeveloping transferable skills such as teamwork, leadership,communication, decision making, working to targets anddeadlinesadding breadth and depth to their formal studies, includinginvolvement with community and with people outside theirpeer groupaccepting the challenge of trying new activities and/orpersevering with current activities.Engineering Education Schemein England (EESE)The Engineering Education Scheme in England is administered bythe Engineering Development Trust and forms part of the RoyalAcademy of Engineering BEST (Better Engineering, Science andTechnology) programme.The Scheme provides students with an in-depth experience inengineering, science and technology, that will allow them to makean informed choice about their future studies and career.During this work-related learning experience a professionalengineer from a link company/organisation liaises with andmentors a team of four students and their contact teacher over aperiod of about six months. They work as a team on a realscientific engineering or technical problem.The scheme is aimed at students who are interested in science,technology, engineering, mathematics or a related discipline, whoare in Year 12. All students need to show a genuine interest inengineering as a possible career. Students may submit theirindividual contribution for accreditation as part of their projectwork for certain awarding bodies. Each student is expected tocomplete a logbook which records their individual input into theproject. In addition, the team is required to produce a full projectreport. Students also get an oportunity to compete for aBA/CREST (British Association/Creativity in Science andTechnology) Award. The EESE is also an access organisation tothe Duke of Edinburgh’s Award Scheme.The Scheme provides a scheme launch, a university residentialworkshop and a celebration and assessment day (CAD). Seminarsare delivered on project management and communication skills.Full and rigorous assessment of the team project is carried out atthe CAD where teams display their projects, present to a panel ofassessors and face in-depth questioning at their display stands.All members of the team receive certificates of participation anddetailed information regarding their achievements compared toregional and national averages.Essential SkillsNATIONAL QUALIFICATIONS FRAMEWORK LEVEL:Entry level, level 1, level 2BACKGROUND:The specifications for these qualifications have been designed tomeet the background of:gggthe standards for Key Skills at the relevant levelthe national standards for adult literacy at the relevant levelthe Northern Ireland Essential Skills Adult Literacy corecurriculum at the relevant level.There are three skills available – Application of Number,Communication and ICT. It is also possible to undertake EssentialSkills qualifications in Adult Literacy and Adult Numeracy.Achievement at level 2 can build on achievement at level 1 andcan be used to assist progression to recognised qualifications athigher level.DATE OF FIRST TEACHING:2004NUMBER OF UNITS/STRUCTURE:One-unit structureASSESSMENT METHOD:Portfolio of evidenceGRADING SYSTEM:Competence-based.LevelUCAS Tariff pointsLevel 2 10Essential Skills attracted Tariff points for 2010 but were removedfrom the Tariff for entry into higher education from 2011onwards, except where they form part of a composite level 3qualification.PROGRESSION/ARTICULATION:Level 3 Key Skills and other appropriate qualifications.Essential Skills WalesNATIONAL QUALIFICATIONS FRAMEWORK LEVEL:Entry Level to Level 4BACKGROUND:Key Skills and Basic Skills qualifications have been central to theskills agenda in Wales in meeting the policy aim of ensuring thateveryone masters the skills needed in education, work and life ingeneral.The introduction of Essential Skills Wales (ESW) in September2010 brings clarity and consistency to this policy aim. The newstandards and the associated qualifications provide, for the firsttime in Wales, a single ladder of progression from Entry Level toLevel 4 in the skills of Communication, Application of Number andICT.The new standards have been developed by converging anddrawing on best practice from the standards for Adult Literacy,Adult Numeracy and Adult ICT, and the standards for Key SkillsCommunication, Application of Number and ICT.ESW are applicable to all programmes, ages, abilities andcontexts. They are required for success in all aspects ofeducation, training, work and life in general. They are thereforeappropriate for a variety of candidates at all levels from studentsand junior staff through to middle and senior managers. Theysupport the effectiveness of learning and performance both ineducation and at work, by encouraging the individual to:ggggggthink about their intentions and purposesplan a course of actionimplement the planreflect on their progress towards completing the planreview the plan to suit changing circumstances or toovercome problemsdevise a new plan when the original one has been fulfilled.The process underpinning all ESW qualifications is therefore:Plan ä Do ä Reflect ä Review158 <strong>UK</strong> QUALIFICATIONS
Skills/EnrichmentDATE OF FIRST TEACHING:September 2010DATE OF FIRST AWARD:2010PREREQUISITES:No entry requirementsNUMBER OF UNITS/STRUCTURE:One unit qualificationASSESSMENT METHOD:Portfolio assessment at Levels 1 to 4EXAMINATION TIMING:No examinations. Ongoing assessment as per awarding bodyarrangements.DATE OF RESULT PUBLICATION:OngoingGRADING SYSTEM:Competence basedGradeUCAS Tariff pointsLevel 2 10Level 3 20Level 4 30Essential Skills Wales at level 2 attracted Tariff points for 2010but were removed from the Tariff for entry into higher educationfrom 2011 onwards, except where they form part of a compositelevel 3 qualification.QUALITY ASSURANCE:Awarding body arrangements for external verification and/orModerationPROGRESSION/ARTICULATION:No specific qualification route. Transferrable skills applicableacross all areas of education, employment and life in general.Functional SkillsNATIONAL QUALIFICATIONS FRAMEWORK LEVEL:Entry level, Level 1, Level 2BACKGROUND:Functional Skills are about using English, mathematics andinformation & communication technology in everyday situations.They are incorporated into the 14-19 Diplomas and are alsoavailable as standalone qualifications. The three Functional Skillsof English, mathematics and information & communicationtechnology have been available nationally since September 2010.All apprentices must achieve qualifications in English andMathematics (either a GCSE or Functional Skills). Where theapprentice does not already hold a qualification Functional Skillsmay be delivered as part of the apprenticeship programme.ASSESSMENT METHOD:Task-based controlled assessmentGRADING SYSTEM:Pass/FailGrade UCAS Tariff pointslevel 2 10Tariff points for Functional Skills were removed from the Tariff forentry into higher education from 2011 onwards, except wherethey form part of a composite level 3 qualification.PROGRESSION/ARTICULATION:Functional Skills qualifications are designed from E1 – L2 toensure clear progression pathways and personal developmentopportunities. The levels are mapped across the relevant NationalCurriculum levels and the key skills ‘application of number' and‘adult numeracy’ standards.Key SkillsNATIONAL QUALIFICATIONS FRAMEWORK LEVEL:Levels 1–4BACKGROUND:Key Skills are generic skills that are important and relevant ineveryday life for activities undertaken in education, the workplaceor training. They can be achieved through a wide range ofactivities such as full- or part-time working, enrichmentprogrammes, training programmes or full- or part-time education.All six Key Skills (in communication, application of number, ICT,problem solving, working with others and improving own learningand performance) can be achieved at levels 1–4.Following a review undertaken by the regulators during 2002/3,revised Key Skills standards were introduced in England fromSeptember 2004. Minor changes have been made to thespecifications, renamed as standards, to help candidates andcentres produce more focused evidence in portfolios.In EnglandKey Skills in communication, application of number and ICT wereaccredited until the end of August 2010 and were replaced byFunctional Skills in English, mathematics and ICT from September2010 at levels 1 and 2. Only continuing learners who enrolledbefore 1 September 2010 are funded to complete theirqualification up to the certification end date of 31 August 2012.Key Skills in communication, application of number and ICTwithin Apprenticeship Frameworks have been extended untilSeptember <strong>2013</strong>.The wider Key Skills (problem solving, working with others, andimproving own learning and performance) were removed from theNQF in April 2011.In WalesWith effect from September 2004, all tests in Key Skillsqualifications at all levels were discontinued for candidates in theWelsh education system. All candidates in Wales are expected toachieve Key Skills qualifications on the successful demonstrationof competence through a portfolio only. The discontinuation of theKey Skills tests did not affect the UCAS Tariff points forcertificated Key Skills qualifications in Wales.In Northern IrelandFollowing a review of Key Skills qualifications, CCEA piloted anew approach to assessment of Key Skills qualifications. Unlikethe existing multiple-choice tests, candidates undertook taskswithin appropriate contexts as one element of the assessmentregime. CCEA’s Key Skills qualifications are currently certificateduntil 2014.DATE OF FIRST TEACHING:2000DATE OF FIRST AWARD:2000PREREQUISITES:No entry requirements.NUMBER OF UNITS/STRUCTURE:Each Key Skill is a one-unit qualification.<strong>UK</strong> QUALIFICATIONS 159
Skills/EnrichmentASSESSMENT METHOD:The Key Skills in application of number, communication and ICTare assessed by a test (multiple-choice tests at levels 1 and 2and short answer/extended response tests at levels 3 and 4) anda portfolio of evidence (but see information above on candidatesin the Welsh and Northern Irish education systems). The KeySkills in working with others, problem solving and improving ownlearning and performance are often referred to as the wider KeySkills and are only assessed on a portfolio basis.EXAMINATION TIMING:Varies according to level and awarding body.DATE OF RESULT PUBLICATION:Varies according to level and awarding body.GRADING SYSTEM:The three main Key Skills of application of number, communication,and IT carried UCAS Tariff points for entry to HE from 2000-2010.The three wider Key Skills of improving own learning andperformance, problem solving, and working with others carriedUCAS Tariff points from 2007-2010. Tariff points for all six KeySkills were as shown in the following table:Grade UCAS Tariff pointslevel 4 30level 3 20level 2 10Please note that for entry to HE from 2011 onwards, UCAS Tariffpoints will not be allocated to level 2 Key Skills unless they arepart of a level 3 composite qualification. This does not affect thepoints awarded to level 3 and 4 Key Skills.QUALITY ASSURANCE:Externally set and marked test and internally assessed andexternally moderated portfolio.PROGRESSION/ARTICULATION:There is no specific qualification route. Key Skills are transferableskills most commonly needed for success in education andtraining in general, and a range of activities at work. Institutionsof higher education are making explicit use of Key Skills, GCSEsand Functional Skills within their undergraduate and postgraduateprogrammes, and in initiatives such as the Higher Apprenticeships.Industrial Careers FoundationQUALIFICATION ABBREVIATION:ICFBACKGROUND:Over many years, the ICF organised bespoke conferences,courses and events for schools and colleges to individualrequirements. The purpose of all events was to provideopportunities for student delegates to practise and hone theirmanaging (key) skills in the close company of motivated adultadvisers from business. In the process, the students weretherefore encouraged to improve their own abilities.Since 2005, the ICF no longer directly delivers conferences, butworks to promote activity in schools and colleges by providingadvice and intellectual capital. It also supports events beingorganised by Challenge Training Partners and other similarorganisations.At present, the ICF is prepared to produce a Summary of SkillsAchievement indicating the skills that have been demonstratedby each student delegate on every course it helps to arrange. Ithas also had experience of producing evidence that will lead,under suitable moderation, to an assessment of the standard oflevel achieved.Trident Trust ‘Skills for Life’ProgrammeThe Trident Trust ‘Skills for Life’ Programme provides threeexperiential, integrated elements for young people aged 14-19 –Personal Challenge, Community Involvement, and WorkExperience. The programme can be used in its entirety or asindividual modules. Individual certificates can be awarded foreach element and the Trident Gold certificate is presented tostudents who successfully complete all three parts.In order to receive certification, the student will have developed aportfolio of evidence which details the skills, competences andpersonal qualities that have been learned or improved as aconsequence of their involvement in the activities. In addition, thestudent will have developed a personal action plan, recorded theiractivities, reviewed their progress and assessed the outcomes forthem personally.OCR Level 3 Certificate forYoung Enterprise (QCF)This qualification has been accredited onto the <strong>Qualifications</strong> andCredit Framework (QCF) at levels entry, 1, 2 and 3. Thequalification has been developed by OCR in partnership withYoung Enterprise and aims to recognise candidates' skills,knowledge and understanding of enterprise activities. It has beendesigned to accredit candidates' achievements and participationin the Young Enterprise Company Programme. The qualificationaims to:gggggdevelop candidates' knowledge of the enterprise environmentthrough practical experiencesdevelop candidates' understanding of the factors affectingthe success of a business enterprisedevelop candidates' appreciation of economic concepts in abusiness contextencourage candidates' development of practical skills thatwould be of benefit in the workplacedevelop candidates' understanding of the responsibilities ofthe individual in contributing to a team activity.GRADING SYSTEM:The qualification is graded Pass, Merit and Distinction.Grade UCAS Tariff pointsDistinction 40Merit 30Pass 20More information can be found on the Register of Regulated<strong>Qualifications</strong> at http://register.ofqual.gov.ukThe aims of the ICF are to excite students to the challenge of acareer in management, and to increase understanding betweenbusiness and education. Its primary role is promoting conferencesto allow students to develop and practice their skills within ateamwork situation.160 <strong>UK</strong> QUALIFICATIONS
Phased Out <strong>Qualifications</strong>Admissions tutors may need to check the results of pastexaminations, including, in the case of some mature applicants,some qualifications which have been obsolete for a number ofyears. The following is a brief overview of the chronology ofacademic qualifications in England, Wales and Northern Ireland,which are likely to be relevant to entry to HE.From 1918 to 1950 the main academic qualifications were theSchool Certificate and Higher Schools Certificate examinations.From 1951/2 to 1987 GCE examinations were available asfollows.Ordinary levelThis was normally taken after five years in a secondary school. InJune 1988, the GCSE replaced GCE O level and the CSE.However, some awarding bodies continue to offer an examinationentitled GCE O level for applicants in some overseas countries.GRADING SYSTEMSBefore 1963The grades or marks awarded before 1963 correspondedapproximately to the GCE A level system (see above). The passmark was 45%, with the exception of the following.Examining BoardPass MarkCambridgeVariable from subject to subjectLondon June 1953 to January 1959 – 47%June 1960 to January 1973 – Grade 6Oxford and CambridgeVariable from subject to subjectWelsh Joint Education Committee 50%June 1963–June 1974For all examining boards, GCE O level grades did not appear oncertificates until June 1975, when an official grading systemreplaced the pass/fail system of reporting results. Previously onlyunofficial grades were made available to schools, candidates,universities and local education committees. The markingsystems used were as shown in the following chart.1975–1987The grading system for GCE O level was as follows.ABCDEPerformance better than or equivalent to the previous passlevel: only these grades were normally acceptable touniversities for the purposes of satisfying entry requirements.A lower level of attainment.The lowest level of attainment judged to be of sufficient standardto be recorded.Grades D and E covered approximately the same range ofperformance as the old School Certificate pass grade.Alternative Ordinary levelOrdinary level, but with syllabuses designed for sixth formersand other more mature candidates. AO/O* examinations werebetween GCE O level and A level in standard. They ceased in1987, with the exception of Additional Mathematics and OCR-runsubjects under the title Additional Subjects. The certificatesawarded do not bear the signature of a DfES representative, buthave been included in the DfES list of statutory qualifications.The subjects in which the AO/O* examination has been offeredare:ggggAdditional FrenchAdditional mathematicsAdditional mathematics (MEI)Certificate in additional mathematics.AO/O* examinations should not be confused with a pass allowedat GCE O level for a subject taken at GCE A level up to andincluding the 1986 examinations. Assessment was related to GCEO level standards, and the successful candidate’s certificaterecorded as GCE O level grade (shown with an asterisk).BOARDAssociated Examining BoardCambridgeMARKING SYSTEM1: 70%+; 2: 65–69%; 3: 60–64%; 4: 55–59%; 5: 50–54%; 6: 45–49%; 7,8,9: fail. The AEB printed the following caveatafter their published O level grading table: “All grade boundaries are determined by careful judgement on performancecriteria, and the levels of performance required for the award of each grade in each subject are similar. Not all subjectsare bound to follow a normal pattern and the mark equivalents of the appropriate performance levels in some subjectsmay vary substantially from those indicated above.”Nine grades awarded, but boundaries could differ from year to year within a subject.Durham Pass grades 1 75–952, 3 60–704, 5, 6 45–557 408 359 30 and underJoint Matriculation BoardA nine-point scale (as Durham above)London 1963–68 Instead of 1–6 as above, A, B, C, D, E , O; and for 7, 8, 9 above, F, G, H.1968–75 Instead of 1–6 as above, A, C, E; and for 7, 8, 9 above, F, H.Northern IrelandPrior to the introduction of the official grading system at O level in 1975, the pattern of the other boards was followed inawarding unofficial grades on a nine-point scale, on which grades 1–6 represented the pass standard.OxfordA nine-point scale (as Durham above).Oxford and CambridgeRaw marks issued, of very little value to other universities.Southern Universities Joint BoardScaled marks, 45% pass.Welsh Joint Education CommitteeScaled marks, 50% pass up to 1970, thereafter scaling to 50% pass not applied and nine grades awarded. Gradeboundary points differed from year to year within subjects.<strong>UK</strong> QUALIFICATIONS 161
Phased Out <strong>Qualifications</strong>Advanced levelThe GCE A level was first introduced in 1951 to replace theHigher School Certificate. It was normally taken in schools andcolleges two years after the GCSE or Ordinary (O) levelexaminations (before 1988). In the past, GCE A levels have beenregarded as stand-alone examinations which need notnecessarily form part of an integrated programme as such. Therewas no requirement that the candidate must have taken thesubject at GCSE or O level before attempting the same subject atGCE A level, although individual schools and colleges may haveimposed their own requirements concerning progression.Candidates were able to choose how many GCE A levelexaminations to take, and there was no requirement that theyshould all be taken simultaneously. The normal pattern for entryto HE was to offer three GCE A levels in Year 13 in schools or FEcolleges in England and Wales (Year 14 in Northern Ireland).Some candidates took fewer subjects, or took their GCE A levelsover a longer period. Some schools/colleges encouraged theirstronger candidates to take four subjects. Candidates may haveused the GCE Advanced Supplementary (AS) examination (half anA level in terms of content but assessed at full A level) to broadenor complement their A level programme.From September 2000, revised GCE A levels were introduced andthe new GCE Advanced Subsidiary (AS) replaced the GCEAdvanced Supplementary (AS), although both AS qualificationswere offered for examination in summer 2001.QUALITY ASSURANCEAll GCE A level examinations were subject to quality assuranceprocedures. The regulators (QCDA, ACCAC, CCEA and theirpredecessor bodies) were responsible for keeping under reviewall aspects of school examinations and assessment. In 1994, theGCE A and AS Code of Practice was published in conjunction withthe awarding bodies. The Code of Practice has since beenrevised, firstly as the joint GCSE and GCE A level/AS Code ofPractice, and more recently as the joint GCSE, GCSE in vocationalsubjects, GCE, VCE and GNVQ Code of Practice 2002/3.The purpose of all the codes has been to:ggglay down detailed procedures to promote accuracy, fairness,quality and consistency across all awarding bodiesensure that staged examinations are of the same standardas end-of-course examinationsrepresent an enhanced measure of national uniformity ofprocedures and quality assurance.Subject cores were developed to specify the requirements for GCEA level syllabuses. All syllabuses were subject to the approval ofthe regulators and were required to comply with the requirementsof the subject cores and the Code of Practice.TIMING OF EXAMINATIONSAll awarding bodies offered GCE A level examinations in thesummer (May/June). AQA, Edexcel Foundation and WJEC alsooffered examinations in the autumn/winter, but not in all subjects.OCR offered modular examinations in March, June and Novemberfor the former UCLES and UODLE suites of specifications.Modules for the former OCSEB A level were held in January andJune. These examinations were certificated by OCR, which hadtaken over all previous modular A levels run by UCLES, UODLE,OCSEB and OCEAC. Module tests for the former NEAB A levelswere held in February/March and June.MODULAR GCE A LEVELSThe development of modular GCE A level and AdvancedSupplementary specifications offered choice and flexibility forboth students and teachers, and enabled candidates to select aspecified number of modules from those available for an A levelcertificate, and half that number for the award of an AdvancedSupplementary certificate. There were allowable combinations ofmodules, the selection of which might influence the title of thecertificate awarded, for example, in modular mathematics.Modular GCE A levels were replaced by the revised unitisedGCE A levels from September 2000.Modular syllabuses were required to incorporate the relevantsubject cores where appropriate and adhere to the Code ofPractice. All modules were assessed at full A level standard,including those taken at an early stage in the course, ie therewas no allowance for maturation.Modular GCE A level and AS examinations were available twoor three times a year for many syllabuses, and candidatescould enter for any number of modular examinations at eachof these times.At the end of each GCE A level or AS module, results were issuedby the appropriate examining bodies, either by grading andcertification or a statement of result to the candidate. At thisstage, if candidates believed they could obtain a higher grade,they could decide to resit one or more modules. Their modularresults were held in a module bank.For qualifications started before September 2000, candidatescould retake modules on any number of occasions beforepresenting them for a final subject award. The highest result forany module would be accepted, provided it was within its fouryearvalidity, and subject to the satisfaction of the terminalassessment requirement.The regulations required that at least 30% of the totalassessment for a final subject award should consist of externallyassessed terminal examinations. Terminal examinations wereregarded as externally marked modules taken either in theJanuary series (November for OCR) following October entryor the March/May/June series following February entry.Modules taken as part of the 30% terminal examinations had tobe included in the subject award, even if their results were notthe candidate’s best for the module(s) concerned.It is UCAS’s policy that applicants who have taken modular GCEA level or Advanced Supplementary qualifications need not declareon the UCAS form the detailed modules which they are taking orthe results of any modules which may have been completed. Theyshould, however, state the title of the overall qualification.PREVIOUS GRADING SYSTEMS FOR GCE A LEVELBefore 1963Different examining boards used various systems, and specificenquiries should be addressed to the relevant awarding body (seecontact information in Appendix A); some information is given inthe table below. Before 1963, A level grades were not includedon the GCE certificate although they were communicated to localeducation authorities and universities. Performance in Scholarshippapers was not recorded on the certificates. Candidates whoreached an outstanding level of performance were awarded‘Advanced with Distinction’. This was the only award, other thanthe simple award of an A level pass, which was available in theperiod 1953–62.162 <strong>UK</strong> QUALIFICATIONS
Phased Out <strong>Qualifications</strong>BOARD DATE MARKING SYSTEMAssociated Examining Board January 1960 and earlier Pass 40%, allowed Ordinary 30–39%To 1962 1+2: 70%; 3: 60–69%; 4: 55–59%; 5: 50–54%; 6: 40–49%;7+8: 25–39% allowed Ordinary; 9: failCambridge; Oxford and Cambridge To 1962 Raw marks given by the Joint Oxford and Cambridge Board (but not by Cambridge) withdifferent grades, maxima and pass marks for each subject and sometimes for each year.Reduction of these to percentages was not encouraged by these boards.Durham 1960 and earlier Results given as grades on a scale running from 90 to 0 by increments of 5.Joint Matriculation Board To 1962 Results given as grades on a scale running from 95 to 0 by increments of 5.London January 1960 and earlier Marks given1960–63 1: 75% or better; 2: 70–74%; 3: 60–69%; 4: 50–59%; 6: 40–49%;7+8: 30–39% allowed Ordinary; 9: failOxford To 1962 Results given as grades on a scale running from 90 to 0 by increments of 5.Southern Universities Joint Board Before 1963 Percentage marks given.Welsh Joint Education Committee To 1962 Results given as grades: A: 75% or better; B: 60–74%; C: 50–59%; D: 40–49%Autumn 1963–winter 1986/7 (Durham from 1961)The GCE boards worked within a grading scheme originallylaid down by the Secondary Schools Examinations Council andsubsequently confirmed by the Schools Council. This schemeset out the distribution of grades which might be expected insubjects with large and average entries, the approximateproportions of the total entry allocated to each grade in suchcircumstances being as follows.Approximate % of entry Advanced Grade10 A15 B10 C15 D20 E20 O Allowed Ordinary10 F FailThe suggested percentages were for the guidance of boards, andactual percentages differed from subject to subject, depending onthe calibre of the entry.The boards attempted to maintain continuity of standards from oneyear to the next in each subject and also general comparability ofdemands between subjects. In a grading system of this kind, thecentral grades covered relatively narrow mark ranges becausethey fell in the area where candidates were most closelybunched. This applied in particular to grade C, which coveredonly a very narrow spread of marks.Candidates who failed by a narrow margin might be given an‘allowed Ordinary’ grade (O) which indicated a performanceequivalent to at least grade C at GCE O level.From summer 1987In 1985, the Secondary Examinations Council recommended areform of the A level grading system, designed partly to resolve theproblem of the narrow mark range defining grade C. In April 1986,the Department of Education and Science announced that, witheffect from the summer 1987 examinations, a new A level gradingsystem would be adopted as follows.ABCDENUHighest grade awardedLowest pass grade awardedCertificate to indicate the candidate’s performance fell shortof the standard required for grade E by a narrow margin.UncertificatedGCE A LEVEL POINTS SCORE SYSTEMIn the early 1960s, UCCA devised a points score system to helpwith the presentation of statistics; this was initially based on ascore of 1–5 (grade A = 5). In 1989, the system was amended bydoubling the A level scores to take into account the new AdvancedSupplementary qualifications. This system was subsequentlyadministered by UCAS and became recognised as follows.Grade A B C D EPoints 10 8 6 4 2It should be stressed that the above system wasdiscontinued from 2002 entry, being superseded by theUCAS Tariff, full details of which are given later in thisdocument. While it is not intended to publish point scores inthe UCAS Tariff for former qualifications, admissions staffshould note that it is acceptable to use the UCAS Tariff forGCE A levels started before September 2000 in view of thecommonality of grading systems.Advanced SupplementaryThe GCE AS examinations were introduced in England and Walesin 1987, and in Northern Ireland in 1988, to encourage breadthin the post-16 curriculum. In particular, they were intended toencourage students specialising in one discipline (for example,art/humanities) to broaden their knowledge of other areas ofthe curriculum (for example, science/mathematics). The firstcertificates were issued in 1989 for England and Wales and1990 for Northern Ireland.The GCE AS was of the same academic standard as GCE A level.It was intended to represent no more than half the study time ofA level with an upper limit of 20% for coursework in most cases.GCE AS subjects were often studied in tandem with GCE A levelsubjects in schools or colleges of FE. In theory, candidates couldtake GCE A level and AS in any combination, and the formerCVCP endorsed the concept of a programme consisting of twoA levels and two AS qualifications. In practice, the majority ofapplicants who took GCE AS offered a single AS qualification inassociation with three GCE A levels.From September 2000, the GCE Advanced Supplementary wasreplaced by the new GCE Advanced Subsidiary (also with theabbreviation AS); in summer 2001 both qualifications wereavailable for award. The Advanced Supplementary is nolonger available.<strong>UK</strong> QUALIFICATIONS 163
Phased Out <strong>Qualifications</strong>The GCSE and GCE A level/AS Code of Practice applied equallyto both GCE A level and AS examinations. The establishment ofsubject cores common to both GCE A level and AS improved therelationship between those examinations. A number of GCE ASsyllabuses were modular, and the principles and practicalarrangements were effectively as for modular GCE A levels.As with GCE A levels, the same standards and subject coresapplied for modular GCE AS syllabuses as for syllabuses withend-of-course assessment.AWARDING BODIESGCE AS examinations were offered by all the GCE awardingbodies in England, Wales and Northern Ireland.TIMING OF EXAMINATIONSGCE AS examinations were held in the summer (May/June).Modular AS examinations were usually held in the same sessionsas modular A level.GRADINGThe grading system for GCE AS was the same as for A level. Thesame standards applied to GCE AS as to GCE A level examinations.ACCEPTABILITY FOR ENTRY TO HIGHER EDUCATIONHEIs have accepted two GCE AS subjects in place of anunspecified third GCE A level subject for entry to most courses.For the purposes of entry to HE, one GCE AS qualification wasequivalent to half an A level and was treated as such whencalculating points scores. AS grades were therefore scored asfollows in the former UCAS points score system.Grade A B C D EPoints 5 4 3 2 1While there is no formal points score in the new UCAS Tariff forGCE Advanced Supplementary, HEIs may wish to attribute thesame Tariff points scores as for the equivalent grade in the newGCE Advanced Subsidiary. It should be noted that both types ofAS qualification represent half the value of the relevant full GCEA level qualification.Special PapersSPs were additional examinations which could be taken inconjunction with, and at the same time as, the GCE A levelexamination in the same subject. Some awarding bodies offeredSPs as stand-alone examinations that did not require a link torelated GCE A level subjects. For some GCE A level subjects,there was no corresponding SP. The questions were designed totest the level of knowledge and understanding of candidatesdeemed to be more able.SPs were offered by AQA, OCR, and WJEC.SP results were graded as follows.1 Distinction – an outstanding performance2 Merit – a good performanceU Unclassified – if the candidate did not reach the standardrequired for grade 2, or failed to qualify by not passingGCE A level in the same subjectIt was possible for the candidate to pass an A level subject but tobe unclassified in the SP.Admissions tutors have sometimes taken into account the resultsof SPs, but it has not been normal practice to include them withinconditional offers. SP results were reported to HE in associationwith the relevant GCE A level results.Following the introduction of AEAs in association with revisedGCE A levels from summer 2002, SPs have been phased out.Certificate of SecondaryEducationThe CSE examination was offered from 1965t to1987. In June1988, the GCSE replaced CSE and GCE O levels. The modes ofexamining for the CSE varied according to the degree ofinvolvement on the part of the candidate’s school. The principalforms were:gggMode 1 – examinations designed by the examining board onsyllabuses set and published by the boardMode 2 – examinations designed by the examining board onsyllabuses devised by individual schools or groups of schoolsMode 3 – both syllabuses and examinations created byschools under boards’ guidance and approval.As Modes 2 and 3 syllabuses were drawn up by individualschools or groups of schools, examinations on these syllabuseswere normally available only to pupils in the particular schools orgroups of schools.The three modes were not mutually exclusive; many school-basedexaminations incorporated board-based components and viceversa. All combinations were subject to moderation by the boards.Many universities accepted CSE grade 1 as equivalent to grade Cor above at O level or GCSE.Joint 16+ examinationsSome applicants may indicate on their application forms that theytook joint 16+ examinations. This indicates that the applicantstook part in examinations conducted by consortia of GCE boardsand CSE boards. These examinations had their origins in thefeasibility studies which led the Schools Council in 1976 to aform of examination similar to GCSE. In 1980, the Governmentproposed the GCSE as a single system of examining at 16+.Applicants who took the joint 16+ examinations of various GCE/CSE consortia will have received two certificates unless ungraded,one showing their results in terms of O level grades (A – E), theother in terms of CSE grades (1–5). Grades achieved in such16+ examinations were directly equivalent to the correspondingGCE and CSE grades. There is no formal correspondencebetween CSE grades 2–5 and GCE O level grades D and E.Certificate of ExtendedEducationThe CEE was an official pilot examination recommended by theSchools Council in 1976. It was primarily for students who hadobtained CSE grades 2–4 and who were staying on for one yearin the sixth form but who had no immediate intention of seekingadmission to HE. It was discontinued in 1991.Although the Department of Education and Science’s approvalfor the CEE was extended to 1985, and to 1986 only for twoyearcourse candidates, the consortium for the CEE continuedto offer CEE examinations until 1990. Since the experimentalexaminations began in 1972, the CEE had in some areas beentaken by students from the whole of the ability range and notjust from the original target group.There were five grades, of which grade I was the highestand grade V the lowest. CEE grades I, II and III, obtained bycandidates who took the CEE examinations conducted by aconsortium of GCE and CSE boards, were certified by those164 <strong>UK</strong> QUALIFICATIONS
Phased Out <strong>Qualifications</strong>boards as being equivalent to at least grade C in the formerGCE O level examination.Certificate of Extended StudiesThe CES was a post-GCSE examination offered by AQA (NEAB) in1994-8. The subjects involved were biology, chemistry, English,french, history, mathematics, physics and religious studies.Syllabuses are suitable for students who have attained GCSEgrades C or D. In 1999 and 2000 only, French was offered. CESwas withdrawn after 2000.Each syllabus was free-standing, and required approximately 90hours’ teaching time. It could be completed in one year or spreadover two years. It could be taken in combination with othercourses, for example, GCSE, A level/AS, GNVQ. Successfulcandidates were awarded Distinction, Merit or Pass Certificates.The Distinction was awarded to candidates who provided workabove that normally expected at GCSE. The course bridged thegap between GCSE and GCE A level.Certificate of Further StudiesAQA (formerly AEB) introduced a series of examinations for the CFSin 1991. Syllabuses are offered for one year in 10 different subjects.The CFS is designed primarily for students who attained grade D orE at GCSE, but is also suitable for Access students in England,Wales and Northern Ireland and others for whom GCE A level orAS examinations are inappropriate. Students could enter for anynumber of CFS subjects. The CFS in English, French and Germanfor Business was offered for the last time in summer 2002.The assessment pattern for each subject consists of courseworkand one written paper. Results were announced officially as twopercentage marks rounded to the nearest 5%. The Boardunderwrites a mark of 60% or better for coursework, and 50% orbetter for written papers as representing a standard of attainmentequivalent to grade C in GCSE.Intermediate CertificatesOCR offered a range of former UODLE Certificates in Travel andTourism, Leisure Studies, Nutrition and Food, and Education andCare of Under-Fives. The Certificates were designed to be taughtin one year as an additional, vocationally related course betweenGCSE and GCE A level. The Certificates were offered for lastexamination by OCR in 2000.OCR has provided the three Additional Mathematics syllabusesinherited from UCLES and OCSEB, based on the former AOAdditional Mathematics. These certificates were offered for thelast time in June 2002.Senior Certificate ExaminationThe Ministry of Education Senior Certificate Examination wasconducted by the Ministry between 1925 and 1965, when thegroup certificate was superseded by the GCE examination inseparate subjects at O and A levels. The grading system of theSenior Certificate Examination was by marks (total 400) as follows.Ordinary levelAdvanced level160+ marks – Pass240+ marks – Pass with Credit160+ marks – Pass280+ marks – Pass with DistinctionBetween 1965 and 1969, the Northern Ireland General Certificateof Education (GCE) examinations were conducted by the Ministryof Education.From 1970 until 1984, the GCE Board, a statutory body underthe Education and Libraries (Northern Ireland) Order, conductedthe examinations. As a result of a further legislative change in1984, NISEC conducted the examinations until 1989.Between 1990 and 1993, the examinations were conducted byNISEAC. Since 1994, this task has been undertaken by NICCEA(often expressed as CCEA).Use of EnglishOCSEB offered the Use of English paper until 1989. From 1990until 1995, it was offered by UCLES. Use of English was anexamination outside the structure of GCSE and GCE.BTEC <strong>Qualifications</strong> Prior toSeptember 2002(INCLUDING FORMER BTEC, BEC AND TECQUALIFICATIONS)BTEC First, National and HigherNational Certificates andDiplomasBTEC First, National and Higher National qualifications includedtwo types of vocational unit:ggcore units, which specified the knowledge, skills andunderstanding required for qualifications in the subject areaoption units, which provided the knowledge, skills andunderstanding in more specialised areas, offeringprogression opportunities.For learners on programmes of study before September 2000,qualifications included skills achievement, which was recorded onstudents’ certification as BTEC Common Skills.Learners on BTEC First and National programmes fromSeptember 2000 no longer followed the BTEC Common Skillswithin their programmes. They were encouraged to take the KeySkills qualifications which were separately certificated.Higher National <strong>Qualifications</strong> –EngineeringBefore September 1999, Engineering National Certificateprogrammes had a unit value of 10.0, of which the equivalentof at least 3.0 units were at NIII level. National Diplomaprogrammes had a minimum unit value of 16.0, of which theequivalent of at least 6.0 were at NIII. Where an Edexcel unitis classified simply as N, it will for this purpose be consideredto be equally weighted between NII and NIII. Engineering HNCprogrammes had a unit value of 10.0, of which 8.0 had to be atH level. HND programmes had a minimum unit value of 16.0, ofwhich 12.0 were at H level. NIII units used in Higher Nationalprogrammes were designated at H/N level.<strong>UK</strong> QUALIFICATIONS 165
Phased Out <strong>Qualifications</strong>BTEC qualifications prior to 1986(INCLUDING FORMER BEC, TEC AND JOINT COMMITTEEQUALIFICATIONS)For programmes revised and updated since 1985, the previousTechnical Education Council Levels 1–5 have been subsumedinto the current BTEC <strong>Qualifications</strong> Framework. There are a fewexceptions to this, for example, some Higher National andNational Certificates and Diplomas in Engineering andConstruction.The relationship between the principal BEC, TEC and BTECqualifications and the associated level information is detailed inthe chart below.PREVIOUS QUALIFICATIONSTitle Designation LevelBEC Higher National Certificate and Diploma HNC/D –TEC Higher Certificate and Diploma – IV/VBEC National Certificate/Diploma NC/ND –TEC Certificate/Diploma – II/IIIBEC General Certificate/Diploma – at Credit Level GC/D –Technician Studies Certificate – IThe awards issued by BEC and TEC had themselves in most cases replaced ONC/D and HNC/D issued by the former Joint Committees.CURRENT QUALIFICATIONSTitle Designation LevelBTEC Higher National Certificate/Diploma H IVin designated study areaBTEC Higher National Certificate/Diploma H IVin designated study areaBTEC National Certificate/Diploma in N IIIdesignated study areaBTEC National Certificate/Diploma in N IIIdesignated study areaBTEC First Certificate/Diploma in F IIdesignated study areaBTEC First Certificate/Diploma in F IIdesignated study areaAccess to HE CertificateThe Access to HE Certificate was an undifferentiated award whichwas phased out between 2007 and 2009. It has been replacedby the Access to HE Diploma, which has both a common systemof grading and a standard credit requirement. During thephasing-in period, Access to HE Diplomas were awardedaccording to the standard credit requirement but the awardremained ungraded. The Access to HE Certificate had neither astandard system for grading nor common credit requirements:the use of credit; specific credit requirements, and any system ofgrading used for the Access to HE certificate were determined bylocal agreement.The outline below shows the qualification awarded to studentswho registered on an Access to HE course for the first time andcompleted that course in the year(s) given. Students whocompleted recognised Access to HE courses in earlier years; orwho started courses prior to the academic year in which theaward was made (ie they were studying part-time or took a breakin their studies which ran across two or more years) may havebeen awarded an earlier variant of the qualification. The changedapproach to the description of student achievement for Access toHE in recent years does not invalidate the achievement ofstudents who completed courses before the current commonspecification for the qualification was developed.g2009Access to HE Diplomas (ungraded; standard creditrequirement for all awards - 60 credits; 45 at level 3)g2007 and 2008Some Access to HE Diplomas (ungraded; standard creditrequirement - 60 credits; 45 at level 3); some Access to HEcertificates (ungraded; credit requirements agreed at locallevel)gPre-2007:Access to HE certificates (ungraded; credit requirementsagreed at local level)g1998-2007: certificate logo: green arrow head withthe words ‘Access to Higher Education recognised bythe Quality Assurance Agency for Higher Education’gg1992-1997: certificate logo: red triangle with thewords ‘recognised by the Higher Education QualityCouncil’pre-1992: Access to HE certificates awarded throughlocal arrangements.The awarding bodies for the Access to HE qualification are knownas ‘Access Validating Agencies’ (AVAs) and were known as‘Authorised Validating Agencies’ until 2008. There have been alarge number of name changes and mergers among AVAs sincethe Access Recognition Scheme was first established in 1989.Details of current and former AVAs are available on the Access toHE website at www.accesstohe.ac.uk/avas/default.aspAdvanced General NationalVocational <strong>Qualifications</strong>QUALIFICATION ABBREVIATION:Advanced GNVQNATIONAL QUALIFICATIONS FRAMEWORK LEVEL:Level 3BACKGROUND:At Advanced level, the GNVQ has been replaced by the AdvancedVocational Certificate of Education (AVCE).The following table provides an equivalence with generalqualifications:Advanced 12 units 2 GCE A levels6 units 1 GCE A levelAdvanced GNVQ students could opt to do additional studiesalongside their GNVQ, either to broaden their general educationto or deepen their understanding of the particular vocational areathey were studying. Key Skills were a requirement of thepre-2000 GNVQs.Students could choose to take as additional studies:gmore vocational units (from either the same or another GNVQsubject area). Students received a separate results slip andcertificate for individual GNVQ units166 <strong>UK</strong> QUALIFICATIONS
Phased Out <strong>Qualifications</strong>gggggadditional Key Skills units (Improving Learning andPerformance, Working with Others and Problem Solving)separate foreign language unitsone or more GCE A levelone or more GCE Advanced Supplementary or Subsidiaryother additional studies, eg BTEC qualifications, NOCN units,NVQ units, various certificates.The Advanced GNVQ (Single Award) was also available as a pilotfrom September 1998, and was primarily aimed at post-16students. It was designed to be equivalent to one A level.Students had the option of taking this qualification over one ortwo years. It gave a basis in a vocational area with the possibilityof a certain amount of specialisation via optional units.The Single Award was a six-unit GNVQ at advanced level only,covering the following vocational areas:ggggArt & designBusinessHealth & social careInformation technology.The Single Award was based on the same revised model as theAdvanced GNVQ (Full Award)(pilot).DATE OF FIRST TEACHING:1992DATE OF LAST AWARD:2000NUMBER OF UNITS/STRUCTURE:The Advanced GNVQ (Full Award) was made up of 12 units, plusKey Skills, as follows:gggeight mandatory vocational unitsfour optional vocational unitsthree mandatory Key Skills in application of number,communication and information technology (IT).ASSESSMENT METHOD:In the pre-September 2000 model of the Advanced GNVQ,students had to pass an externally set and marked unit test in avariable number of mandatory units (most commonly seven).These tests were designed to ensure that students had theunderpinning knowledge important for the unit; they did notcontribute to the overall grade of the qualifications.Differentiation rested on the other, more significant assessmentprocess. Advanced GNVQ students completed activities, projectsand assignments as well as taking part in traditional lessons. As aresult of this work, they put together a portfolio of evidence,demonstrating that they had met all the requirements of theGNVQ programme at the necessary standard. Key Skills wereoften achieved through these activities, although separateteaching of Key Skills occurred where necessary.The external assessment of the Single Award took two forms:tests, and external moderation of the student’s portfolio. The testsconsisted of short-answer papers of one to two hours’ duration,marked by the awarding bodies’ examiners.EXAMINATION TIMING:January/JuneDATE OF RESULT PUBLICATION:March/AugustGRADING SYSTEM:Distinction/Merit/PassWhen the portfolio of evidence had been completed and theunit tests passed, the student gained an overall Pass in thequalification. To achieve a higher overall grade (Merit orDistinction), a student had to have strong evidence of learningskills (planning, information seeking, handling and evaluation anduse of language) and high quality outcomes, as well as satisfyingall the requirements of the 12 vocational units and the threemandatory Key Skills at the appropriate level.QUALITY ASSURANCE:The Advanced GNVQ (Full Award) was also available as a pilotusing an interim structure and assessments.The pilot GNVQ included an interim unit structure, external shortanswertests, a new system for determining the overall grade tobe awarded and new moderation of students’ coursework.The aim of external moderation was to confirm that theassessment decisions made by centres conformed to nationalstandards. The standards moderation process replaced theprevious system of external verification.PROGRESSION/ARTICULATION:Although the achievement of the Single Award led to aqualification in its own right, it could also be used as progressiontowards a Full Award.VARIANTS:See also GNVQ and Part One GNVQ.Sixth Term Examination PapersQUALIFICATION ABBREVIATION:STEPBACKGROUND:STEP was formerly administered by the Oxford and CambridgeSchools Examination Board on behalf of Cambridge Colleges.When it was first examined in the mid-1980s, there were 22STEP papers available. Over the years, the number of papershas been gradually reduced. Most of them, with the exceptionof mathematics, were examined for the last time in 2002 whenAdvanced Extension Awards were introduced. There are nowthree mathematics papers. They are all based on themathematics Advanced GCE Common Core. STEP is currentlyused by some Cambridge Colleges and by other HEIs.DATE OF LAST AWARD:2002 (except for Mathematics)NUMBER OF UNITS/STRUCTURE:Mathematics IMathematics IIMathematics III.Candidates take one or two of these papers.ASSESSMENT METHOD:External assessmentEXAMINATION TIMING:JuneDATE OF RESULT PUBLICATION:August (same date as A/AS results)GRADING SYSTEM:Grade S: OutstandingGrade 1: Very goodGrade 2: GoodGrade 3: SatisfactoryGrade U: UnclassifiedThe minimum standard for Grade 2 is equivalent to the minimumstandard for Merit in an Advanced Extension Award.PROGRESSION/ARTICULATION:Higher education<strong>UK</strong> QUALIFICATIONS 167
Phased Out <strong>Qualifications</strong>Part One General NationalVocational <strong>Qualifications</strong>QUALIFICATION ABBREVIATION:Part One GNVQNATIONAL QUALIFICATIONS FRAMEWORK LEVEL:Level 1 = Foundation, Level 2 = IntermediateBACKGROUND:Part One GNVQs became new GCSE qualifications in vocationalsubjects (Double Award) from 2002.Part One GNVQs have been available nationally since September1999 in seven vocational areas and are broadly equivalent to twoGCSEs. They are also available post-16.The last normal certification date was summer 2003, the lastresit opportunity being January 2004. These qualifications havebeen replaced by GCSEs in vocational subjects.DATE OF FIRST TEACHING:September 1999DATE OF LAST AWARD:January 2004NUMBER OF UNITS/STRUCTURE:Three unitsASSESSMENT METHOD:An assessment regime consisting of a graded test per unit, plusportfolio evidence.EXAMINATION TIMING:January/JuneDATE OF RESULT PUBLICATION:March/AugustGRADING SYSTEM:Distinction/Merit/PassVARIANTS:See also GNVQs and GCSEs in vocational subjects.ifs Certificate in FinancialServices PracticeQUALIFICATION ABBREVIATION:CFSPNATIONAL QUALIFICATIONS FRAMEWORK LEVEL:Level 3BACKGROUND:The Certificate in Financial Services Practice (CFSP) wasdesigned to:gggimprove students’ knowledge of the financialservices industrydevelop financial literacy and business awarenesshelp those working in a customer services environmentprovide a better service to their customers.The CFSP has also been designed to cover many of theknowledge and understanding requirements of the ProvidingFinancial Services (Banks and Building Societies) NVQs,particularly at levels 2 and 3.The aims of the CFSP are to:ggggggprovide an up-to-date body of knowledge of the <strong>UK</strong> financialservices sector, which can serve as a basis for further studyand developmentprovide an introduction to organisational systems andprocesses both generally and within the financialservices sectorencourage an understanding of an individual’s role as part ofan organisation within the financial services sectorprovide an opportunity for the individual to experience avariety of differing aspects of the financial services industry,and thus be in a position to make informed decisionsdevelop an awareness and understanding of the ways inwhich regulation and legislation impact on, and are relevantto, the individual’s organisation and the financial servicesindustry in generalengender an awareness of the need for, and the value of,effective customer service in the financial services sector.DATE OF LAST AWARD:2004ASSESSMENT METHOD:To complete the qualification, candidates must pass five subjects– three core subjects and two option subjects. The core subjectsare designed to give students a broad understanding of thefinancial services environment, while the option subjects allowstudents to develop specialist knowledge.The CFSP can be studied as a self-study course or students mayreceive tuition at an appointed centre. Each subject is supportedby a self-study text. Each subject requires approximately 40hours of study time, which, for the whole qualification, equates toapproximately 200 hours of study. The subjects are assessed bytwo-hour multiple-choice examinations.GRADING SYSTEM:GradeUCAS Tariff pointsPass 60VARIANTS:ifs provides a wide range of qualifications to suit the needs of thefinancial services industry.ggggggggDiploma in Financial Services Management (DFSM)Diploma in Mortgage Lending (DML)Diploma in Trust and Estate Practice (DTEP)Certificate in Mortgage Advice and Practice (CeMAP)Certificate for Financial Advisers (CeFA)Certified Documentary Credit Specialist (CDCS)Contact Centre Professional (CCP)The Certificate and Diploma in English for Banking andFinance (CEBF/DEBF).Further information about ifs qualifications is available from theInstitute of Financial Services.Advanced Subsidiary VocationalCertificate of EducationQUALIFICATION ABBREVIATION:ASVCE (also known as the three-unit VCE)NATIONAL QUALIFICATIONS FRAMEWORK LEVEL:Level 3BACKGROUND:New qualifications with the same AS and A2 structure as existingGCE qualifications were introduced to replace VCEs for firstteaching in September 2005. The new qualifications are knownas Advanced Subsidiary and Advanced GCEs in applied subjects,and four awards are available: AS (three AS units), AS double168 <strong>UK</strong> QUALIFICATIONS
Phased Out <strong>Qualifications</strong>award (six AS units), Advanced (three AS and three A2 units) andAdvanced double award (six AS and six A2 units).The ASVCE was available from September 2000 in the followingvocational areas only:gBusinessgEngineeringgHealth & social caregInformation & communication technology (ICT).The ASVCE was designed to promote breadth and addenrichment to students’ learning programmes, encouraging themto mix and match AVCE qualifications with other qualifications,or to pursue vocational study part-time, possibly in conjunctionwith part-time employment. Students would normally completethis award in one year, but it may have been taken overa longer period.The ASVCE was referred to as ‘Advanced Subsidiary (AS)’.However, while it was the same size as the GCE AS, it was not‘subsidiary’ in nature. Its units were assessed at full AVCEstandard and there was no requirement to teach them in aparticular order.DATE OF FIRST TEACHING:2000DATE OF FIRST AWARD:2001DATE OF LAST AWARD:2006NUMBER OF UNITS/STRUCTURE:Three unitsASSESSMENT METHOD:The AVCE, ASVCE and AVCE Double Award all drew fromthe same pool of units and used the same assessmentarrangements: a combination of externally assessed writtenpapers (usually 30%) and internally assessed coursework/portfolio (usually 70%).EXAMINATION TIMING:January/JuneDATE OF RESULT PUBLICATION:March/AugustGRADING SYSTEM:For the ASVCE, an A – E grading system was used, givingcomparability with GCE AS level.GradeUCAS Tariff pointsA 60B 50C 40D 30E 20GRADING ADDITIONAL INFORMATION:U indicated an unclassified performance which was not certificated.QUALITY ASSURANCE:The ASVCE was quality assured by the same mechanisms as theAVCE six-unit award.Advanced Vocational Certificateof EducationQUALIFICATION ABBREVIATION:AVCE (also known as the six-unit AVCE)NATIONAL QUALIFICATIONS FRAMEWORK LEVEL:Level 3BACKGROUND:New qualifications with the same AS and A2 structure as existingGCE qualifications were introduced to replace VCEs for firstteaching in September 2005. The new qualifications are knownas Advanced Subsidiary and Advanced GCEs in applied subjects,and four awards are available: AS (three AS units), AS DoubleAward (six AS units), Advanced (three AS and three A2 units) andAdvanced Double Award (six AS and six A2 units).AVCEs were qualifications which enabled students to developskills, knowledge and understanding in the vocational area theywere studying and prepared them for both the world of work andfor progression to higher education. They were informally knownas ‘Vocational A levels’.AVCEs were designed to be related to National OccupationalStandards in relevant sectors and to equip students with up-todateknowledge, skills and understanding of the underpinningprinciples and processes of those sectors. Learning was expectedto be active and student-led, although directed by teachers andsupported by professional and employer input. The six-unit AVCEwas the same size as GCE A level, and the overall grade was onthe same A – E scale.In autumn 2000, the Advanced GNVQ was replaced by the newAVCE as a part of the introduction of Qualifying for Successreforms. The AVCE was available as a series of different sizes ofaward to promote flexibility in the post-16 curriculum:gVCE Advanced Subsidiary (ASVCE) – three unitsgAVCE – six unitsgAVCE Double Award – 12 units.The achievement of an AVCE was not dependent on achievementof Key Skills. However, the development of Key Skills formed anintegral part of the AVCE and they were signposted in thevocational units.DATE OF FIRST TEACHING:2000DATE OF FIRST AWARD:2002DATE OF LAST AWARD:2006NUMBER OF UNITS/STRUCTURE:AVCE was available from September 2000 as a six-unit award.The award consisted of a mixture of compulsory and optionalunits. Within individual vocational areas, there may have beenalternative models of how the AVCE was constructed, providinga measure of controlled flexibility. It could be taken over one ortwo years.ASSESSMENT METHOD:The ASVCE, AVCE and AVCE Double Award all drew from thesame pool of units and used the same assessmentarrangements: a combination of externally assessed writtenpapers (usually 30%) and internally assessedcoursework/portfolio (usually 70%).The broad aim of the redesign of vocational qualifications atadvanced level was to reduce the overall burden of assessmentwhilst strengthening the external element and making clearerwhat students need to learn as opposed to what is assessed.AVCE qualifications were unit-based. Each unit clearly set out thelearning which students must cover in order to provide theassessment evidence. Assessment criteria were used to assessthe students’ ability to apply their skills, knowledge and<strong>UK</strong> QUALIFICATIONS 169
Phased Out <strong>Qualifications</strong>understanding in a vocational context. The assessment criteriawere written for each unit, and the units were written for, andaddressed directly to, the students themselves. The exact natureof external assessment depended on the subject area, level andunit content.Complete portfolio units were assessed by means of unit-specificcontextualised grading criteria. Evidence for assessors on the useof the criteria was given in a section of the units entitled EssentialInformation for Teachers, which suggested teaching strategies,assessment strategies and resources, and includes Key Skillssignposting.EXAMINATION TIMING:January/JuneDATE OF RESULT PUBLICATION:March/AugustGRADING SYSTEM:GradeUCAS Tariff pointsA 120B 100C 80D 60E 40GRADING ADDITIONAL INFORMATION:The final grade was calculated using a points-based system.Separate points were available for each unit, and these wereaggregated to determine an overall grade for the qualification.These points should not be confused with those used on theUCAS Tariff (see above).U indicates an unclassified performance, which was not certificated.QUALITY ASSURANCE:For internal assessment, a moderation system designed to ensurethat entry grades are in line with national standards replaced theexternal verification system. Normally at least a third of theoverall assessment was externally set and marked by theawarding bodies.PROGRESSION/ARTICULATION:The AVCE was designed to promote flexibility in the post-16curriculum allowing students to combine AVCE with otherqualifications, including GCE A level, GCE AS and the ASVCE.Advanced Vocational Certificateof Education: Double AwardQUALIFICATION ABBREVIATION:AVCE Double AwardNATIONAL QUALIFICATIONS FRAMEWORK LEVEL:Level 3BACKGROUND:New qualifications with the same AS and A2 structure as existingGCE qualifications were introduced to replace VCEs for firstteaching in September 2005. The new qualifications are knownas Advanced Subsidiary and Advanced GCEs in applied subjects,and four awards are available: AS (three AS units), AS doubleaward (six AS units), Advanced (three AS and three A2 units) andAdvanced double award (six AS and six A2 units).The former Advanced GNVQ (which consisted of a minimum of12 units) was replaced by the AVCE Double Award.The AVCE Double Award was equivalent in size to two GCEA levels and would normally be taken over two years.Students had the opportunity to supplement the AVCE DoubleAward with additional units which were graded separately. Thesewere often in the same vocational subject area, or includedlanguage units. Where students wished to take additional studiesin a different vocational area, they may have taken a six-unitAVCE or three-unit AVCE award in that subject area.DATE OF FIRST TEACHING:2000DATE OF FIRST AWARD:2002DATE OF LAST AWARD:2006NUMBER OF UNITS/STRUCTURE:Twelve unitsAccording to the vocational subject area, the AVCE Double Awardwas structured within the following rules:gga minimum of six and a maximum of eight compulsory unitsa maximum of six optional units.ASSESSMENT METHOD:The ASVCE, AVCE and AVCE Double Award all drew from the samepool of units and used the same assessment arrangements, thatis, through a combination of externally assessed written papers(usually 30%) and internally assessed coursework/portfolio(usually 70%).EXAMINATION TIMING:January/JuneDATE OF RESULT PUBLICATION:March/AugustGRADING SYSTEM:The award resulted in the student receiving two related grades onan A – E scale, ie AA, AB, BB, BC, CC, CD, DD, DE, EE. It shouldbe understood that these are paired overall grades for the wholeaward, and are not two individual grades relating to clusters ofsix units.GradeUCAS Tariff pointsAA 240AB 220BB 200BC 180CC 160CD 140DD 120DE 100EE 80GRADING ADDITIONAL INFORMATION:U indicated an unclassified performance which was not certificated.QUALITY ASSURANCE:The AVCE Double award was quality assured by the samemechanisms as the AVCE six-unit award.Diploma of AchievementBACKGROUND:OCR offered a skills-based Diploma of Achievement designed tocomplement students’ studies on post-16 courses. (This Diplomawas previously offered by OCEAC.) The Diploma course wasconcerned with the development of a wide range of life skills,including key skills, and provided evidence in the form of acertificate reporting skills attainment, together with a portfolio.The assessment was withdrawn in 2004.170 <strong>UK</strong> QUALIFICATIONS
Phased Out <strong>Qualifications</strong>General National Vocational<strong>Qualifications</strong>QUALIFICATION ABBREVIATION:GNVQNATIONAL QUALIFICATIONS FRAMEWORK LEVEL:level 1 = Foundation GNVQ, level 2 = Intermediate GNVQ.BACKGROUND:GNVQs were introduced as part of the National <strong>Qualifications</strong>Framework for England, Wales and Northern Ireland in responseto the Government’s White Paper Education and Training for the21st Century (May 1991).GNVQs are available at two levels and the following table providesan equivalence with qualifications in the general category.Intermediate 6 units 4 GCSEs (grades A*-C)3 units 2 GCSEs (grades A*-C)Foundation 6 units 4 GCSEs (grades D-G)3 units 2 GCSEs (grades D-G)Following the GNVQ Assessment Review (November 1995)and piloting during 1996/8, GNVQs were redesigned in all areas.The redesigned GNVQ has been available since September 2000.The names of Foundation and Intermediate GNVQs remainunchanged.The broad aim of the redesign was to reduce the overall burdenof assessment while strengthening the external element andmaking clearer what students need to learn as opposed to whatis assessed.The achievement of a GNVQ is not dependent on achievementof Key Skills. However, the development of Key Skills forms anintegral part of the redesigned qualifications. The revised KeySkills are signposted in the vocational units to support Key Skillsachievement. Key Skills are separately certificated through theKey Skills qualifications.The Government has decided that Foundation and Intermediatesix-unit GNVQs should be phased out, as successor qualificationsare identified. Candidates should no longer be able to register forthese qualifications although further details of when each GNVQwill be withdrawn can be found on the QCDA website,www.qcda.org.uk/DATE OF FIRST TEACHING:2000DATE OF FIRST AWARD:2002NUMBER OF UNITS/STRUCTURE:Six unitsEach unit clearly sets out the learning the students must cover inorder to produce the assessment evidence.Assessment criteria are used to assess the students’ ability toapply their skills, knowledge and understanding in a vocationalcontext. The assessment criteria are written for each unit,replacing the separate generic grading criteria. Units, includingthe assessment criteria, are written for, and addressed directly to,the students.ASSESSMENT METHOD:Assessment is through a combination of internal and externalrequirements: namely continuously assessed portfolios and shorttest papers. The exact nature of external assessment variesdepending on the subject area, level and unit content.Complete portfolio units are assessed by means of the unitspecificcontextualised grading criteria. Assessors are guided inthe use of the criteria by a new section in the units entitled‘Essential Information for Teachers’, which suggests teachingstrategies, assessment strategies and resources, and includesKey Skills signposting.EXAMINATION TIMING:January/JuneDATE OF RESULT PUBLICATION:March/AugustGRADING SYSTEM:The final grade is calculated using a points-based system.Separate points are available for each unit, and these areaggregated to determine an overall grade for the qualification.Grades for Foundation and Intermediate GNVQ remain as Pass,Merit and Distinction.QUALITY ASSURANCE:For internal assessment, a standards moderation systemdesigned to ensure that entry grades are in line with nationalstandards has replaced the external verification system.Normally at least a third of the overall assessment is externallyset and marked by the awarding bodies.VARIANTS:See also Advanced GNVQs and Part One GNVQs.NCSC National ChristianSchools’ CertificateQUALIFICATION ABBREVIATION:NCSCBACKGROUND:The NCSC provides qualifications for pupils who use theAccelerated Christian Education (ACE) programme. A relativelysmall number of pupils gain these qualifications annually, mainlyfrom small independent faith-based schools. A growing numberof pupils educated at home have opted for the NCSC Certificateprogramme. NCSC level 3 is recognised by many universities forundergraduate entry.Since September 2004, the NCSC has been replaced by theInternational Certificate of Christian Education (ICCE). Thecurriculum content and standard have been enhanced by theaddition of coursework The designation of certificates haschanged (see separate ICCE entry). NCSC qualifications remainvalid in the <strong>UK</strong>.DATE OF FIRST AWARD:1994PREREQUISITES:A recommended minimum of two years on the full ACEprogramme.NUMBER OF UNITS/STRUCTURE:NCSC level 1 = 16 unitsNCSC level 2 = 23 unitsNCSC level 3 = 30 unitsNCSC Honours Certificate = 35 units.ASSESSMENT METHOD:By unit tests, essays and externally moderated assessments(80% internal, 20% external).EXAMINATION TIMING:Throughout the year<strong>UK</strong> QUALIFICATIONS 171
Phased Out <strong>Qualifications</strong>DATE OF RESULT PUBLICATION:Throughout the yearGRADING SYSTEM:A 100%–96%B 95%–92%C 91%–88%D 87%–84%E 83%–80%Fail below 80%QUALITY ASSURANCE:All unit tests are moderated by external moderators. Schools arevetted by an annual assessment visit. Home educated pupilsreceive home visits and are required to submit all tests annually.PROGRESSION/ARTICULATION:Pupils complete all levels of the certification programme over aperiod of approximately five years. Pupils must complete thelower certificates before proceeding to the next.Progress FileENGLANDProgress File – a set of interactive materials designed to supportlearners’ goal-setting, learning and study skills, progressmonitoring and recording of achievements – has been used bymany schools and colleges since becoming nationally available inApril 2002. These materials, supplied free of charge by theDepartment for Education & Skills, addressed a range of 14-19and Skills White Paper policy objectives – for the development ofindependent learners, able to manage their own development andto make successful transitions between age phases, institutionsand into work.The DfES ceased to make Progress File materials available inApril 2006 as the principles and processes that underpinProgress File are now well-established and have been adopted inan increasing range of other products and services. Users areencouraged to continue applying those principles and processesto their own circumstances, making use of other tools andsolutions as appropriate. To help in this transition, the DfESwaived all copyright in its Progress File materials – so that theycan be copied and adapted for local use.The Centre for Recording Achievement, has provided thefollowing additional information.“Progress File can help individuals record both academic andnon-academic achievements and select those most relevant totheir needs. The activities of reviewing and target setting arecentral to Progress File, which also provides detailed guidance forusers to help develop these skills. It also provides a context withinwhich Individual Learning Plans can focus on future educationaland/or vocational targets being devised and implemented. Linkscan also be made with approaches to teaching and learningbeing developed with vocationally related qualifications.”Use in the admissions processMany institutions recognise the value in helping individualsdevelop the skills of reflection, recording and action planning.These not only help to build crucial personal organisational andself-management skills, but enable them to take ownership oftheir own development and apply their skills and achievements toa wide range of situations. Progress File can be used in a widerange of contexts and can provide useful information for the HEadmissions process. Progress File is also designed to helpindividuals link their achievements to key skills.A good recording achievement structure supports the developmentof students’ forward plans and can help motivation and improvechoice. Several projects have shown that where such a structureis in place, applicants can enhance the quality of their applications.The Centre for Recording Achievement, a national cross-sectornetwork organisation, works to encourage the use of records ofachievement within the HE applications process, and to supporttutors and applicants in making effective use of the recording andplanning experience and documentation in all applications. Thefollowing ways in which engagement in Progress File practice cansupport an application to HE have been identified.gProviding a basis for the construction of the personalstatement.gA source of additional material to support applications sentto particular institutions.gA direct source of evidence that may be valuable inconsidering applicants in Clearing.gA document for collection and display of evidenceaccumulated in compact arrangements, local progressionrecords or within the new Partnership for Progression initiative.At Clearing, Progress File may enable individuals to offeradditional, clear and up-to-date information to institutions toassist decision-making at a critical time. Admission tutors mayrequest a summary copy (not the original) of information from theProgress File directly from the applicant.Interest in recording achievement has not been confined toschools and FE. Over the last 10 years, a large number of HEIshave developed a range of practices under names like Personaland Academic Records, Personal Profiles or Learning Logs.During 1999/2000, the QAA, CVCP (now Universities <strong>UK</strong>) andSCOP (now GuildHE) worked together to consult on the mostappropriate means of taking forward the recommendations of theDearing Enquiry into HE that all institutions should develop aProgress File (incorporating a Personal Development Record basedon a process of Personal Development Planning). A policystatement was produced in May 2000. This set a target for theimplementation of Personal Development Planning across the HEsector as a whole by 2005/6. This was confirmed in the HEStrategy Paper, The Future of Higher Education. From September2005, the Centre for Recording Achievement is supporting theHigher Education Academy in the implementation of PersonalDevelopment Planning in the HE sector.WALESIn Wales, the Assembly has provided funding for Careers WalesOnline (CWO), which is targeted at both young people and adultsin Wales, whether in or out of formal education. Its primary aimsare to help people to initiate their lifelong learning and careerdevelopment process, and then to provide support for that process.The main portal is a gateway to dedicated pages for differenttarget groups: up to 16, 16-19, 19+, professionals and employers.CWO contains an ‘e-progress file’ that highlights both processand product benefits: (as) ‘a process that helps you take morecontrol of your learning, your personal development and yourplans for the future. It's about making improvements, seizingopportunities and achieving more (which) enables you to:gsave all your information in one place and update itwhenever you wantgidentify and value your skills and qualities, recognise yourachievements and use that information to make betterchoices for the futuregkeep an up-to-date online record of all your plans, documentsand information that you can share with other people.’For more information see www.careerswales.com/172 <strong>UK</strong> QUALIFICATIONS
Phased Out <strong>Qualifications</strong>SCOTLANDWithin Scotland, parallel developments are in train. For example,‘Assessment is for Learning’ funding has been directed to everylocal authority in Scotland to focus on three main strands,including formative assessment and personal learning planning.Progress Files are available in an editable web-enabled version atwww.ltscotland.org.uk/ and the Scottish <strong>Qualifications</strong> Authority(SQA) has developed a module on personal development planningat HNC/HND level which was launched in June 2004. Mostrecently (January 2006), in response to the Consultation on‘Assessment, Testing and Reporting 3–14’ (2003), the ScottishExecutive confirmed support for ‘the development of personallearning planning to reflect best practice, taking full account ofevaluations and concerns about manageability and workload, as away of encouraging pupils to take a fuller part in managing andevaluating their own learning’ (at www.scotland.gov.uk/).NORTHERN IRELANDFor further information on Progress File and the NRA in NorthernIreland, contact Department of Education, Northern Ireland (DENI),or CCEA – see Appendix A for details.<strong>UK</strong> QUALIFICATIONS 173
Other entry routes to higher educationAccreditationof Prior Learning (APL)APL is the overall term widely used for the recognition of, andaward of, academic credit on the basis of demonstrated learningthat has occurred at some time in the past. This learning mayhave come about as the result of a course, or self-directed study,or as the result of experience either at work or in leisure pursuits.It is used in FE, adult education and HE for the purpose of:gggentry into a course or programmeadvanced standing on a course or programmecredit against some of the outcomes of a course orprogramme that will count towards an award.Prior learning capable of assessment and accreditation may takethe form of:gguncertificated or experiential learning (APEL or Accreditationof Prior Experiential Learning)certificated learning (which is the form of prior learning mostusually identified as APL, and also called APCL, orAccreditation of Prior Certificated Learning. It can also betermed RPL, or Recognition of Prior, or Previous, Learning).The main underpinning principle of APL is that credit is given forevidence of learning, not for experience alone. The resultingcredit is notionally of the same value within an award as thatgained through a taught programme. Arrangements for APL willvary from institution to institution. Full details of the process willbe found within institutions’ own guidelines, regulations andquality assurance frameworks.Learners wishing to use APL to access HE will need to:gggidentify a potential programme/awardmatch previous learning against the requirements stipulatedby the institutionprovide evidence of that learning – either in writing or someother tangible form, and/or through an interview.The institution, meanwhile, will need to:ggggensure that the background information about the course isaccurate and clearly expressed so that it is possible forapplicants to see how they might match prior learning toits outcome 1have people available who can advise candidates in theprocess of identifying prior learning and submitting evidenceprovide assessors who can quantify the demonstratedlearning within the context of the programme/award that thecandidate is seeking to accesssatisfy itself that the evidence offered by the applicant issufficient, authentic, current and valid in relation to therelevant learning outcomes, taking into account the level andvolume of credit sought.If both sets of actions are successfully implemented, it is thenpossible for individual learners to negotiate the ‘terms andconditions’ that will enable them to study for the rest of theaward against which their prior learning has already beenrecognised.Some HEIs offer taught or online modules to facilitate the APLprocess described above.Learners wishing to take advantage of APL may do so on thebasis of many forms of learning:gggggggexperiential learning acquired in paid workexperiential learning acquired in unpaid or voluntary workexperiential learning acquired from leisure activitiesuncertificated learning from self-directed studycertificated learning from abroadcertificated learning from other <strong>UK</strong> educational institutionscertificated work-based learning.Within the sphere of further and adult education, learners mayuse their prior learning for:ggggentry into vocational programmesentry with advanced standing onto some longer courses (forexample, direct entry into the second year of HE programmesdelivered in an FE college, such as a foundation degree,HND, etc)credit towards academic, vocational, occupational andcompetence-based qualificationsentry into Access to Higher Education provision.Within HE, prior learning may be used, upon assessment by thereceiving institution, for:gggentry into the institutiondirect entry into a second or subsequent year of aprogrammeadvanced standing with credit towards a target award (forexample, the award of credit against specified moduleswithin a programme, which do not necessarily amount to theequivalent of a whole year).Credit for Higher and FurtherEducation <strong>Qualifications</strong>WHAT IS CREDIT?Credit is a tool for assessing and expressing learningachievement and equivalence. It plays an important role inrewarding the incremental progress of learners, facilitatingstudent transfer and recognising prior learning, and it contributesto the definition of academic standards. The QAA document‘Academic Credit in Higher Education in England’, written toaccompany the Burgess proposals for a national credit frameworkin England, should be used as a reference for furtherunderstanding of the definitions and issues discussed here.Thefundamental principle is that credit is awarded only for evidenceof learning achievement. Two parameters are used to reflect thelearning achievement: credit value and credit level.CREDIT VALUEThe first parameter, credit value, is the number of credits whichrepresents the amount of learning needed to achieve a set oflearning outcomes. The number of credits is derived from anestimate of the notional learning time involved. This is defined asthe total amount of time which, on average, it is expected that alearner will undertake to achieve a set of designated learning1The Final Report of the Burgess Group on credit in England (2006) proposed that,“by the start of the academic year 2009/10, English HEIs should have credit-ratedtheir main provision and thereafter include the credit value in a publisheddescription of each of the programmes they offer”.174 <strong>UK</strong> QUALIFICATIONS
Other Entry Routes To Higher Educationoutcomes. Generally, in <strong>UK</strong>-based HEIs, the credit to learning timeratio is normally 1 credit: 10 notional hours of study. In the FEand adult learning sectors, Access to HE courses, validated byQAA-licensed regional Authorised Validating Agencies (AVAs),operate on the same basis of 1 credit: 10 hours. Credit using thistariff is also awarded by the National Open College Network(NOCN) and its regional Open College Networks (OCNs), generallylicensed by QAA. Before August 2005 a tariff of 1 credit: 30notional hours was used in this sector.CREDIT LEVELThe second parameter is the credit level, which is an indicator ofthe relative academic demand on the learner in undertaking thestudy. Successively higher levels reflect increasing demand onthe learner in terms of complexity, intellectual rigour andautonomy of learning.Credit levels are related to but are different from qualificationlevels, which indicate the principal outcomes that a studentshould be able to demonstrate following completion of awards atthe designated level. The credit levels are placed within a seriesof levels based upon upward progression. The following outlinelevel descriptors are becoming increasingly widely used.gggggggggEntry: Employ recall and demonstrate elementarycomprehension in a narrow range of areas.Level 1: Employ a narrow range of applied knowledge, skillsand basic comprehension within a limited range ofpredictable and structured contexts.Level 2: Apply knowledge with underpinning comprehensionin a number of areas and employ a range of skills within anumber of contexts, some of which may be routine.Level 3: Apply knowledge and skills in a range of complexactivities demonstrating comprehension of relevant theories.Access and analyse information independently and makereasoned judgements, selecting from a wide choice ofprocedures in familiar and unfamiliar contexts.Level 4: Develop a rigorous approach to the acquisition of abroad knowledge base. Employ a range of specialised skillsand evaluate information using it to plan and developinvestigative strategies. Determine solutions to unpredictableproblems.Level 5: Generate ideas through the analysis of concepts atan abstract level with a command of specialised skills and theformulation of responses to well-defined and abstract problems.Level 6: Critically review, consolidate and extend asystematic and coherent body of knowledge. Criticallyevaluate new concepts and evidence from a range ofsources. Transfer and apply diagnostic and creative skills andexercise significant judgement in a range of situations.Level 7: Display mastery of a complex and specialised areaof knowledge and skills, employing advanced skills to conductresearch or advanced technical or professional activity.Level 8: Make a significant and original contribution to aspecialised field of enquiry demonstrating a command ofmethodological issues and engaging in critical dialoguewith peers.THE AWARD OF CREDITCredit is awarded for the assessed achievement of learningoutcomes. These are statements of what the student will know,understand or be able to do, on successful completion of thelearning experience. Each module (HE) or unit of assessment (FE)has a coherent set of formally identified learning outcomes.Normally, in order to earn credit for the module, the studentshould satisfy the assessment criteria for all (or, in HE, themajority) of the designated learning outcomes for the module orunit. The module/unit is the smallest entity for which credit maybe awarded. The number of credits awarded for successfulcompletion of the module is the credit value of the module. Thecredit value therefore defines the nominal size of the module andreflects the estimated notional learning hours. Thus all units,modules, programmes and qualifications can be specified interms of a credit value and credit level(s).CREDITS AND QUALIFICATIONSThe <strong>Qualifications</strong> and Credit Framework (QCF) is a newframework for recognising and accrediting qualifications inEngland, Wales and Northern Ireland. The framework was at theheart of a major reform of the vocational qualifications systemdesigned to make the whole system simpler to understand anduse and more inclusive. The intention was to make both thesystem and the qualifications offered more relevant to the needsof employers and more flexible and accessible for learners.The QCF awards credit for qualifications and units (small steps oflearning) and enables people to gain qualifications at their ownpace along flexible routes.Learners may achieve credit-based or other programmes thatconstitute acceptable evidence of their readiness to commencean HE programme, or evidence of supplementary achievement inaddition to their main qualification. Access to HE, and OCN,credits are recorded on transcripts/certificates provided by theAVA, and by NOCN.The following table offers some guidance as to the equivalencesbetween levels and qualifications at FE levels.Level 3 NVQ 3 AVCE GCE A levelLevel 2 NVQ 2 Intermediate GNVQ GCSE A*-CLevel 1 NVQ 1 Foundation GNVQ GCSE D-GEntry levelIt is important to remember that not all <strong>UK</strong> HEIs use creditsystems. The table below, however, sets out the recommendedminimum credit values of undergraduate and associatedqualifications offered by institutions in England, Wales andNorthern Ireland. The second column indicates the qualificationlevel for each qualification.This series of nine levels spans the FE/HE sectors in England,Wales and Northern Ireland. Courses leading to the award of thebachelor degree with honours normally start at level 4 andculminate at level 6. NOCN uses an equivalent set of descriptorsfor Entry level and levels 1 to 3, with some regional OCNs usinglevels 4 and 5.<strong>UK</strong> QUALIFICATIONS 175
Other Entry Routes To Higher EducationQUALIFICATION HEQF MINIMUM OVERALL RANGE OF LEVELS/ MAXIMUM CREDITS ATQUALIFICATION CREDITS NUMBER OF CREDITS LOWEST LEVELLEVELAT HIGHEST LEVELHonours degree H (3) 360 credits Levels (3), 4, 5, 6 30 credits at Level 3min 90 credits at Level 6Ordinary degree I (2) 300 credits Levels (3), 4, 5, 6 30 credits at Level 3min 60 credits at Level 6Foundation degree I (2) 240 credits Levels (3), 4, 5 30 credits at Level 3min 90 credits at Level 5Diploma HE I (2) 240 credits Levels (3), 4, 5 30 credits at Level 3min 90 credits at Level 5HND I (2) 240 credits Levels (3), 4, 5 30 credits at Level 3min 90 credits at Level 5HNC C (1) 150 credits Levels (3), 4, 5 30 credits at Level 3min 30 credits at Level 5Certificate HE C (1) 120 credits Levels (3), 4 30 credits at Level 3min 90 credits at Level 4The Open UniversityThe Open University (OU) is the world’s leading open and distanceteaching university. Established by Royal Charter in 1969, it hasbecome Britain’s largest higher education institution. The OU hasbeen one of the top three <strong>UK</strong> universities for student satisfactionin the National Student Survey every year since the survey beganin 2005. In 2009/10 it had a 93 per cent satisfaction rating.More than 50% of the University’s research is rated‘internationally excellent’ (3*) and 14% is ‘world-leading’ (4*).The Open University began teaching undergraduates in 1971. Inits first year, the OU had 20,000 students. In 2011, more than264,000 people study with the OU, including 18,000 studentsstudying directly with the University overseas. It offers a widerange of undergraduate and postgraduate certificates, diplomasand degrees. Most qualifications are made up by combining freestandingcourses.OU students study part-time from home, work or wherever theychoose. They have a personal tutor to answer questions andprovide study support, including feedback and assessment ofregular pieces of written work. Many modules also includeoptional group tutorials, usually on weekday evenings orSaturdays.There are two main routes to an undergraduate degree. Studentscan choose from the full range of undergraduate courses toobtain a BA or BSc tailored to meet their own requirements.Alternatively, they can choose from more than 50 honoursdegrees in different named subjects, including computing,humanities, the natural sciences, psychology and social sciences.Students need a minimum of 300 credits for a degree withouthonours and 360 for a degree with honours. Most students do nomore than 60 points’ worth of modules a year and take at leastsix years to complete their degrees. Some, however, study at 120points a year, which is the equivalent of full-time.There are no selection procedures and no entry requirements formost undergraduate-level modules and qualifications. Moststudents find it sensible to start with either a short Openingsmodules or a level 4 (HE level 1) module. The Openingsprogramme of introductory modules has been specially designedto give students a chance to ‘test the water’ with a short 10-credit-point module, before committing themselves to fullundergraduate study at HE level 1. They have four start dates ayear – March, May, July and September – and each module lastsup to 20 weeks.As well as introducing particular subject areas, the 30- or 60-point level 4 (HE level 1) modules develop the skills necessary toprogress to higher levels. They provide extra support, such asmore frequent optional tutorials, to help students to get used tothe OU way of studying as quickly and efficiently as possible.Tutorials give opportunities to meet a tutor and other students.Once students are familiar with OU teaching methods anddevelop their learning skills, they should be very well prepared forfurther degree-level study, whatever their educationalbackground.The OU has paid special attention to its level 4 (HE level 1)modules to make sure that they are accessible to a wide varietyof entrants, whether they already have knowledge of the subjectarea or not. The credits acquired contribute towards the degree.Level 4 (HE level 1) modules are not preparatory to degree-levelstudy, they are part of it. Some modules at level 4 (HE level 1)offer a certificate if completed successfully.Most undergraduate modules start in February and runcontinuously for about nine months, with an examination (if themodule has one) in October. Other undergraduate modules havedifferent start dates, mainly in May and November.What is included in an individual course depends largely on thesubject and on how it is taught. Most courses provide several ofthe following:ggggspecially written textbooks, workbooks and other printedmaterialsonline Virtual Learning Enviroments and e-learning toolsequipment lent out for practical work – particularly forscience and technology coursesaudio and video recordings.In most OU modules, academic performance is measured bycontinuous assessment and written examinations or examinedproject work. Continuous assessment measures performance inassignments throughout the module; these may be pieces ofwritten work marked by the tutor, or multiple-choice questionsmarked by computer. Marks are combined with those awardedfor any examined or project work at the end of the module tocalculate a student’s final result. Assessment in the OU is closelylinked to teaching. As well as marking assignments, tutors willcomment on them, pointing students in new directions,elaborating on points of difficulty or contention and giving ageneral sense of progress.In 2006 the OU became the first <strong>UK</strong> university to offer learningmaterials free online, when it launched OpenLearn176 <strong>UK</strong> QUALIFICATIONS
Other Entry Routes To Higher Educationwww.open.ac.uk/openlearn. Since then, there have been morethan 16.7 million visits. These learning materials cannot becounted for an award, however.The OU has a Young Applicants in Schools Scheme which givesspecially selected students in Year 12/13 the chance to takecertain level 1 modules, either to extend beyond their AS levelstudies or to add breadth. The scheme relates to a number ofGovernment agendas, including provision for gifted and talentedstudents through the National Academy for Gifted and TalentedYouth. The young students are treated in the same way as anyother OU student. As well as undertaking the academicchallenges, they have acquired learning skills, studying alongsideadults and studying independently, while maintaining theirmotivation over a period of up to nine months. The majority ofstudents have chosen a level 4 (HE level 1) module that gives them30 or 60 credit points, depending on the module taken. The OU isintroducing an increasing number of short modules that are alsobeing offered to young students and which count for 10 credits.Some students want to use OU module credits to enter firstdegree programmes at other institutions, and perhaps to gainexemption from part of the programme. Decisions aboutadmission and exemption are always made by the otherinstitution. The decision will depend on the availability of places,the appropriateness of the OU modules taken, and perhaps thelevel of pass obtained. Many universities have signed agreementswith the OU, confirming that they will take account of OU credit.In practice, almost all higher education institutions will considerapplicants with OU credit, even if there is no formal agreement.<strong>UK</strong> QUALIFICATIONS 177
WalesThe Department of Education and Skills (DfES) is contributing tothe Welsh Government’s vision of better public services.The Welsh Government launched a review of qualifications for14-19 year olds in Wales in September 2011. The Review willmake recommendations for consideration by Welsh Ministers inNovember 2012. It aims to create a clear and simple systembased on coherent programmes of learning, with relevant, valued,internationally recognised qualifications underpinned byassessment that is robust, valid and proportionate and which willhelp drive improvements in literacy and numeracy. WelshMinisters have indicated that no significant changes will be madeto qualifications in Wales during the review, and that any changesin the future will take into account its recommendations.PRIORITIESThe Department’s key objectives are:gggTo raise the standards of education performance acrossWales so that all can reach their potential.To improve the personal social and economic wellbeing ofchildren, young people and families.To support a high skills economy with opportunities foreveryone.More information on qualifications in Wales can be found at:http://wales.gov.uk/topics/educationandskills/qualificationsinwalesOBJECTIVESDfES leads the education and training system in Wales in its dutyto improve outcomes for children, young people and learners ofall ages and businesses so that all can reach their potential.Within DfES the <strong>Qualifications</strong> and Learning Division providesexpert advice to Welsh Ministers on General, Vocational and Skillsqualifications (except those within Higher Education) anddischarges the statutory responsibilities of Welsh Ministers inrelation to the regulation of those qualifications in Wales. As partof this the Division is responsible for the approval of qualificationsfor use with learners in Wales aged 14 or over, excluding highereducation. Details of approved qualifications are available fromthe Database of Approved <strong>Qualifications</strong> in Wales (DAQW). Moreinformation on the DAQW can be found at:http://www.daqw.org.uk/178 <strong>UK</strong> QUALIFICATIONS
Northern IrelandA revised curriculum was introduced from 2007. This focuses onthe development of young people as individuals, members ofsociety and contributors to the economy and the environment.The result is learning programmes that encourage pupils toengage more fully in their own learning and providesopportunities for the development of the skills and capabilitiesthat are vital for success in a rapidly changing world.The profile of skills has been raised for 4-14 year olds throughthe development of a thinking skills and personal capabilitiesframework, which includes:gggggggmanaging information;thinking;problem solving;decision making;being creative;working with others;and self-management.At Key Stage 3 an additional area of learning entitled ‘Learningfor Life and Work’ (LLW) has been developed to include personaldevelopment, home economics, citizenship and employability.At Key Stage 4 there is now greater flexibility with opportunitiesfor schools to develop learning programmes that best meet theneeds of their learners. The statutory core for 14-16 year oldscovers around 30% of curriculum time and includes:There are no longer detailed subject Programmes of Study at KeyStage 4. However, schools must provide opportunities for breadthand balance by enabling their pupils to access courses andqualifications related to the following learning areas:ggggThe ArtsEnvironment and SocietyModern LanguagesScience and Technology.Legislation will be introduced to promote breadth within thecurriculum for 14-19 year olds. The Entitlement Framework willrequire schools to make available a balance of General(academic) and Applied (vocational) courses for all their students.The Entitlement Framework will, therefore, support a range ofqualifications with a sufficient degree of choice and challenge forall students, whatever their ability. It is important that studentskeep their options open, particularly at Key Stage 4. An importantaspect of provision is, therefore, the availability of career advice,education and guidance for all young people throughout the 14-19 phase. The Department of Education has worked with theDepartment for Employment and Learning (DEL) to put in place acareers strategy.gggggthe skills of communication;using mathematics and ICT;LLW (comprising personal development, citizenship andemployability);physical education; andreligious education<strong>UK</strong> QUALIFICATIONS 179
180 <strong>UK</strong> QUALIFICATIONS<strong>Qualifications</strong> inScotland
IntroductionGUIDE FOR ADMISSIONS STAFFThis section is intended to give admissions tutors and other staffwith responsibility for admissions to Higher Education Institutions(HEIs) an overview of Scottish qualifications, particularly thosethat may be presented to them by applicants. This overviewincludes the National <strong>Qualifications</strong> (introduced in Scotland from1999) and phased out predecessor qualifications.This section also provides a background to entry to highereducation (HE) in Scotland, including relevant information on theScottish education system and recent developments. Of particularimportance is the Scottish Credit and <strong>Qualifications</strong> Framework(SCQF), which brings all mainstream Scottish qualifications, fromScottish <strong>Qualifications</strong> Authority (SQA) Access 1 to HE Doctorate,into a single framework of 12 levels, and describes them in termsof their level and general credit value. The SCQF complementsthe Scottish Government’s strategy for promoting lifelonglearning. It is intended to make the overall system of Scottishqualifications easier to understand by making it clearer howqualifications relate to one another and helping to clarify thevarious progression and credit transfer routes, including entry toHE.The general topics covered are as follows.The Scottish Credit and <strong>Qualifications</strong>FrameworkAwarding and accrediting body – Scottish<strong>Qualifications</strong> AuthorityCurrent Scottish qualificationsPhased out qualificationsCertificates and other supporting evidencelikely to be offered by applicantsRoutes into Higher Education in ScotlandContact detailsThe Scottish Credit and <strong>Qualifications</strong> FrameworkThe Scottish Credit and <strong>Qualifications</strong> Framework (SCQF) hasbeen created by bringing together all mainstream Scottishqualifications into a single unified framework – HE qualifications,including HNCs and HNDs, National <strong>Qualifications</strong>, such asHighers and Advanced Highers, and SVQs. Increasingly, provisionother than that offered by HEIs and SQA is being brought into theframework. The framework has 12 levels covering a range ofqualifications from Access 1 (National Qualification) to HEDoctorate.The aims and benefits of the SCQF include:ggggggincreasing understanding of the qualifications systemshowing the relationship of qualifications to one anotherassisting learners to plan their progress from onequalification to the nextfacilitating transfers of relevant credit gained from onequalification towards another qualificationhelping employers plan training for employeesestablishing links with other framework developments acrossthe <strong>UK</strong> and also to the European <strong>Qualifications</strong> Framework(EQF) to facilitate cross-border credit transfer or theportability of qualifications across boundaries.The SCQF builds on and replaces the Scottish CreditAccumulation and Transfer system (SCOTCAT). It goes beyond itin terms of it being a lifelong learning framework, whichincorporates (or can incorporate) all general educational,vocational and HE provision. The underlying principle of the SCQFis that learning, defined by learning outcomes that have been orcould be assessed and externally quality-assured, should be ableto be credit-rated. Building on this principle, the SCQF providesthe context in Scotland through which the transfer of appropriatespecific credit can take place within and between HEIs andbetween FE colleges and HEIs.Increased demand at each level is set by factors such ascomplexity and depth of knowledge, links to associatedacademic, vocational or professional practice, and degree ofautonomy exercised by the learner. SCQF Levels are not directlyrelated to years of study. In fact, in many programmes, studentsare likely to undertake courses at different levels in theframework and, in the course of a lifetime of learning, individualswill often move from a higher to a lower level qualification as theytake on new learning and acquire new skills. In somecircumstances, all or most of the study undertaken in a year willbe at one level and progression will be from level to level.All qualifications awarded by Scottish degree-awardinginstitutions and those awarded or accredited by SQA have been(or are intended to be) credited and levelled to the SCQF. Smallercomponents of qualifications (such as SQA units or universitymodules) are also allocated SCQF credit and levels. Largerqualifications that are made up of a number of components (forexample, group awards and degrees) are allocated a final or exitlevel, but will often be composed of components at a number ofdifferent levels.SCQF credit points are used to quantify learning, to show clearlyhow large a qualification is. All required learning to achieve thelearning outcomes is taken into consideration. The SCQF workson the basis that each point is awarded for every notional 10hours of learning, which includes both programmed andindependent study. Each qualification in the framework has beenallocated a number of general SCQF points, based on the totalcredit value of the component parts of the qualification. (SCQFpoints should not be confused with UCAS Tariff points, which maybe used by some HEIs when making offers – see Appendix B.)SCQF credit points and levels are used in programme design,setting entrance requirements and as a basis for credit transfer.This approach facilitates broad comparability of achievement andshould make it easier for HEIs to award specific credit for directentry to the programme or for entry into the later stages of firstor subsequent years.<strong>UK</strong> QUALIFICATIONS 181
The Scottish Credit and <strong>Qualifications</strong> FrameworkThe SCQF was developed and established jointly by theorganisations in Scotland that have prime responsibility forqualifications: QAA, Universities Scotland, SQA and the Scottishgovernment. These Development Partners were joined by theAssociation of Scotland’s Colleges (now known as Scotland’sColleges) in 2006. In 2000, a Joint Advisory Committee (JAC)made up of representatives of the main providers, funders andusers of Scottish qualifications, was established to help takeforward the Framework. A National Implementation Plan wasdeveloped in 2003, and an Implementation Group wasestablished to carry out the associated activities. Theimplementation period ended in March 2006 and the NationalImplementation Plan can be found archived on the SCQF website.Contact information for the SCQF is given in Appendix A.Admissions tutors will find Introduction to the SCQF and NationalPlan for Implementation of the Framework useful resources(www.scqf.org.uk). The website also gives up-to-date informationon the SCQF.In November 2006, SCQF became a partnership and is governedby a Board of Management which consists of:gggggggScotland’s CollegesScottish GovernmentScottish <strong>Qualifications</strong> AuthorityQAA ScotlandUniversities Scotlandan independent chairan employer representative.THE SCOTTISH CREDIT AND QUALIFICATIONS FRAMEWORKSCQFLevelsSQA<strong>Qualifications</strong>12 Awards11 Awards10 Awards9 Awards8 Higher National Diploma AwardsProfessionalDevelopment AwardsProfessionalDevelopment AwardsProfessionalDevelopment AwardsProfessionalDevelopment AwardsProfessionalDevelopment Awards<strong>Qualifications</strong> ofHigher EducationInstitutionsDoctoratesScottishVocational<strong>Qualifications</strong>MastersPost Graduate Diploma SVQ5Post Graduate CertificateHonours DegreeGraduate DiplomaGraduate CertificateOrdinary DegreeGraduate DiplomaSVQ 4Graduate CertificateDiploma ofHigher Education SVQ 47Advanced HigherScottish Baccalareate Higher National Certificate AwardsProfessionalDevelopment AwardsCertificate ofHigher Education SVQ 36543HigherSkills for Work Higher National Certificates AwardsIntermediate 2/Skills for Work Intermediate 2Credit Standard GradeIntermediate 1/Skills for Work Intermediate 1General Standard GradeAccess 3/Skills for Work Access 3Foundation Standard GradeProfessionalDevelopment AwardsNational Progression AwardsNational Certificates Awards National Progression Awards SVQ 2National Certificates Awards National Progression Awards SVQ 1National Certificates Awards National Progression AwardsSVQ 32 Access 2 National Certificates Awards National Progression Awards1 Access 1 AwardsNoteggThe UCAS Tariff for awarding points to qualifications for thepurposes of entry to HE includes a tariff linked to the SCQFfor certain Scottish qualifications.The UCAS Tariff is intended to report learner achievements ina way that allows admissions tutors to make balancedjudgements in selecting for courses. The UCAS Tariff forScottish <strong>Qualifications</strong> covers Core Skills at level 6 andNational Courses at level 6 and 7 – ie Higher and AdvancedHigher. The Tariff gives points to grades of achievement atthese levels and is intended to allow points scored atdifferent levels to be aggregated into a single score. It wasintroduced in 2002. For detailed information on the UCASTariff, see Appendix B.ggUntil 2010, Credit Standard Grade, Intermediate 2 and CoreSkills at Intermediate 2 received a UCAS Tariff. These Tariffswere withdrawn in line with wider <strong>UK</strong> qualifications practice.The SCQF is intended to show the relative size and level ofqualifications in the Scottish education and training system ina way that allows a wide range of users to understand thesystem better, and to track progression routes through thesystem. It is also intended to provide a nationally agreedbasis upon which credit and exemption (including advancedstanding) can be negotiated. It covers all levels and all typesof qualification and is not designed to take account of gradesor allow points to be aggregated across levels.182 <strong>UK</strong> QUALIFICATIONS
Awarding and Accrediting Body – Scottish <strong>Qualifications</strong> AuthoritySQA was formed on 1 April 1997 and replaced both the ScottishExaminatiion Board (SEB) and the Scottish Vocational EducationCouncil (SCOTVEC). It is now the single body responsible forScottish qualifications, apart from degrees and professionalqualifications. It is also responsible for the accreditation of SVQs,other qualifications based on National Occupational Standardsand qualifications which may be specified by Industry RegulatoryBodies such as the Security Industry; for providing advice asrequired to the Scottish Government on Scottish qualifications,and on the education, training and assessment that contribute toqualifications.SQA qualifications are designed to increase participation rates atall levels of post-S2 (corresponding to Year 9 in England )education, including HE, and to encourage lifelong learning. TheNational <strong>Qualifications</strong> introduced in 1999 were benchmarked onpredecessor qualifications (for example, Higher against SCEHigher, Advanced Higher against CSYS) to ensure standards werevigorously maintained. SQA regularly consults its centres andCurrent Scottish <strong>Qualifications</strong>National <strong>Qualifications</strong>This section covers the National <strong>Qualifications</strong> introduced since1999 and all other relevant SQA qualifications.The information in this section is complemented by informationpublished on the SQA website. You can also contact theCustomer Contact Centre (see above).NATIONAL QUALIFICATIONS INTRODUCED IN 1999See alphabetical qualifications listing below.The system of National <strong>Qualifications</strong> introduced in 1999 broughttogether into a single curriculum, assessment and certificationsystem, subjects traditionally regarded as academic or generaleducation and those perceived to be more vocational and workrelated.These National <strong>Qualifications</strong> are based on National Unitsand National Courses. National Courses, for example, Highers andAdvanced Highers, are normally made up of three National Unitsplus an external assessment. National Certificates, introduced in2007, may be made up of National Courses, National Units andCore Skills, which fit together to make a balanced and coherentprogramme of study. As part of a phased programme, these newqualifications replaced SCE Highers, CSYS, GSVQs and someother group awards.Levels and StandardsNational <strong>Qualifications</strong> are designed to let candidates study at thelevel that offers the appropriate challenge. There are seven levels– Access 1, Access 2, Access 3, Intermediate 1, Intermediate 2,Higher and Advanced Higher – although not all subjects areavailable at the full range of levels.The seven levels offer all candidates increased opportunities forprogression. Standard Grades are normally completed bycandidates during S3 and S4 and National Courses wereoriginally intended for candidates in S5 and S6 to provideappropriate progression routes from the different levels ofStandard Grade. Thus, for example, a candidate attaining CreditStandard Grade could still progress directly to a Higher Course inthe same subject in S5. However, a candidate who had attained aGeneral Standard Grade could move to an Intermediate 2 Coursein S5 (see also SCQF diagram) and, finally, the Higher Course inthe same subject in S6. (Years 10–13 in England correspond toS3–S6 in Scotland).stakeholders (including HE) on aspects of its qualificationssystem, and will continue to liaise closely with other bodies, ongeneral education and vocational education and training issuesrelating to mutual recognition and parity of esteem forqualifications across the <strong>UK</strong>.SQA has a Customer Contact Centre to deal with enquiries fromtutors and potential applicants about new and old qualificationsand how they relate to one another. Contact details aregiven below.Scottish <strong>Qualifications</strong> AuthorityThe Optima Building58 Robertson StreetGlasgow G2 8DQTel: 0845 279 1000Fax: 0845 213 5000Email: customer@sqa.org.ukwww.sqa.org.ukSome schools use National Courses for candidates in S3 and S4in combination with or in place of Standard Grades. This allowscandidates to simply progress to the next level of National Coursein S5 and S6 as appropriate.The level of demand involved in National <strong>Qualifications</strong> has beenbenchmarked against that of a range of predecessorqualifications and Standard Grade. SQA maintains an archive ofmarked candidate assessment material, which is used to monitorthe stability of standards over time. SQA also applies a system ofnational ratings, which monitors performance between subjectsand ensures that all subjects at the same level are comparable interms of demand.For National Courses with grades at Advanced Higher, Higher,Intermediate 1 and Intermediate 2, there are four grades ofaward: A, B, C and D. Full information about the award scales forNational Courses at all levels, including Highers and AdvancedHighers, is outlined below.National Courses (SCQF Levels 4to 7)National Courses are made up of National Units, usually in agroup of three Units per Course, plus an external assessment.Each Unit at levels 4 to 6 is made up of 60 National LearningHons (NLH); at level 7, each Unit is made up of 80 NLH. Note:There is no external assessment in the Skills for Work NationalCourses or the Personal Development Courses. At level 4 to 6 thenumber of Units will vary if 30 or 120 NLH Units are used in aCourse (sometimes Units are reduced or increased in size, ifappropriate, for the purpose of the Unit or National Course). Anadditional time allocation of 60 NLH is provided to allow studentsto integrate learning across the Course and to prepare for theexternal assessment. Thus the Notional Learning Time for eachCourse at SCQF Levels 4-6 is 240 hours, making them the samecredit value – 24 SCQF credit points. Courses at SCQF Level 7(Advanced Higher) are longer, reflecting the fact that SCQFLevel 7 is the starting point for higher education in Scotland.<strong>UK</strong> QUALIFICATIONS 183
Current Scottish <strong>Qualifications</strong>Therefore Courses at SCQF Level 7 are 320 NLH and 32 SCQFcredit points. The units of a Course are related to the learningrequirements of a coherent programme of study in a givensubject area. Courses are SCQF credit-rated and, at SCQF Levels6 and 7, UCAS Tariff rated.The external assessment is usually a written examination orsometimes a project, product or performance, or a combinationof these. The purpose of this external assessment is to test thatknowledge and skills learned have been retained and can beintegrated and contextualised by the candidate. The externalassessment also helps to assure end users of the qualificationsthat standards are being rigorously maintained.Grade Band Range of Standardised MarksA 1 85–100A 2 70–84B 3 65–69B 4 60–64C 5 55–59C 6 50–54D 7 45–49– 8 40–44 fail– 9 Fewer than 40 failReporting:ggGrades A, B, C, D reported to candidatesBand reported to centre.NoteGrade D was implemented from August 2004. Prior to this date,candidates who obtained Band 7 in a National Course externalassessment were awarded a grade A in the correspondingNational Course at the lower level, provided they had successfullycompleted the Units of the Course.Scottish HEIs normally frame their conditional offers in terms ofnumbers and grades of passes in Higher Courses.Highers have normally been taken at the end of a student’s fifthyear of secondary education. However, they can also be taken atthe end of the sixth year:ggggas a resit (N.B. There is no Winter re-sit diet in Scotland)for candidates completing a Higher over two years (as asingle sitting)for candidates progressing from Intermediate 2 in fifth yearfor candidates building on the range of Higher subjects theycompleted in fifth year.Since the abolition of “Age and Stage” regulations in Scotland in2005, some candidates may take some Higher Courses in S4and S5 or as a two-year Higher (one sitting) in S4-S5.Years 12 and 13 in England correspond to the fifth and sixthyears in Scotland.Advanced Highers are normally taken at the end of the sixth yearof secondary education. The number of Advanced Highers thatstudents can achieve or the availability of the ScottishBaccalaureate may be affected by a school’s timetabling policy,and by the extent to which students decide to broaden theirknowledge and skills by taking Intermediate 2 or Higher Courses.For entry to HE, Intermediate 1 and 2 Courses should be treatedas equivalent to Standard Grade and therefore acceptable asbackup to Highers in the main subjects and as contributory toproviding evidence of curriculum breadth.National Units (available at SCQFLevels 1 to 7)National Units (these subsumed National Certificate Units andShort Courses) are 60 NLHs in length at SCQF Levels 1 to 6,though some are fractions (for example, 30 NLHs) or multiples(for example, 120 NLHs). At SCQF Level 7, National Units are 80NLHs or fractions or multiples thereof.National Units are internally assessed by teachers and lecturers,who can draw on materials from SQA’s National AssessmentBank of Unit assessment packages to assist them with this workand ensure that national standards are applied to all Unitassessments. Unit internal assessments are also subject toexternal verification by SQA. Candidates are awarded a ‘pass’ ina Unit when they have achieved all of the Unit outcomes.National Courses consist of Units (usually three) which areinternally assessed but not graded. They do not contribute to theNational Course grade, but must be passed in order forcandidates to achieve the Course.Core SkillsThe National <strong>Qualifications</strong> system supports the development ofthe broad, generic, transferable skills (Core Skills) valued inschools, FE and HE, employment and personal and social life.The five Core Skills are Communication, Numeracy, Informationand Communication Technology (ICT), Problem Solving andWorking with Others. These are available at SCQF 2–6 (Access2-3, Intermediate 1-2 and Higher levels).Core Skills can be embedded in other qualifications or covered byseparate Units. Those achieved through separate Units are alsocertificated as achieved qualifications. All Core Skills achieved bythe candidate through embedding or discrete delivery arerecorded on the Scottish Qualification Certificate (SQC) as aprofile.QUALIFICATIONS WHICH CONTINUE ALONG WITH THENATIONAL QUALIFICATIONS INTRODUCED IN 1999See alphabetical qualifications listing starting on the next pageSQA continues to offer Standard Grades, HNCs, HNDs, SVQs,Scottish Progression Awards (SPAs) (these are few in number andwill either lapse or be revised as National Progression Awards(NPAs)) and Professional Development Awards (PDAs). In March2005, SQA carried out an evaluation on the design of nonadvancedGroup Awards and PDAs. The design rules for eachqualification can be found in the relevant sections below.TIMES OF EXAMINATIONS AND NOTIFICATION OFRESULTS FOR NATIONAL COURSES WITH GRADES ANDSTANDARD GRADESStandard Grade external assessments and those for NationalCourses with grades take place in May-June and lead tocertification in early August. There are also a number of externallyassessed, project-based National Courses that are available forcompletion at times other than the summer and lead tocertification on a quarterly basis. Most candidates for projectbasedCourses are likely to be from FE colleges.NOTIFICATION OF RESULTS FOR NATIONAL COURSESWITHOUT GRADESThere is now a small but growing group of National Courseswithout grades that are made up of internally assessed Units andwhich have no external assessment. These are the Skills for Workand Personal Development Courses. Although most candidate184 <strong>UK</strong> QUALIFICATIONS
Current Scottish <strong>Qualifications</strong>results for these Courses will continue to be reported in Augustalong with results for National Courses with grades, they can bereported in any month of the year, depending on when thecandidate completes the Course. These Courses are subject toexternal verification.DATE OF NOTIFICATION TO UCASSQA issues the results of summer examinations for StandardGrade and National Courses at Intermediate 1 and 2, Higher andAdvanced Higher in early August. The exact timing of the issue ofresults is notified in an annual circular to UCAS correspondents.SQA no longer reports Standard Grade and Intermediate resultsto UCAS since the removal of the Tariff.TARIFF POINT SCORESSince 2002 entry, graded National Courses at Advanced Higher,Higher and Intermediate 2 levels along with Standard GradeCredit level and Core Skills have been part of the UCAS Tariffalthough UCAS withdrew the Tariff for Intermediate 2 from 2010.The scores used since 2010 entry onwards are as follows.Grade Advanced Higher HigherA 130 80B 110 65C 90 50D 72 36SCOTTISH INTERDISCIPLINARY PROJECT FOR THESCOTTISH SCIENCE/LANGUAGES /SOCIALSCIENCES/EXPRESSIVE ARTS BACCALAUREATEGradePoints ScoreA 65B 55C 45The Interdisciplinary Project receives a UCAS Tariff rather than theScottish Baccalaureate, as the other components of the ScottishBaccalaureate already receive Tariff points. However, the ScottishBaccalaureate is graded as a “Distinction” or “Pass” based onachievements in all of the components (see Section on ScottishBaccalaureates below).Core Skills Level Points ScoreHigher 20National Certificates carry UCAS Tariff points with effect for entryto higher education from 2011 as follows:UCAS Tariff pointsGroup C 125Group B 100Group A 75Please refer to the Tariff section of the UCAS website for a list ofwhich subjects are included in each group.www.ucas.ac.uk/students/ucas_tourist/tarifftables/sncgroupsIf a candidate has previously taken a qualification and thenproceeded to take a higher level qualification in the same subjectsuch as Higher Chemistry followed by Advanced HigherChemistry, the points score will be subsumed by the points scoreof the qualification at the higher level.The Core Skills scores relate to each of the five Core Skills takenas dedicated units. More detailed information about the UCASTariff is given in Appendix B.Double counting of more than one qualification in the same subjectarea will not be permitted. The points score will be derived from thehighest grades achieved in the highest level of the course.Full details of qualifications in the following pages can be foundat www.sqa.org.ukAccess 2 and Access 3QUALIFICATION ABBREVIATION:Acc 2 and Acc 3SCOTTISH CREDIT AND QUALIFICATIONS FRAMEWORKLEVEL:Access 2 – Level 2Access 3 – Level 3BACKGROUND:See ‘The System in Scotland’ introductory paragraphs.DATE OF FIRST TEACHING:1999DATE OF FIRST AWARD:2000PREREQUISITES:There is no age restriction on the use of Access 2 and 3 Coursesbut they are normally taken by candidates in S3 and above.NUMBER OF UNITS/STRUCTURE:Normally three National Units each of 60 NLHs. The number ofUnits will vary if 30-NLH units are used in the Course.ASSESSMENT METHOD:The Units that comprise the Course are internally assessed andexternally verified.DATE OF RESULT PUBLICATION:Mainly August, but can be issued in any month of the year.GRADING SYSTEM:Ungraded. Achievement is certified as a ‘Pass’.QUALITY ASSURANCE:Subject to SQA’s system of quality assurance. See Guide toAssessment, which is available on SQA’s website atwww.sqa.org.uk/files_ccc/GuideToAssessment.pdfPROGRESSION/ARTICULATION:Access 2 and 3 Courses will be used for a variety of purposes,including progression to National Courses at the same levels andat higher levels.Curriculum for Excellence will see the Access 2 and 3 coursesbeing replaced by National 2 and National 3 courses. In <strong>2013</strong>/14and 2014/15, the current Access 2 and Access 3 will be dual runin centres alongside the new National 2 and National 3 courses.For more information on Curriculum for Excellence please visitwww.sqa.org.uk/curriculum for excellence.Advanced HighersQUALIFICATION ABBREVIATION:AHSCOTTISH CREDIT AND QUALIFICATIONS FRAMEWORKLEVEL:Level 7SCOTTISH CREDIT AND QUALIFICATIONS FRAMEWORKCREDIT VALUE:32 credit points (320 NLH)BACKGROUND:See ‘The System in Scotland’ introductory paragraphs.DATE OF FIRST TEACHING:2000DATE OF FIRST AWARD:2001<strong>UK</strong> QUALIFICATIONS 185
Current Scottish <strong>Qualifications</strong>PREREQUISITES:AH are National Courses normally taken at the end of a student’ssixth year of secondary education. Many candidates will have studiedthe subject at Higher but a few applicants may have bypassed Higherand moved directly to AH. AH can also be taken by adults.NUMBER OF UNITS/STRUCTURE:Normally, three 80-NLH National Units, plus an externalassessment. The number of Units will vary if 40 or 160-NLH Unitsare used in the Course. An additional 80-NLH is allocated to allowstudents to integrate learning across the Course and to preparefor the external assessment.ASSESSMENT METHOD:The Units that comprise the Course are internally assessed andexternally verified. The external assessment is usually anexamination or sometimes an assignment, project, product orperformance, or a combination of these.EXAMINATION TIMING:May/JuneDATE OF RESULT PUBLICATION:AugustGRADING SYSTEM:From August 2004 candidates have received a grade A – D. Forinformation on the grading system prior to August 2004 see thesection on National Courses.TARIFF POINTSGradeUCAS Tariff pointsA 130B 110C 90D 72QUALITY ASSURANCE:Subject to SQA’s system of quality assurance. See Guide toAssessment, which is available on SQA’s website atwww.sqa.org.uk/files_CCC/GuideToAssessment.pdfPROGRESSION/ARTICULATION:AH is used for a variety of purposes, including entry to highereducation. The number of AHs that may be available at a schoolat which students can achieve may be affected by a school’stimetabling policy and by the extent to which students decide tobroaden their knowledge and skills by taking new Courses atIntermediate 2 or Higher levels. Scottish HEIs normally frame theiroffers in terms of numbers and grades of pass in Higher Courses.Some HEIs offer direct entry to second year on particular Coursesfor candidates with Advanced Highers. The pattern of uptake ofcontinuation of AH in S6 may be affected by candidates receivingunconditional firm offers from HEIs based on their higher resultsfrom S5.Advanced Highers will be revised in the context of Curriculum forExcellence. The new Advanced Higher qualifications will beavailable from 2015/16. The new Advanced Higher qualificationwill not be dual run. For more information on Curriculum forExcellence, please visit www.sqa.org.uk/curriculumforexcellence.AwardsSCOTTISH CREDIT AND QUALIFICATIONS FRAMEWORKLEVEL:1-12BACKGROUND:Awards are small flexible qualifications which are intended toprovide the learner with a variety of practical skills andknowledge. Suitable for any type of learner, Awards are designedto address and provide proof of specific skills.SQA offers a range of Awards from Safe Road User to PersonalAchievement. Of particular interest to admissions tutors might bethe Award in Volunteering Skills, which provides formalrecognition of volunteering activity, and the Leadership Awardwhich is endorsed by the Chartered Management Institute.DATE OF FIRST TEACHING:2009DATE OF FIRST AWARD:2010NUMBER OF UNITS/STRUCTURE:Structure varies depending on Award, for more information,please see the Awards page on SQA’s website:www.sqa.org.uk/sqa/41280.htmlASSESSMENT METHOD:Internally assessed and externally verified by SQA. Assessment iscriterion referenced against specified standards.EXAMINATION TIMING:FlexibleDATE OF RESULT PUBLICATION:FlexibleGRADING SYSTEM:Ungraded. Achievement is certificated as a ‘Pass’.QUALITY ASSURANCE:Subject to SQA’s system of quality assurance. See Guide toAssessment, which is available on SQA’s website atwww.sqa.org.uk/files_ccc/GuideToAssessment.pdfPROGRESSION/ARTICULATION:Please see the Awards page on SQA’s website at:www.sqa.org.uk/sqa/41280.html for details on progression fromindividual Awards.Core SkillsSCOTTISH CREDIT AND QUALIFICATIONS FRAMEWORKLEVEL:Up to and including level 6SCOTTISH CREDIT AND QUALIFICATIONS FRAMEWORKCREDIT VALUE:Unit one 6 SCQF credit points (60 NLH), but are also available atsome SCQF levels as 15 NLH Units.BACKGROUND:The five Core Skills are Communication, Numeracy, Informationand communication technology (IT), Problem solving and Workingwith others. They are recorded on the Scottish <strong>Qualifications</strong>Certificate (SQC) as a profile. Candidates for Scottish GroupAwards (SGAs) were required to achieve at least three of the fiveCore Skills at the levels determined for the particular award.However, SGAs finished in July 2010. National Certificates havereplaced SGAs - see section below on National Qualification GroupAwards.DATE OF FIRST TEACHING:1999DATE OF FIRST AWARD:2000NUMBER OF UNITS/STRUCTURE:Core Skills are embedded in some National Courses and can alsobe covered by discrete National Units.ASSESSMENT METHOD:See above.186 <strong>UK</strong> QUALIFICATIONS
Current Scottish <strong>Qualifications</strong>EXAMINATION TIMING:May/June for National Courses. Flexible for National Units.Discrete Core Skills Units are not subject to external examination.DATE OF RESULT PUBLICATION:Profile appears on Scottish Qualification Certificate (SQC), whichis normally issued in August for candidates taking NationalCourses. For other candidates, group award results are issuedweekly.GRADING SYSTEM:Core Skills are not graded, but the SCQF Level at which theyhave been achieved is shown as a profile on the SQC.TARIFF POINTSLevelUCAS Tariff pointsHigher (SCQF Level 6) 20NB. Only Core Skills achieved through discrete Units carry UCASTariff points.QUALITY ASSURANCE:Subject to SQA’s system of quality assurance. See Guide toAssessment, which is available on SQA’s website atwww.sqa.org.uk/files_ccc/GuideToAssessment.pdfPROGRESSION/ARTICULATION:The National <strong>Qualifications</strong> system supports the development ofthe Core Skills valued in FE and HE, employment and personaland social life.Scottish BaccalaureateScottish Baccalaureate inExpressive ArtsQUALIFICATION ABBREVIATION:Scot BaccSCOTTISH CREDIT AND QUALIFICATIONS FRAMEWORKLEVEL:Level 7SCOTTISH CREDIT AND QUALIFICATIONS FRAMEWORKCREDIT VALUE:104 credit points (1040 NLH)BACKGROUND:The Scottish Baccalaureate in Expressive Arts has been designedto provide a challenging and rewarding experience for learners infifth and sixth year of secondary education who are able to copewith the demands of study at Higher and Advanced Higher level.The Scottish Baccalaureate is made up of one Higher, twoAdvanced Highers and the Interdisciplinary Project (IP). TheInterdisciplinary Project is the defining feature of the ScottishBaccalaureate, bringing added value to the ScottishBaccalaureate as a whole.INTERDISCIPLINARY PROJECT:Key features of the Interdisciplinary Project:ggggapplication or extension of subject knowledge in a relevantcontextfocus on generic and cognitive skills development, egcresearch skillscinterpersonal skillscpresentation skillsopportunity to access different learning environmentslearner negotiation of context will be important and should berelated to areas of interest and/or future career aspirations.DATE OF FIRST TEACHING:2012DATE OF FIRST AWARD:<strong>2013</strong>PREREQUISITES:Entry to the Scottish Baccalaureate in Expressive Arts is at thediscretion of the centre. However, the Baccalaureate is intendedfor candidates who, in fifth and sixth years of secondaryeducation, are working at Higher and Advanced Higher level intwo different, eligible subjects, together with English (or ESOL orGàidhlig) or mathematics. Two of the subjects must be atAdvanced Higher level.NUMBER OF UNITS/STRUCTURE:The Scottish Baccalaureate in Expressive Arts requires threedifferent eligible Courses, two of which must be at AdvancedHigher level and one at Higher level. One of these Courses mustbe English (or ESOL or Gàidhlig) or mathematics (or appliedmathematics) at Higher or Advanced Higher level.The mandatory components of the Scottish Baccalaureate inExpressive Arts are:Interdisciplinary Project UnitAdvanced Higher SCQF Level 7 (16 SCQF points)Two CoursesAdvanced Higher SCQF Level 7 (64 SCQF points)One CourseHigherSCQF Level 6 (24 SCQF points)The Interdisciplinary Project Unit will be graded A, B or C andcarries UCAS Tariff points as follows:GradeTariff pointsA 65B 55C 45ASSESSMENT METHODThese Course components are either externally assessed (oftenthrough a question paper) or internally assessed and externallyverified, depending on the nature of the assessment involved andthe skills/knowledge being assessed.CERTIFICATIONA Scottish Baccalaureate is not intended to be a full programmeof study. It is expected that learners who take a Baccalaureatewill also take other courses in S5 and S6. Their choice ofsubjects is likely to be based around interest, career choice andthe entrance requirements specified by the universities wherethey wish to study.In addition to their Scottish Qualification Certificate showingStandard Grade, Intermediate, Higher and Advanced HigherCourse achievement, learners who take a Baccalaureate and aresuccessful will receive a commemorative certificate for theirBaccalaureate showing either a Pass or Distinction.GRADING SYSTEM:Candidates who achieve a Pass in all mandatory components andwho do not meet the criteria for Distinction will be awarded aPass in the Scottish Baccalaureate in Expressive Arts.The Scottish Baccalaureate in Expressive Arts with Distinction willbe awarded to candidates who achieve:gggGrade A in one Advanced Higher eligible courseGrade A in one other componentGrade B or above in all other components.See Number of Units/Structure for Interdisciplinary Project Tariff.<strong>UK</strong> QUALIFICATIONS 187
Current Scottish <strong>Qualifications</strong>QUALITY ASSURANCE:All National Courses are subject to external marking and/orverification. External markers, visiting examiners and verifiers aretrained by SQA to apply national standards.The units of all courses are subject to internal verification andmay also be chosen for external verification. This is to ensure thatnational standards are being applied across all subjects.Courses may be assessed by a variety of methods. Wheremarking is undertaken by a trained marker in their own time,markers meetings are held to ensure that a consistent standardis applied. The work of all markers is subject to scrutiny by thePrincipal Assessor.The Interdisciplinary Project will be internally assessed andsubject to external quality assurance by SQA.External quality assurance of the Interdisciplinary Projectcontinues through external verification of centres’ internalassessment decisions through subject specific quality forums.Quality forums will bring together staff with an overview of theassessment and internal verification processes from a group ofcentres delivering the Interdisciplinary Project Unit.PROGRESSION/ARTICULATIONCandidates who achieve a Scottish Baccalaureate in ExpressiveArts may progress to:ggfurther or higher educationemployment/training.Scottish Baccalaureate inLanguagesQUALIFICATION ABBREVIATION:Scot BaccSCOTTISH CREDIT AND QUALIFICATIONS FRAMEWORKLEVEL:Level 7SCOTTISH CREDIT AND QUALIFICATIONS FRAMEWORKCREDIT VALUE:104 credit points (1040 NLH)BACKGROUND:The Scottish Baccalaureate in Languages has been designed toprovide a challenging and rewarding experience for learners infifth and sixth year of secondary education who are able to copewith the demands of study at Higher and Advanced Higher level.The Scottish Baccalaureate is made up of one Higher, twoAdvanced Highers and the Interdisciplinary Project (IP). TheInterdisciplinary Project is the defining feature of the ScottishBaccalaureate bringing added value to the Scottish Baccalaureateas a wholeINTERDISCIPLINARY PROJECT:Key features of the Interdisciplinary Project:ggggapplication or extension of subject knowledge in a relevantcontextfocus on generic and cognitive skills development, egcollaborative working, information management,communication and presentationopportunity to access different learning environmentslearner negotiation of context within one of following broadthemes: employability, enterprise, citizenship, sustainabledevelopment or economic development.DATE OF FIRST TEACHING:2009DATE OF FIRST AWARD:2010PREREQUISITES:Entry to the Scottish Baccalaureate in Languages is at thediscretion of the centre. However, the Baccalaureate is intendedfor candidates who, in fifth and sixth years of secondaryeducation, are working at Higher and Advanced Higher level in twodifferent, eligible languages, together with English (or Gàidhlig orESOL). Two of the subjects must be at Advanced Higher level.NUMBER OF UNITS/STRUCTURE:The Scottish Baccalaureate in Languages requires two differenteligible modern or classical Language Courses, at least one ofwhich must be at Advanced Higher level.The mandatory components of the Scottish Baccalaureate inLanguages are:InterdisciplinaryProject Unit Advanced Higher SCQF Level 7 (16 SCQF credits)2 Courses Advanced Higher SCQF Level 7 (64 SCQF credits)1 Course Higher SCQF Level 6 (24 SCQF credits)One of the above Courses must be English (or ESOL or Gàidhlig*)and this may be at Higher or Advanced Higher level.The Interdisciplinary Project Unit will be graded A, B or C andcarries UCAS Tariff points as follows:GradeTariff pointsA 65B 55C 45* Learners who have Gàidhlig as their first language may count both English andGàidhligASSESSMENT METHODThese course components are either externally assessed (oftenthrough a question paper) or internally assessed and externallyverified, depending on the nature of the assessment involved andthe skills/knowledge being assessed.CERTIFICATIONA Scottish Baccalaureate is not intended to be a full programmeof study. It is expected that learners who take a Baccalaureatewill also take other courses in S5 and S6. Their choice ofsubjects is likely to be based around interest, career choice andthe entrance requirements specified by the universities wherethey wish to study.In addition to their Scottish Qualification Certificate showingStandard Grade, Intermediate, Higher and Advanced HigherCourse achievement, learners who take a Baccalaureate and aresuccessful will receive a commemorative Certificate for theirBaccalaureate showing either a Pass or Distinction.GRADING SYSTEM:Candidates who achieve a Pass in all mandatory components andwho do not meet the criteria for Distinction will be awarded aPass in the Scottish Baccalaureate in Languages.The Scottish Baccalaureate in Languages with Distinction will beawarded to candidates who achieve:gggGrade A in one Advanced Higher eligible CourseGrade A in one other componentGrade B or above in all other components.See Number of Units/Structure for the Interdisciplinary ProjectTariff.188 <strong>UK</strong> QUALIFICATIONS
Current Scottish <strong>Qualifications</strong>QUALITY ASSURANCE:All National Courses are subject to external marking and/orverification. External markers, visiting examiners and verifiers aretrained by SQA to apply national standards.The units of all courses are subject to internal verification andmay also be chosen for external verification. This is to ensure thatnational standards are being applied across all subjects.Courses may be assessed by a variety of methods. Wheremarking is undertaken by a trained marker in their own time,markers meetings are held to ensure that a consistent standardis applied. The work of all markers is subject to scrutiny by thePrincipal Assessor.The Interdisciplinary Project will be internally assessed andsubject to external quality assurance by SQA.External quality assurance of the Interdisciplinary Projectcontinues through external verification of centres’ internalassessment decisions via subject specific quality forums.Quality forums will bring together staff with an overview of theassessment and internal verification processes from a group ofcentres delivering the Interdisciplinary Project Unit.PROGRESSION/ARTICULATIONCandidates who achieve a Scottish Baccalaureate in Languagesmay progress to:ggfurther or higher educationemployment/training.Scottish Baccalaureate inScienceQUALIFICATION ABBREVIATION:Scot BaccSCOTTISH CREDIT AND QUALIFICATIONS FRAMEWORKLEVEL :Level 7SCOTTISH CREDIT AND QUALIFICATIONS FRAMEWORKCREDIT VALUE:104 credit points (1040 NLH)BACKGROUND:The Scottish Baccalaureate in Science has been designed toprovide a challenging and rewarding experience for learners infifth and sixth year of secondary education who are able to copewith the demands of study at Higher and Advanced Higher level.The Scottish Baccalaureate is made up of one Higher, twoAdvanced Highers and the Interdisciplinary Project (IP). TheInterdisciplinary Project is the defining feature of the ScottishBaccalaureate bringing added value to the Scottish Baccalaureateas a whole.INTERDISCIPLINARY PROJECTKey features of the Interdisciplinary Project:ggggapplication or extension of subject knowledge in a relevantcontextfocus on generic and cognitive skills development eggcollaborative workingginformation managementgcommunication and presentationopportunity to access different learning environmentslearner negotiation of context within one of following broadthemes: employability, enterprise, citizenship, sustainabledevelopment or economic development.DATE OF FIRST TEACHING:2009DATE OF FIRST AWARD:2010PREREQUISITES:Entry to the Scottish Baccalaureate in Science is at the discretionof the centre. However, the Baccalaureate is intended forcandidates who, in fifth and sixth years of secondary education,are working at Higher and Advanced Higher level in two different,eligible science subjects, together with mathematics. Two of thesubjects must be at Advanced Higher level.NUMBER OF UNITS/STRUCTURE:The Scottish Baccalaureate in Science requires two differenteligible science Courses, at least one of which must be atAdvanced Higher level.The mandatory components of the Scottish Baccalaureate inScience are:InterdisciplinaryProject Unit Advanced Higher SCQF Level 7 (16 SCQF credits)2 Courses Advanced Higher SCQF Level 7 (64 SCQF credits)1 Course Higher SCQF Level 6 (24 SCQF credits)One of the above Courses must be mathematics (Higher orAdvanced Higher level) or applied mathematics (Advanced Higherlevel).ASSESSMENT METHOD:These course components are either externally assessed (oftenthrough a question paper) or internally assessed and externallyverified, depending on the nature of the assessment involved andthe skills/knowledge being assessed.CERTIFICATION:A Scottish Baccalaureate is not intended to be a full programmeof study. It is expected that learners who take a Baccalaureatewill also take other courses in S5 and S6. Their choice ofsubjects is likely to be based around interest, career choice andthe entrance requirements specified by the universities wherethey wish to study.In addition to their Scottish Qualification Certificate showingStandard Grade, Intermediate, Higher and Advanced HigherCourse achievement, learners who take a Baccalaureate and aresuccessful will receive a commemorative Certificate for theirBaccalaureate showing either a Pass or Distinction.GRADING SYSTEM:Candidates who achieve a Pass in all mandatory components andwho do not meet the criteria for Distinction will be awarded aPass in the Scottish Baccalaureate in Science.The Scottish Baccalaureate in Science with Distinction will beawarded to candidates who achieve:gggGrade A in one Advanced Higher eligible CourseGrade A in one other componentGrade B or above in all other components.The Interdisciplinary Project Unit will be graded A, B or C andcarries UCAS Tariff points as followsGradeTariff pointsA 65B 55C 45See number of Units/structure for Interdisciplinary Project Tariff.<strong>UK</strong> QUALIFICATIONS 189
Current Scottish <strong>Qualifications</strong>QUALITY ASSURANCE:All National Courses are subject to external marking and/orverification. External markers, visiting examiners and verifiers aretrained by SQA to apply national standards.The units of all courses are subject to internal verification andmay also be chosen for external verification. This is to ensure thatnational standards are being applied across all subjects.Courses may be assessed by a variety of methods. Wheremarking is undertaken by a trained marker in their own time,markers meetings are held to ensure that a consistent standardis applied. The work of all markers is subject to scrutiny by thePrincipal Assessor.The Interdisciplinary Project will be internally assessed andsubject to external quality assurance by SQA.External quality assurance of the Interdisciplinary Projectcontinues through external verification of centres’ internalassessment decisions via subject specific quality forums.Quality forums will bring together staff with an overview of theassessment and internal verification processes from a group ofcentres delivering the Interdisciplinary Project Unit.PROGRESSION/ARTICULATION:Candidates who achieve a Scottish Baccalaureate in Science mayprogress to:ggfurther or higher educationemployment/training.Scottish Baccalaureate inSocial SciencesQUALIFICATION ABBREVIATION:Scot BaccSCOTTISH CREDIT AND QUALIFICATIONS FRAMEWORKLEVEL:Level 7SCOTTISH CREDIT AND QUALIFICATIONS FRAMEWORKCREDIT VALUE:104 Credit Points (1040 NLH)BACKGROUND:The Scottish Baccalaureate in Social Sciences has been designedto provide a challenging and rewarding experience for learners infifth and sixth year of secondary education who are able to copewith the demands of study at Higher and Advanced Higher level.The Scottish Baccalaureate is made up of one Higher, twoAdvanced Highers and the Interdisciplinary Project (IP). TheInterdisciplinary Project is the defining feature of the ScottishBaccalaureate bringing added value to the Scottish Baccalaureateas a whole.INTERDISCIPLINARY PROJECT:Key features of the Interdisciplinary Project:ggggapplication or extension of subject knowledge in a relevantcontextfocus on generic and cognitive skills development, egcresearch skillscinterpersonal skillscpresentation skillsopportunity to access different learning environmentslearner negotiation of context will be important and should berelated to areas of interest and/or future career aspirations.DATE OF FIRST TEACHING:2012DATE OF FIRST AWARD:<strong>2013</strong>PREREQUISITES:Entry to the Scottish Baccalaureate in Social Sciences is at thediscretion of the centre. However, the Baccalaureate is intendedfor candidates who, in fifth and sixth years of secondaryeducation, are working at Higher and Advanced Higher level intwo different, eligible subjects, together with English (or ESOL orGàidhlig) or mathematics. Two of the subjects must be atAdvanced Higher level.NUMBER OF UNITS/STRUCTURE:The Scottish Baccalaureate in Social Sciences requires threedifferent eligible Courses, two of which must be at AdvancedHigher level and one at Higher level. One of these Courses mustbe English (or ESOL or Gàidhlig) or mathematics (or appliedmathematics) at Higher or Advanced Higher level.The mandatory components of the Scottish Baccalaureate inSocial Sciences are:Interdisciplinary Project UnitAdvanced Higher SCQF Level 7 (16 SCQF points)Two CoursesAdvanced Higher SCQF Level 7 (64 SCQF points)One CourseHigherSCQF Level 6 (24 SCQF points)The Interdisciplinary Project Unit will be graded A, B or C andcarries UCAS Tariff points as follows:GradeTariff pointsA 65B 55C 45ASSESSMENT METHOD:These course components are either externally assessed (oftenthrough a question paper) or internally assessed and externallyverified, depending on the nature of the assessment involved andthe skills/knowledge being assessed.CERTIFICATION:A Scottish Baccalaureate is not intended to be a full programmeof study. It is expected that learners who take a Baccalaureatewill also take other courses in S5 and S6. Their choice ofsubjects is likely to be based around interest, career choice andthe entrance requirements specified by the universities wherethey wish to study.In addition to their Scottish Qualification Certificate showingStandard Grade, Intermediate, Higher and Advanced HigherCourse achievement, learners who take a Baccalaureate and aresuccessful will receive a commemorative certificate for theirBaccalaureate showing either a Pass or Distinction.GRADING SYSTEM:Candidates who achieve a Pass in all mandatory components andwho do not meet the criteria for Distinction will be awarded aPass in the Scottish Baccalaureate in Social Sciences.The Scottish Baccalaureate in Social Sciences with Distinction willbe awarded to candidates who achieve:gggGrade A in one Advanced Higher eligible CourseGrade A in one other componentGrade B or above in all other components.See Number of Units/Structure for Interdisciplinary Project Tariff.190 <strong>UK</strong> QUALIFICATIONS
Current Scottish <strong>Qualifications</strong>QUALITY ASSURANCE:All National Courses are subject to external marking and/orverification. External markers, visiting examiners and verifiers aretrained by SQA to apply national standards.The units of all courses are subject to internal verification andmay also be chosen for external verification. This is to ensure thatnational standards are being applied across all subjects.Courses may be assessed by a variety of methods. Wheremarking is undertaken by a trained marker in their own time,markers meetings are held to ensure that a consistent standardis applied. The work of all markers is subject to scrutiny by thePrincipal Assessor.The Interdisciplinary Project will be internally assessed andsubject to external quality assurance by SQA.External quality assurance of the Interdisciplinary Projectcontinues through external verification of centres’ internalassessment decisions through subject specific quality forums.Quality forums will bring together staff with an overview of theassessment and internal verification processes from a group ofcentres delivering the Interdisciplinary Project Unit.PROGRESSION/ARTICULATION:Candidates who achieve a Scottish Baccalaureate in SocialSciences may progress to:ggfurther or higher educationemployment/training.Higher National CertificatesQUALIFICATION ABBREVIATION:HNCSCOTTISH CREDIT AND QUALIFICATIONS FRAMEWORKLEVEL:Level 7SCOTTISH CREDIT AND QUALIFICATIONS FRAMEWORKCREDIT VALUE:96 Credit Points (960 NLH)However many candidates take 120 Credit Points (1200 NLHworth of relevant Units).BACKGROUND:HNCs are HE group awards covering broad occupational areasand are offered by colleges and some HEIs.DATE OF FIRST TEACHING:1923DATE OF FIRST AWARD:1925PREREQUISITES:Entry is at the discretion of the centre. However, applicants fromschool are normally expected to have a range of National<strong>Qualifications</strong>, including some at SCQF Level 6, eg Highers. Nonschoolleavers will enter with a variety of qualifications and/orexperience. Many candidates may undertake their HNC asemployer-funded training through day or block release, or throughdistance learning.NUMBER OF UNITS/STRUCTURE:HNCs developed under 1988 design rules comprise 12 SQAcredits. Prior to modernising all HNCs, five subject areas werereviewed using pilot design rules. These HNCs were validatedwith 15 SQA credits, two of which are Integrated Assessments.All HNCs have now been revised using the 2003 designprinciples and these will comprise 12 SQA unit credits (96 SCQFcredit points), one of which will be a Graded Unit (8 SCQF creditpoints at SCQF Level 7). In the revised HNCs, Core Skills may besignposted and/or embedded.ASSESSMENT METHOD:HNCs are internally assessed and externally verified.EXAMINATION TIMING:Flexible, but full-time college students normally complete HNCsin June.DATE OF RESULT PUBLICATION:Flexible, but full-time college students normally receive results inJuly. Group award results are also issued weekly. Group Awardresults are reported to UCAS along with the annual diet of results,but only the achievement of the Group Award is reported as a“Pass”. SQA plans to report the result of Graded Units to UCASfrom <strong>2013</strong>.GRADING SYSTEM:HNC Group Awards developed under the 1988 design rulescomprise Units which are awarded at Pass or Merit. HNCsdeveloped under the pilot design rules contain two credits ofIntegrated Assessments, which are Graded A, B or C. HNCsdeveloped under the 2003 design principles contain one gradedunit worth eight SCQF credits at SCQF Level 7, which will begraded A, B or C. It should be noted that in rare circumstancessome applicants who present the current HNCs may offer a mixof old Units (graded Pass or Merit) and revised (ungraded)HN Units.QUALITY ASSURANCE:Subject to SQA’s system of quality assurance. See Guide toAssessment, which is available on SQA’s website atwww.sqa.org.uk/files_ccc/GuideToAssessment.pdfPROGRESSION/ARTICULATION:HNCs are designed and validated at SCQF Level 7. As such,students may progress to HNDs, degree courses or employment.HEIs make their own decisions on the specific credit to begranted and many articulation agreements exist between FEcolleges and HEIs. Direct entry to year two of a degreeprogramme may be possible at some universities.Higher National DiplomasQUALIFICATION ABBREVIATION:HNDSCOTTISH CREDIT AND QUALIFICATIONS FRAMEWORKLEVEL:Level 8SCOTTISH CREDIT AND QUALIFICATIONS FRAMEWORKCREDIT VALUE:240 Credit Points (2400 NLH)BACKGROUND:HNDs are advanced HE group awards covering broadoccupational areas and are offered by colleges and some HEIs.DATE OF FIRST TEACHING:1958DATE OF FIRST AWARD:1960PREREQUISITES:Entry is at the discretion of the centre. However, applicants fromschool are normally expected to have a range of National<strong>Qualifications</strong>, including some at SCQF Level 6, eg Highers. Nonschoolleavers will enter with a variety of qualifications and/orexperience.<strong>UK</strong> QUALIFICATIONS 191
Current Scottish <strong>Qualifications</strong>NUMBER OF UNITS/STRUCTURE:HNDs developed under 1988 design rules comprise 30 credits.Prior to modernising all HNDs, a few were developed under pilotrules. These comprise 30 SQA credits, four of which areIntegrated Assessments. All HNDs have been revised using the2003 design principles and these will comprise 30 SQA unitcredits (240 SCQF credit points). Three of these SQA credits willbe for Graded Units – one worth eight SCQF credit points at SCQFLevel 7 plus 16 SCQF credits at SCQF Level 8 (the 16 credits cancomprise one double credit Graded Unit or two single creditGraded Units). In the revised HNDs, Core Skills may be signpostedand/or embedded. It should be noted that a double Credit GradedUnit will only be certificated with a single grade. Where threeGraded Unit grades are considered by an HEI for offer-making, thedouble credit Graded Unit should be taken as a ‘duplicate grade’,i.e. ‘AA’ instead of simply ‘A’ for the purpose of equity.ASSESSMENT METHOD:HNDs are internally assessed and externally verified.EXAMINATION TIMING:Flexible, but full-time college students normally complete HNDsin June.DATE OF RESULT PUBLICATION:Flexible, but full-time college students normally receive results inJuly. Group award results are also issued weekly. Group Awardresults are reported to UCAS along with the annual diet of results, butonly the achievement of the Group Award is reported as a “Pass”.GRADING SYSTEM:HND Group Awards developed under the 1988 design rulescomprise Units which are awarded at Pass or Merit. HNCsdeveloped under the pilot design rules contain four credits ofintegrated assessments, which are graded A, B or C. HNDsdeveloped under the 2003 design principles contain GradedUnits – one worth eight SCQF credit points at SCQF Level 7 plus16 SCQF credits at SCQF Level 8 (the 16 credits can compriseone double credit Graded Unit or two single credit Graded Units)each of which will be graded A, B, or C. It should be noted thatinitially some applicants who present these new HNDs are likelyto offer a mix of old Units (graded Pass or Merit) and new(ungraded) HN Units.QUALITY ASSURANCE:Subject to SQA’s system of quality assurance. See Guide toAssessment, which is available on SQA’s website atwww.sqa.org.uk/files_ccc/GuideToAssessment.pdfPROGRESSION/ARTICULATION:HNDs are designed and validated at SCQF Level 8. As such,students may progress to degree courses or employment. HEIsmake their own decisions on the specific credit to be grantedand many articulation agreements exist between FE collegesand HEIs. Direct entry to year three of a degree programme maybe possible at some universities.HighersSCOTTISH CREDIT AND QUALIFICATIONS FRAMEWORKLEVEL:Level 6SCOTTISH CREDIT AND QUALIFICATIONS FRAMEWORKCREDIT VALUE:24 Credit Points (240 NLH)BACKGROUND:See ‘The System in Scotland’ introductory paragraphs.DATE OF FIRST TEACHING:1999DATE OF FIRST AWARD:2000PREREQUISITES:Highers are National Courses normally taken at the end of acandidate’s fifth year of secondary education. They are alsocommonly taken at the end of the sixth year. (The fifth and sixthyears in Scotland correspond to years 12 and 13 in England). Insome circumstances they may be taken at the end of the sixthyear. Highers can also be taken by adults.NUMBER OF UNITS/STRUCTURE:National Courses with grades normally have three 60-NLHNational Units, plus an external assessment. The number of Unitswill vary if 30- or 120-NLH Units are used in the Course. Anadditional 60-NLH is recommended to allow students to integratelearning across the Course and to prepare for the externalassessment.National Courses without grades – Skills for Work and PersonalDevelopment Courses – normally have four 60-NLH National Unitsand do not have an external assessment. The number of Units willvary if 30-, 90- or 120-NLH Units are used in the Course.ASSESSMENT METHOD:The Units that comprise the Course are internally assessed andexternally verified. Where courses contain an externalassessment, it is usually an examination or, less commonly, aproject, product or performance, or a combination of these.EXAMINATION TIMING:May/June (for National Courses with grades)DATE OF RESULT PUBLICATION:AugustGRADING SYSTEM:From August 2004, candidates have received a grade A – D. Forinformation on the grading system prior to August 2004, seeNational Courses section.TARIFF POINTSGradeUCAS Tariff pointsA 80B 65C 50D 36Ungraded Highers 45QUALITY ASSURANCE:Subject to SQA’s system of quality assurance. See Guide toAssessment, which is available on SQA’s website atwww.sqa.org.uk/files_ccc/GuideTo Assessment.pdfPROGRESSION/ARTICULATION:Highers are used for a variety of purposes, including entry tohigher education. Scottish HEIs normally frame their conditionaloffers in terms of numbers and grades of Higher passes. Somestudents will have passed four, five or, in exceptional cases, sixHighers by the end of fifth year and may well have obtained therequired grades for entry to a Scottish HEI or college. However,they may stay at school for a further year to undertake somecombination of AH and additional Highers and/or free-standingNational Units. The number of Highers that students can achievemay be affected by a school’s timetabling policy.Highers will be revised in the context of Curriculum forExcellence. The new Higher qualifications will be available from2014/15. In 2014/15 the current Higher will be dual run incentres alongside the new Higher qualifications. For moreinformation on the new qualifications and curriculum forExcellence, please visit www.sqa.org.uk/curriculumsforexcellence192 <strong>UK</strong> QUALIFICATIONS
Current Scottish <strong>Qualifications</strong>Intermediate 1 and Intermediate 2QUALIFICATION ABBREVIATION:Int 1 and Int 2SCOTTISH CREDIT AND QUALIFICATIONS FRAMEWORKLEVEL:Int 1 – level 4, Int 2 – level 5.SCOTTISH CREDIT AND QUALIFICATIONS FRAMEWORKCREDIT VALUE:Int 1 – 24 credit points (240 NLH), Int 2 –24 credit points(240 NLH)BACKGROUND:See ‘The System in Scotland’ introductory paragraphs.DATE OF FIRST TEACHING:1999DATE OF FIRST AWARD:2000PREREQUISITES:Int 1 and Int 2 are National Courses available to students normallyin the fifth and sixth years of secondary education and to postschoolstudents. However, some schools offer younger students inS4, for example, the opportunity to take Intermediate Coursesinstead of Standard Grades.NUMBER OF UNITS/STRUCTURE:National Courses with grades normally have three 60-NLHNational Units, plus an external assessment. The number of Unitswill vary if 30-, 90- or 120-NLH Units are used in the Course. Anadditional 60 NLH is recommended to allow students to integratelearning across the Course and to prepare for the externalassessment.National Courses without grades – Skills for Work and PersonalDevelopment Courses – normally have four 60-NLH NationalUnits and do not have an external assessment. The number ofUnits will vary if 30-, 90- or 120-NLH Units are used in theCourse.ASSESSMENT METHOD:The Units that comprise the Course are internally assessed andexternally verified. Where courses contain an externalassessment, it is usually an examination, or sometimes a project,product or performance, or a combination of these. Unitachievement does not contribute to the Course grade, but mustbe achieved in order for the Course to be awarded.EXAMINATION TIMING:May/June (for National Courses with grades)DATE OF RESULT PUBLICATION:August for National Courses with grades. Results for NationalCourses without grades are also normally issued in August, butcan be issued in any month of the year.GRADING SYSTEM:From August 2004, candidates have received a grade A – D. Forinformation on the grading system prior to August 2004, seesection on National Courses.QUALITY ASSURANCE:Subject to SQA’s system of quality assurance. See Guide toAssessment, which is available on SQA’s website atwww.sqa.org.uk/files_ccc/GuideToAssessment.pdfCurriculum for Excellence will see Intermediate 1 andIntermediate 2 courses being replaced by National 4 and National5 courses. In <strong>2013</strong>/14 and 2014/15, the current Intermediate 1and Intermediate 2 will be dual run in centres alongside the newNational 4 and National 5 qualifications. For more information onCurriculum for Excellence, please visitwww.sqa.org.uk/curriculumforexcellence.National Certificate Group AwardsSCOTTISH CREDIT AND QUALIFICATIONS FRAMEWORKLEVEL:Level is dependent on the component parts of the award.BACKGROUND:National Certificate Group Awards validated by SQA are stillavailable in a limited number of subjects. Of particular interest toadmissions tutors is the National Certificate Group Award inPharmaceutical Sciences. This qualification is designed to providenational recognition for specified groupings of Units which formcoherent programmes of study.DATE OF FIRST TEACHING:First introduced in session 1991/2DATE OF FIRST AWARD:1992PREREQUISITES:Entry is at the discretion of the centre.NUMBER OF UNITS/STRUCTURE:The number of Units in a National Certificate Group Award issubject to the specific qualification.ASSESSMENT METHOD:Subject to the requirements of the component parts of the award,but normally internally assessed and externally verified.EXAMINATION TIMING:Assessment is ongoing throughout the year.DATE OF RESULT PUBLICATION:Ongoing throughout the year on a weekly basis.GRADING SYSTEM:Ungraded. Achievement is certificated as a ‘Pass’.QUALITY ASSURANCE:Subject to SQA’s system of quality assurance. See Guide toAssessment, which is available on SQA’s website atwww.sqa.org.uk/files_ccc/GuideToAssessment.pdfPROGRESSION/ARTICULATION:National Certificate Group Awards offer progression to SVQs, andHNCs/HNDs.National Qualification GroupAwards (NQGAs)National Qualification Group Awards (NQGAs) is the term whichencompasses two types of non-advanced Group Awards – small,flexible National Progression Awards and larger, fixed-creditNational Certificates. Both NPAs and NCs provide thosepreparing for work with opportunities to develop skills soughtafter by employers.PROGRESSION/ARTICULATION:Intermediate Courses will be used for a variety of purposes,including progression to Higher in subsequent years. For entry toHE, they should be treated as equivalent to Standard Grade.<strong>UK</strong> QUALIFICATIONS 193
Current Scottish <strong>Qualifications</strong>National CertificatesSCOTTISH CREDIT AND QUALIFICATIONS FRAMEWORKLEVEL:Level is dependent on the component parts of the award, butNational Certificates are available at SCQF Levels 2-6.SCOTTISH CREDIT AND QUALIFICATIONS FRAMEWORKCREDIT VALUE:At SCQF Level 2 and 3 - 54 Credit Points (minimum) (540 NLH)At SCQF Level 4, 5 and 6 - 72 Credit Points (minimum) (720 NLH)BACKGROUND:National Certificates are principally aimed at 16-18-year-olds andadults in full-time education, usually in a further educationcollege, and are linked to National Occupational Standards, asappropriate to the Group Award area. They normally provideopportunities for candidates to develop all five Core Skills.DATE OF FIRST TEACHING:2005DATE OF FIRST AWARD:2006PREREQUISITES:Entry is at the discretion of the centre.NUMBER OF UNITS/STRUCTURE:The number of Units in a National Certificate is subject to thespecific qualification.ASSESSMENT METHOD:Subject to the requirements of the component parts of the award,but normally internally assessed and externally verified.EXAMINATION TIMING:Assessment is ongoing throughout the year.DATE OF RESULT PUBLICATION:Ongoing throughout the year on a weekly basis.GRADING SYSTEM:Ungraded. Achievement is certificated as a ‘Pass’.TARIFF POINTS:National Certificates carry UCAS Tariff points with effect for entryto higher education from 2011 as follows:GradeTariff pointsC 125B 100A 75Please refer to the Tariff section of the UCAS website for a list ofwhich subjects are included in each group:www.ucas.ac.uk/students/ucas_tariff/tarifftables/sncgroups.QUALITY ASSURANCE:Subject to SQA’s system of quality assurance. See Guide toAssessment, which is available on SQA’s website atwww.sqa.org.uk/files_ccc/GuideToAssessment.pdfPROGRESSION/ARTICULATION:National Certificates offer progression to SVQs, and HNCs/HNDs.National Progression Awards(NPAs)QUALIFICATION ABBREVIATION:NPAsSCOTTISH CREDIT AND QUALIFICATIONS FRAMEWORKLEVEL:Level 2-6SCOTTISH CREDIT AND QUALIFICATIONS FRAMEWORKCREDIT VALUE:12 Credit Points (minimum) (120 NLH)BACKGROUND:National Progression Awards are designed to assess a definedset of skills and knowledge in specialist vocational areas, and aremainly used by colleges for short programmes of study. They arealigned to National Occupational Standards or other professionalor trade body standards, as appropriate to the Group Award.DATE OF FIRST TEACHING:First introduced in session 2006/07DATE OF FIRST AWARD:2007PREREQUISITES:Entry is at the discretion of the centre.NUMBER OF UNITS/STRUCTURE:Number of Units can vary, however there must be a minimum of12 SCQF Credit points.ASSESSMENT METHOD:Subject to the requirements of the component parts of the award,but normally internally assessed and externally verified.EXAMINATION TIMING:Assessment is ongoing throughout the year.DATE OF RESULT PUBLICATION:Ongoing throughout the year on a weekly basis.GRADING SYSTEM:Ungraded. Achievement is certificated as a ‘Pass’.TARIFF POINTS:Only one NPA is currently Tariff-rated – NPA in PC PassportAdvanced Level (at SCQF level 6). The Tariff points are as follows:GradeTariff pointsPass 45QUALITY ASSURANCE:Subject to SQA’s system of quality assurance. See Guide toAssessment, which is available on SQA’s website atwww.sqa.org.uk/files_ccc/GuideToAssessment.pdfPROGRESSION/ARTICULATION:National Progression Awards offer progression to SVQs, andHNCs/HNDs.Professional DevelopmentAwards (PDAs)QUALIFICATION ABBREVIATION:PDASCOTTISH CREDIT AND QUALIFICATIONS FRAMEWORKLEVEL:SCQF Levels 6–12 for all new and revised PDAs. Existing PDAsunder the old design rules will be revised under the new designprinciples or phased out by December 2010. The old awardsoperate under the titles Certificate, Advanced Certificate, Diploma,and Advanced Diploma and in many cases have not been SCQFcredit rated.The SCQF Level is subject to the level of the Units that comprisethe PDA.SCOTTISH CREDIT AND QUALIFICATIONS FRAMEWORKCREDIT VALUE:At SCQF Level 6 - 12 Credit Points (minimum) (120 NLH)At SCQF Levels 7-12 - 16 Credit Points (minimum) (160 NLH).194 <strong>UK</strong> QUALIFICATIONS
Current Scottish <strong>Qualifications</strong>BACKGROUND:The PDA Modernisation Project (January 2007 until December2010) involved revising all existing PDAs according to the newdesign principles. There are a small number of PDAs stillavailable which were developed under the old design principlesand they will be revised or phased out.Professional Development Awards (PDAs) are developed inpartnership with key stakeholders and designed to ensure thatthey are more flexible in terms of size, delivery and assessment.They maintain a fitness for purpose that attends to the needs ofrapidly evolving industrial practice and employer and employeeskills needs. They are delivered in Scotland’s colleges, by privateeducation and training providers (ETPs), in some higher educationinstitutions (HEIs) and can also be delivered by employers withSQA approval status. PDAs are also available at SCQF Level 9and above, to offer industry high-level CPD for current andprospective staff; specialised enskilling for graduates; andalternative – work-related/based – higher education progressionfor successful HND and Modern Apprenticeship (SVQ level 4)candidates. Smaller PDAs can sometimes be found embedded inother Group Awards, such as HNC/HNDs, or can be large enoughto embed an HNC within it.DATE OF FIRST TEACHING:First introduced in session 1997/8PREREQUISITES:Entry is at the discretion of the centre.NUMBER OF UNITS/STRUCTURE:PDAs comprise a coherent group of Higher National Units, SVQUnits or National Units or a combination of these. The designprinciples for PDAs determine that they will be:gavailable at SCQF Levels 6–12gmade up of a minimum of two Units with a minimum creditvalue of 12 SCQF credit points at level 6, and 16 SCQFcredit points at levels 7–12. There is no mandatoryrequirement for graded assessment or the inclusion of CoreSkillsgbased on National Occupational Standards, or otherprofessional body standards, as appropriate to the GroupAward area.ASSESSMENT METHOD:Normally continuous assessment and increasingly work-based.EXAMINATION TIMING:Subject to requirements of component parts of the PDA.DATE OF RESULT PUBLICATION:Ongoing throughout the year on a weekly basis.GRADING SYSTEM:Mostly ungraded, but where grading is involved, subject torequirements of component parts of the PDA.QUALITY ASSURANCE:Subject to SQA’s system of quality assurance. See Guide toAssessment, which is available on SQA’s website atwww.sqa.org.uk/files_ccc/GuideToAssessment.pdfPROGRESSION/ARTICULATION:PDAs are designed to help career entry, career development orcareer enhancement, or they may help facilitate career change.However, HE generally considers them for entry – particularlythose designed for post-HND progression, along with theexperience and other qualifications held by the applicant.Scottish Progression Awards(SPAs)SPAs are gradually being replaced with new National ProgressionAwards (NPAs) and National Certificates (NCs).QUALIFICATION ABBREVIATION:SPASCOTTISH CREDIT AND QUALIFICATIONS FRAMEWORKLEVEL:Normally, levels 3–8. SCQF Level is subject to the Level of theUnits which comprise the SPA.BACKGROUND:Designed to provide the underpinning knowledge and enableprogression to Scottish Vocational <strong>Qualifications</strong> (SVQ).DATE OF FIRST TEACHING:First introduced in session 1998/9PREREQUISITES:Entry is at the discretion of the centre.NUMBER OF UNITS/STRUCTURE:The number of Units in a SPA is subject to the specificqualification. SPAs can comprise a group of SVQ Units, a groupof National or Higher National Units, or a combination of these.Assessment is subject to Units that comprise the qualification.ASSESSMENT METHOD:Subject to the requirements of the component parts of the SPA.EXAMINATION TIMING:Assessment flexible to meet candidate needs.DATE OF RESULT PUBLICATION:Ongoing throughout the year.QUALITY ASSURANCE:Subject to SQA’s system of quality assurance. See Guide toAssessment, which is available on SQA’s website atwww.sqa.org.uk/files_ccc/GuideToAssessment.pdfPROGRESSION/ARTICULATION:Candidates normally progress to a full SVQ or other trainingprogramme.Scottish Vocational <strong>Qualifications</strong>(SVQs)QUALIFICATION ABBREVIATION:SVQSCOTTISH CREDIT AND QUALIFICATIONS FRAMEWORKLEVEL*:SVQ 1 – SCQF Level 4, SVQ 2 – SCQF Level 5, SVQ 3 – SCQFLevel 6, SVQ 4 – SCQF Level 8, SVQ 5 – SCQF Level 11.*For many SVQs the levelling to the SCQF has not yet occurred,so the levels are notional. The notional positioning of SVQs on theSCQF gives a broad indication of their place within it. As in mostgroup awards, SVQs are likely to be made up of Units at anumber of levels. As their position on the SCQF is refined, it islikely that some SVQs will be aligned to more than one SCQFLevel. SVQs are being credit rated to the SCQF on an ongoingbasis.SCOTTISH CREDIT AND QUALIFICATIONS FRAMEWORKCREDIT VALUE:Variable<strong>UK</strong> QUALIFICATIONS 195
Current Scottish <strong>Qualifications</strong>BACKGROUND:SVQs are at five non-SCQF Levels based on skills andcompetences required to do a job or range of jobs in a specificindustry, from basic operative to senior management. They areanalogues of NVQs in the rest of the <strong>UK</strong>.DATE OF FIRST TEACHING:First introduced in 1990.PREREQUISITES:Appropriate workplace experience.NUMBER OF UNITS/STRUCTURE:SVQs are Unit-based and are assessed in the workplace or insimulated workplace conditions.ASSESSMENT METHOD:SVQs incorporate National Occupational Standards identified bySector Skills Councils (SSCs) (previously National TrainingOrganisations (NTOs)). Although the focus is on performance, theimportance of underpinning knowledge and understanding,particularly at the higher levels, is now well recognised and,following major reviews, steps have been taken to make theserequirements more explicit.EXAMINATION TIMING:Assessment flexible to meet candidate needs.DATE OF RESULT PUBLICATION:Ongoing throughout the year on a weekly basis.GRADING SYSTEM:Not gradedQUALITY ASSURANCE:Accredited by SQA and offered by a range of bodies, includingSQA. See Guide to Assessment, which is available on SQA’swebsite at www.sqa.org.uk/files_ccc/GuideToAssessment.pdfPROGRESSION/ARTICULATION:SVQ Levels 3 and 4 may be used for entry to HE with or withoutadvanced standing, sometimes in association with Recognition ofPrior Learning (RPL). SVQs at levels 4 and 5 might be used forentry to higher degrees and are sometimes offered in HE as partof postgraduate programmes. Some Colleges and HEIs in Scotlandcombine HNC/HND, degree or postgraduate programmes withSVQs at various levels to ensure students have a broaderexperience of both academic and work-based activities. SVQs maybe embedded in HE programmes such as HNC or HND and will becertificated accordingly. SVQ level 3 is one of the threecomponents of a Modern Apprenticeship in Scotland.PREREQUISITES:S Grades are normally studied over the third and fourth years ofsecondary education.ASSESSMENT METHOD:In most subjects, a combination of internal and externalassessment.EXAMINATION TIMING:May/JuneDATE OF RESULT PUBLICATION:AugustGRADING SYSTEM:1–6 pass grades, with 1 being the highest grade. S Gradeachievement is described on 3 levels: Credit level grades 1 and 2(SCQF Level 5) General level grades 3 and 4 (SCQF Level 4) andFoundation level covers grades 5 and 6 (SCQF Level 3).QUALITY ASSURANCE:Subject to SQA’s system of quality assurance. See Guide toAssessment, which is available on SQA’s website atwww.sqa.org.uk/files_ccc/GuideToAssessment.pdfPROGRESSION/ARTICULATION:S Grades are used for a variety of purposes including entry toemployment or progression to Intermediate, Higher and AdvancedHigher National Courses. For entry to HE, grades 1–3 at S Gradeare normally acceptable in combination with Highers in themain subjects.Curriculum for Excellence will see Standard Grades beingreplaced by National 3, National 4 and National 5 courses. Thefirst National 3, 4 and 5 courses will be available from <strong>2013</strong>/14.The final Standard Grades will be offered in 2012/13. For moreinformation on Curriculum for Excellence, please visitwww.sqa.org.uk/curriculumforexcellenceStandard GradesQUALIFICATION ABBREVIATION:S GradeSCOTTISH CREDIT AND QUALIFICATIONS FRAMEWORKLEVEL:Levels 3–5BACKGROUND:S Grades were first certificated in 1986 with the former OrdinaryGrade finally being discontinued in 1994. (Since 2002, someschools have offered students the opportunity to takeIntermediate Courses in place of S Grade.)DATE OF FIRST TEACHING:1984DATE OF FIRST AWARD:1986196 <strong>UK</strong> QUALIFICATIONS
Scottish Curriculum ReformABOUT CURRICULUM FOR EXCELLENCE (CfE)Curriculum for Excellence (CfE) is the new 3-18 curriculum whichhas been adopted by all schools in Scotland. It aims to makelearning more relevant to the modern world and give youngpeople the skills, knowledge and understanding they need tosucceed in learning, life and work. It is transforming education byproviding a coherent, flexible and enriched curriculum for allyoung people aged 3 to 18 and includes a review of otheraspects of Scotland's education system, including qualifications,assessment and learning and teaching approaches. This will helpprepare young people to take their place in a modern society andeconomy.SQA is a partner organisation involved in developing theCurriculum for Excellence programme. The other partners are theScottish Government and Education Scotland (formed by amerger of Her Majesty’s Inspectorate of Education (HMIe) andLearing and Teaching Scotland (LTS)). Maximising theopportunities that CfE provides requires a joined up approachacross a range of sectors and bodies, and there has been muchpartnership working with the HE sector, along with the teachingunions, associations and employers.Universities have been, and continue to be, key partners in thedevelopment of CfE. As CfE is implemented, it is crucial thatuniversities reflect on the implications and benefits for their ownactivities and practices. This includes both learning and teachingstrategies and admission and recruitment policies. The aim is toensure young people can experience a smooth transition fromschools and colleges to universities, building on prior learning andpreparing for future learning.More specifically, learners will be applying to universities withenhanced skills for learning and new qualifications from 2014onwards. Flexibility in the way in which young people obtainqualifications is a key part of the personalisation and choiceagenda within CfE and as a result young people may have amuch greater range of pathways to obtaining qualifications thanis currently the case, e.g. Highers achieved over 2 years (5 terms)or, for the most able, bypassing lower level qualifications andstudying Highers from S4 onwards.CfE represents a different approach to learning in schools. Thiswill help learners to develop skills and knowledge in more depthwhich they can use across different subjects and gain abilitieswhich they can apply to life outside the classroom. This freshapproach to learning requires new assessment methods andqualifications. SQA’s principal role is to design and develop thenew qualifications and assessment.The new qualifications will have equal status and credibility tothose currently available and will support the new curriculum.ABOUT THE NEW QUALIFICATIONSNational 4 and National 5 will replace the current National<strong>Qualifications</strong> – Standard Grade General and Credit, andIntermediate 1 and 2. Foundation level Standard Grade will bereplaced by National 3. Current Access 1 and Access 2qualifications will be replaced by National 1 and National 2qualifications.Revisions will also be made to the current Higher and AdvancedHigher qualifications to reflect the values, purposes and principlesof CfE.The new National 1 to National 5 qualifications will be introducedin <strong>2013</strong>/14, followed by the new Higher qualifications in 2014/15and the new Advanced Higher qualifications in 2015/16.The Scottish Baccalaureates in Sciences and Languages wereintroduced in August 2009 and the Scottish Baccalaureates inSocial Sciences and Expressive Arts are being introduced August2012. These qualifications have the aim of encouraging morepupils to study these subjects in upper secondary school andassist young people in their transition to tertiary education andemployment. They are especially aimed at high-achieving pupilsand provide learners with a value added dimension to S6 study,through an Interdisciplinary Project at the same level asAdvanced Higher (SCQF Level 7).ABOUT LITERACY AND NUMERACYDevelopment of literacy and numeracy skills is the responsibilityof all teachers and other practitioners who support youngpeople’s learning, regardless of where the young person islearning or the subject being taught. Literacy and Numeracy Unitswill be developed at SCQF Levels 3, 4 and 5, using the skills forLearning, Skills for Life and Skills for Work framework, which canbe accessed at www.sqa.org.uk/sqa/45395.html.These units will be available for all learners to use in any relevantcontext.The Literacy Unit is part of the English and Gàidhlig Courses atNational 3 and National 4. Work in English (National 5) and otherCourses, may be used to contribute to the Literacy Unit atNational 5. The Numeracy Unit is part of the Mathematics Courseat Access 3 and National 4. Work in Mathematics (National 5)and other Courses, may be used to contribute to the NumeracyUnit at National 5. The Numeracy Unit is part of the new LifeskillsMathematics Courses at National 4 and National 5. The Literacyand Numeracy Units will also be available to adult learners.DEVELOPING THE NEW QUALIFICATIONSThe process of designing and developing new qualifications is ahuge task involving teams from across SQA and representativesfrom the teaching profession and wider groups such as thosewho represent further and higher education, unions andprofessional organisations. SQA is developing hundreds ofqualifications at many levels and across many subjects.To ensure that each qualification is of the highest quality, theprocess has been designed to be transparent, allowing forextensive consultation, while maintaining standards. This work isbeing undertaken to ensure that the qualifications support thedevelopment of the required skills among Scotland’s learners.Work on the new qualifications started in 2006. Since then therehas been engagement with partners, stakeholders and theteaching profession on the policy, design and development of thenew qualifications.Over a 3-year period, SQA has hosted meetings, seminars andworkshops with stakeholders to discuss issues such asassessment, curriculum planning, quality assurance andcontinuing professional development.SQA has also set up specific groups to take forward thedevelopment of the new and revised qualifications.Curriculum Area Review Groups (CARGs) provide advice andguidance in each curriculum area. Each group is made up ofnominated representatives from partner organisations,stakeholders, teaching associations and parent groups.<strong>Qualifications</strong> Design Teams (QDTs) work on the design ofqualifications within individual subjects such as Physics, History,English, Music etc. They are made up of nominated subject experts.Subject Working Groups (SWGs) carry out specific pieces of workas designated by the QDTs. Teachers and practitioners cannominate themselves to join these groups.<strong>UK</strong> QUALIFICATIONS 197
Scottish Curriculum ReformThe HEI sector has representation across the CARGs, QDTs andSWGs.More information on published final documents can be found atwww.sqa.org.uk/sqa/57094.3346.htmlDELIVERING THE NEW QUALIFICATIONSWhilst the new qualifications are being implemented, there will bea two-year transition period in <strong>2013</strong>/14 and 2014/15 while thecurrent qualifications are phased out. This is to allow the finalyear group studying Intermediate 1 and / or Intermediate 2 toprogress to the current Higher and Advanced Higher withoutdisruption to their learning.The last year for Standard Grade presentation will be 2012/13with final certification in August <strong>2013</strong>.The new National <strong>Qualifications</strong> (Nationals 1–5) will beimplemented in centres in time for those who started S1 inAugust 2010. SQA will support centres in the build-up to andduring this period.In <strong>2013</strong>–14, the new National 2, National 3, National 4 andNational 5 qualifications will run in centres alongside the currentAccess 2, Access 3, Intermediate 1 and Intermediate 2. The newqualifications will be available for those in S4, while S5 and S6students will complete their education with the currentqualifications.In 2014–15, the new National 2, National 3, National 4, National5 and Higher qualifications will run in centres alongside Access2, Access 3, Intermediate 1, Intermediate 2 and the currentHigher. The new qualifications will be available for those in S4and S5, while S6 students will complete their education with thecurrent qualifications.In 2015–16, the new National 2, National 3, National 4, National5, Higher and Advanced Higher will be available. The newAdvanced Higher qualifications will not be dual run.MORE INFORMATIONFor more information about Curriculum for Excellence, includingthe supporting documentation, development schedule andtimetable for implementation, please see:www.sqa.org.uk/curriculumforexcellence.SQA also has a sign-up facility – MyAlerts – which providesemail notification when new content on CfE is added to the site:www.sqa.org.uk/sqa/39510.html198 <strong>UK</strong> QUALIFICATIONS
Phased Out <strong>Qualifications</strong>As part of a phased programme, National <strong>Qualifications</strong> havereplaced SCE Highers, Certificate of Sixth Year Studies (CSYS),General Scottish Vocational <strong>Qualifications</strong> (GSVQs), Scottish GroupAwards (SGAs) and other Units and groupings of Units andmodules. A number of applicants will only offer the National<strong>Qualifications</strong>, while others will offer some combination of old andnew qualifications.Certificate of Sixth Year Studies(CSYS)The final sitting of examinations for the CSYS was summer 2001,except for CSYS English, which was summer 2002.CSYS was intended to encourage pupils who had obtained aHigher pass in a subject in fifth year to pursue independent studyin selected areas of that subject in sixth year. However, theuptake of CSYS was limited. In most subjects, there was a fairlywide range of options, and candidates were required to work onindividual projects and lines of enquiry.There were five grades: A, B, C, D and E, which were broadlycomparable to the same grades at GCE A level. Some pupils withfour or five good Highers studied up to three CSYS subjects insixth year, with many combining CSYS and additional Highers.Grade (previously known as Ranking) BandA 1B 2C 3D 4E 5No award 6Reporting:Grades A, B, C (pass grades) were reported to both centres andcandidates.General Scottish Vocational<strong>Qualifications</strong> (GSVQs)GSVQs were replaced by SGAs. SGAs began to replace GSVQsfrom the start of session 1999/2000 with no further certificationof GSVQs after 30 September 2004.GSVQs were broadly based group awards leading to employmentand to FE and HE. Level 3 awards (pre-SCQF, but comparable toSCQF Level 6) were designed to help enable progression to HEand were of particular interest to admissions tutors.National Certificate ModulesNational Certificate Modules were replaced by, or converted into,National Units.National Certificate Modules were introduced in 1984/5 whennon-advanced vocational qualifications in Scotland weremodularised. Modules were offered in schools, colleges,community education and training centres. Candidates wereassessed against outcomes and performance criteria to ensurenational standards, and all centres were subject to externalmoderation and other quality assurance requirements.Some modular programmes count towards the general entrancerequirements of some HEIs. In particular, certain groups of modulesare recognised as alternatives to Standard Grades and Highers andthese recognised groupings are detailed in Recognised Groupingsof National Certificate Modules, published by SQA.National Certificate Modules were used by the three ScottishWider Access Programme (SWAP) consortia to build accessprogrammes tailored to meet the admissions requirements of HE.Some institutions also had agreements with local schools andcolleges which recognised particular groupings of modules forentry to specified HNC, HND and degree programmes.Scottish Group Awards (SGAs)SGAs were replaced by National Progression Awards (NPAs) andNational Certificates and have not been available since July 2010.SGAs were introduced in 1999 and were made up of NationalCourses, National Units and Core Skills, which fitted together tomake a balanced and coherent programme of study, normallylasting a year for full-time students and longer for part-timestudents. Untitled or general SGAs were available at all levels.At Int 2 and Higher, named SGAs (eg Arts, Sciences, Business,Technology) were also available.There was a minimum credit and Core Skills requirement for allnamed and general SGAs. SGAs at AH required 20 credits, plusCore Skills Profile at specified levels; SGAs at Higher required 20credits, plus Core Skills Profile at specified levels; SGAs at Int 1and Int 2 required 16 credits, plus Core Skills Profile at specifiedlevels.SGAs were designed to provide progression to FE and HE andemployment. Higher and AH SGAs would have been of particularinterest to admissions tutors as they demonstrated thatcandidates had achieved success over a coherent programme ofsubjects and in the five Core Skills.These group awards were made up of specified numbers ofmandatory and optional National Units (previously NationalCertificate Modules), with the balance between mandatory andoptional varying according to the award area. The mandatoryelement included core skills (the analogue of key skills in the restof the <strong>UK</strong>). GSVQ candidates were also required to pass anintegrated assessment, which was used to distinguish two levelsof achievement: Pass and Merit.<strong>UK</strong> QUALIFICATIONS 199
Phased Out <strong>Qualifications</strong>Scottish Certificate of Education(SCE) HighersThe final sitting of examinations for SCE Highers was summer2001, with the exception of SCE Higher English, where the finaldiet of examinations for resit/two-year candidates was 2002.Bands and grades for SCE Highers are as follows.Grade (previously Band (previously Scaled Markknown as Band) known as Range)A 1 90 –100A 2 85–89A 3 80–84A 4 75–79A 5 70–74B 6 65–69B 7 60–64C 8 55–59C 9 50–54D 10 45–49D 11 40–44- 12 35–39- 13 30–34- 14 0–29Reporting:ggGrades A, B, C (pass grades) and D were reported to thecandidatesThe Band was reported to the centre.200 <strong>UK</strong> QUALIFICATIONS
Certificates and other supporting evidence likely to be offeredby applicantsRelevant contact information is given in Appendix A.Scottish <strong>Qualifications</strong> Certificate(SQC)The SQC is a candidate’s record of achievement in GroupAwards, National Courses, National Units, Core Skills, HigherNational Units, Workplace-assessed Units and SCQF credits.Since January 2000, the SQC has replaced the SCE, CSYS andRET issued by SQA's predecessor bodies SEB and SCOTVEC.The SQC package includes the following:gggSummary of Attainment – a cumulative record of all GroupAwards, Courses and stand-alone Units a candidate hasachieved since 1994Detailed Record of Attainment – lists all the qualifications acandidate has achieved since last issued with a certificateProfiles – this section shows a candidate’s currentachievements in Core Skills and SCQF credits.<strong>Qualifications</strong> of particular interest to admissions tutors, such asStandard Grade, Intermediate 1 and 2, Higher and AdvancedHigher, are recorded on the SQC. In the case of National<strong>Qualifications</strong>, the Detailed Record of Attainment, which listscurrent achievements linked to each examination diet, may proveparticularly helpful.Commemorative CertificatesCommemorative certificates are issued marking the completion ofgroup awards. Thus, for example, a candidate completing a groupaward such as National Certificate, NPA, HNC, HND, SVQ orScottish Baccalaureate receives a commemorative certificaterecognising that achievement. In each case, details of allcomponent Units of the Courses or group awards are listed onthe SQC.Scottish Certificate of Education(SCE)This has been replaced by the SQC. The SCE recordedcandidates’ achievements in Standard Grades, Highers and ShortCourses prior to January 2000.Certificate of Sixth Year StudiesThis has been replaced by the SQC. It recorded successes inCSYS Courses prior to January 2002.Certificates awarded by theScottish Vocational EducationCouncil’s (SCOTVEC)predecessor bodies: ScottishBusiness Education Council(SBEC) and Scottish TechnicalEducation Council (STEC)Information on certificates issued by SCOTBEC and SCOTEC isavailable from SQA.SUPPORTING EVIDENCE FOR ENTRY TO HIGHEREDUCATIONAt interview and in correspondence, applicants may refer to someof the information in the following sections.Progress FileThe Progress File replaced the National Record of Achievement(NRA), which was introduced in February 1991 to provide onecommon, nationally recognised format to summarise individuals’experiences and achievements and help them plan futuredevelopments. The Progress File is designed to support lifelonglearning and help people to plan their personal development andfuture education and career. For updated information about theProgress File in Scotland, please refer to the entry for ‘ProgressFile’ in the ‘Phased Out <strong>Qualifications</strong>’ section for England, Walesand Northern Ireland.National Record of Achievement(NRA)The NRA was replaced by the Progress File.Young Enterprise ScotlandYoung Enterprise Scotland develops the enterprise skills of studentsaged 15 to 19, providing them with the opportunity of formingand running their own companies. The Young Enterprise Scotlandexamination is an assessment of competence in work experience,with questions related to the business excellence model.Record of Education and Training(RET)This has been replaced by the SQC. The RET recorded allNational Certificate Modules, Higher National Units and WorkplaceAssessed Units, and group awards based on these modules andUnits, prior to January 2000.<strong>UK</strong> QUALIFICATIONS 201
Certificates and other supporting evidence likely to be offered by applicantsModern Apprenticeships inScotlandIn Scotland, Modern Apprenticeships (MAs) were first developed in1994. They continue to be developed and reviewed by employerledpartnerships. MAs are designed to meet skill requirements ofall sectors and prepare workers for a highly skilled environment.They are aimed at those who are capable of achieving an SVQ atlevel 3 or above.There are three components to a Scottish MA: vocationalqualifications to SVQ level 3 or above; core skills; and industry-specificcomponents, which might include Units to develop knowledge andunderstanding of the core vocational area. The development offlexibility within the workplace is an additional feature.The final apprenticeship certificate is presented by theappropriate Sector Skills Council.Currently, the body responsible for approving MA frameworks inScotland is the Modern Apprenticeship Group (MAG). MAGcomprises members of Highland and Islands Enterprise Network(HIE), Scottish Enterprise Network, Skills Development Scotland(SDS), (incorporating Careers Scotland), Scottish Government andSQA Accreditation.202 <strong>UK</strong> QUALIFICATIONS
Routes into Higher Education in ScotlandINTRODUCTIONThis section describes the main routes into HE in Scotland andrelated topics, including credit accumulation and transfer usingthe developing SCQF.APPLICANTS FROM SCHOOLSMost applicants from schools will offer some combination ofHighers, Advanced Highers and Scottish Baccalaureates. Somecandidates may offer Intermediate 1 and 2 instead of Generaland Credit Standard Grades.The entrance requirements of Scottish HEIs are generallyformulated in terms of passes in Highers. Institutions haveadapted their admissions policies to recognise the AdvancedHigher, but the recognition given to individual qualifications isdecided by individual institutions and will vary depending on thecourse or faculty to which entry is sought.Scottish applicants applying direct from school to HEIs andcolleges may have taken seven or eight Standard Grades (or anumber of Intermediate Courses) in the fourth year and four orfive Highers in fifth year. A few applicants may have bypassedStandard Grade or Intermediate 1 or 2 and moved directly toHighers. (Variations will depend in part on the ability of the pupiland in part on the school curriculum policy.) Generally, thesepupils enter HE at 18 after six years of secondary education, buta significant minority enter at 17 after only five years insecondary school. Pupils who remain at school for a sixth yearmay undertake some combination of Advanced Highers andadditional Highers, Intermediate Courses and/or free-standingNational Units.NOTE ON AGE AND STAGE REGULATIONSIn March 2004, as part of the National Debate on Education,the Scottish Executive consulted on the future of Age and Stageregulations. As a result of that consultation, the Scottish Executivedecided to replace the Age and Stage regulations with guidance.The document, Guidance on the appropriate age and stagewhen young people can be presented for externally assessedqualifications (Circular 3/2005, Scottish Executive, 2005), outlineskey principles that should guide decisions about when a youngperson is ready to be presented for a formal qualification.MATURE APPLICANTS AND APPLICANTS FROM FURTHEREDUCATION COLLEGESHEIs in Scotland recognise the importance and value of makingtheir provision more accessible in a wide variety of ways, andhave welcomed mature applicants and applicants from FEcolleges with a wide range of qualifications. FE collegescontribute significantly to the provision of HE in Scotland, with arange of HNC and HND programmes from which many progressto degrees in the HE sector.Mature candidates and applicants from colleges are likely to offera mixture of old and new Highers, SGAs, National Units, NationalCertificate Modules, HNCs, HNDs and SVQs. Traditionally, certaingroupings of National Certificate Modules have been recognisedas an alternative to Standard Grades and Highers for thepurposes of entry to certain courses at Scottish HEIs. Detailedinformation is available from SQA. Contact information is givenin Appendix A.EXAMPLES OF POSSIBLE PROGRESSION ROUTES FOR SCHOOL CANDIDATES3rd year Standard Grade at Credit Standard Grade at General National Course at Intermediate 2 National Course at Intermediate 14th year Standard Grade at Credit Standard Grade at General National Course at Intermediate 2 National Course at Intermediate 15th year National Course at Higher Scottish Baccalaureate National Course at Intermediate 26th year National Course at Advanced Higher Scottish Baccalaureate National Course at Higher<strong>UK</strong> QUALIFICATIONS 203
Routes into Higher Education in ScotlandScottish Access to HigherEducation Programmes, Coursesand PathwaysOver the years, access programmes have played an importantrole in increasing participation in HE in Scotland. In the past, themajority of Scottish Access Programmes were run under theauspices of the Scottish Wider Access Programme (SWAP) andcontinuing education departments in Scottish HEIs. In recentyears, a wider range of institutions, including communityeducation and voluntary organisations, have become involved inprovision to create additional pathways to HE. Lifelong learning,social inclusion and increased participation in HE are ScottishGoverment priorities. Additional pathways to HE have been andare continuing to be developed.Scottish Wider AccessProgramme (SWAP)SWAP Access programmes are designed specifically for adultsseeking to progress to higher education. They are one-yearprogrammes developed using National Qualification units whichallow entry to a number of degree courses. Students canundertake programmes in Humanities including PrimaryEducation, Science and Technology, Nursing, Health and MedicalStudies.SWAP students who successfully complete their programmes areguaranteed progression to an HNC, HND or degree course. SWAPAccess Programmes are delivered mainly in colleges and arerecognised by the receiving higher education institutions throughlocal consortium arrangements.A directory of all SWAP programmes and progression routes isavailable from partner HEIs. Further information can be obtainedfrom members of the SWAP consortia – SWAP: West and CentralAccess Consortium, SWAP: East and SWAP: North. Contactinformation is given in Appendix A.Access Courses Run by HigherEducation InstitutionsA wide variety of access courses are run by individual HEIs andthere is rapid development in this area. For example, there areprogrammes which offer a bridge to degree-level study for adultswhose earlier education has been disrupted or adversely affected.In addition, some credit-bearing part-time/short courses offeredby HEIs can be used as a route into HE. Summer Schools (seebelow) provide access for both school-leavers and maturestudents whose formal qualifications are not a true reflection oftheir potential. Successful completion in some cases mayguarantee a place at the HEI. For details of courses, contact theadmissions office at the institution concerned.contact Youth Link Scotland. Contact information for CommunitiesScotland and Youth Link Scotland is given in Appendix A.Summer SchoolsA number of Scottish HEIs operate special entry Summer Schoolsin order to support greater participation in HE and to assistaccess for disadvantaged students generally. Special partnershiparrangements between institutions and education authorities seekto encourage applications from young people who have thepotential to succeed in HE. Some Scottish HEIs have alsoestablished Science Enhancement Summer Schools to widenaccess to Science and Engineering to able students with nonstandardentrance qualifications. Information about SummerSchools may be obtained direct from the institutions.Credit Accumulation and TransferThe SCQF is the national credit and qualifications framework inScotland. The SCQF builds on and replaces SCOTCAT.International FoundationProgramme – Scotland(Prior to September 2003 known as the Scottish InternationalProgramme (SIP))The programme is an established and recognised course foroverseas students hoping to enter Scotland’s unique system ofhigher education.The purpose of the Foundation Programme is to enable overseasstudents to obtain the grades needed to enter their chosencourses, by way of the Scottish <strong>Qualifications</strong> Authorityqualifications and Foundation examinations.Prospective university students sit SQA Highers and theFoundation English examination during the AcademicSummer Programme.Students who do not achieve all the required Higher grades havethe opportunity to take the Foundation examinations. Theseexaminations are accepted by the Scottish institutions of highereducation as the equivalent of Highers, and give Foundationstudents a second opportunity to achieve the necessary grades.Foundation students can enter higher education with acombination of Higher and Foundation results.The opportunity to upgrade Higher grade results through theFoundation examinations is a special feature of the FoundationProgramme, and is available only to Programme students. Ineffect, it allows Programme students to resit their examinations inthe same year as they attempt Highers.Contact information for IFPS is given in Appendix A.Community Education, VoluntaryOrganisation RoutesSome HEIs and FE colleges have links with informal communitybasedlearning organisations. Many of the informal learningopportunities can be used as access courses for CommunityLearning and Development-endorsed qualifications. For furtherdetails, contact Communities Scotland. Community Learningwork-based routes into HE are also available. For further details,204 <strong>UK</strong> QUALIFICATIONS
Appendix A – Contact DetailsABC AwardsRobins Wood HouseRobins Wood RoadAspleyNottinghamshire NG8 3NHt: 0115 854 1616f: 0115 854 1617w: www.abcawards.co.ukAscentisOffice 4Lancaster Business ParkMannin WayCaton RoadLancaster LA1 3SWt: 01524 845 046f: 01524 388 467e: development@ascentis.co.ukw: www.ascentis.co.ukAssessment and <strong>Qualifications</strong>AllianceStag Hill HouseGuildfordSurrey GU2 7XJt: 01483 506 506f: 01483 300 152e: mailbox@aqa.org.ukw: www.aqa.org.uk31-33 Springfield AvenueHarrogateNorth Yorkshire HG1 2HWt: 0161 953 1180f: 01423 523 678e: mailbox@aqa.org.ukw: www.aqa.org.ukDevas StreetManchester M15 6EXt: 0161 953 1180f: 0161 273 7572e: mailbox@aqa.org.ukw: www.aqa.org.ukAssociated Board of the RoyalSchools of Music24 Portland PlaceLondon W1B 1LUt: 020 7636 5400f: 020 7637 0234w: www.abrsm.orgAward Scheme Development andAccreditation NetworkWainbrook HouseHudds Vale RoadSt GeorgeBristol BS5 7HYt: 0117 941 1126f: 0117 954 8325e: info@asdan.org.ukw: www.asdan.co.ukBritish Horse SocietyAbbey ParkStaretonKenilworthWarwickshire CV8 2XZt: 0844 848 1666f: 02476 840 501e: enquiry@bhs.org.ukw: www.bhs.org.ukCambridge Assessment1 Hills RoadCambridge CB1 2EUt: 01223 553 311f: 01223 460 278e: info@cambridgeassessment.org.ukw: www.cambridgeassessment.org.ukCambridge International Examinations1 Hills RoadCambridge CB1 2EUt: 01223 553 554f: 01223 553 558e: international@cie.org.ukw: www.cie.org.ukCentre for Recording Achievement104-108 WallgateWiganLancashire WN3 4ABt: 01942 826 761f: 01942 323 337w: www.recordingachievement.orgCity and Guilds1 Giltspur StreetLondon EC1A 9DDt: 0844 543 0000f: 020 7294 2413w: www.cityandguilds.co.uk4th Floor144 West George StreetGlasgow G2 2HGt: 0141 341 5700f: 0141 341 5725e: scotland@cityandguilds.comw: www.cityandguilds.co.uk/scotlandChartered Institute of Bankers inScotlandDrumsheugh House38b Drumsheugh GardensEdinburgh EH3 7SWt: 0131 473 7777f: 0131 473 7788e: info@charteredbanker.comw: www.charteredbanker.comChristian Education EuropeMaranatha HouseUnit 5Northford CloseShrivenhamSwindon SN6 8HLt: 01793 783 783f: 01793 783 775e: info@christian-education.orgw: www.christian-education.orgCouncil for Awards in Children’s Careand EducationCACHE Head OfficeApex House81 Camp RoadSt. AlbansHertfordshire AL1 5GBt: 0845 347 2123f: 01727 818618e: info@cache.org.ukw: www.cache.org.ukCouncil for the CurriculumExaminations and Assessment (CCEA)29 Clarendon RoadClarendon DockBelfast BT1 3BGt: 028 9026 1200f: 028 9026 1234e: info@ccea.org.ukw: www.ccea.org.ukCommunity Service Volunteers (CSV)237 Pentonville RoadLondon N1 9NJt: 020 7278 6601f: 020 7833 0149e: information@csv.org.ukw: www.csv.org.ukDepartment for Business, Innovationand SkillsWritten Correspondence:1 Victoria StreetLondon SW1H OETt: 020 7215 5000w: www.bis.gov.uk<strong>UK</strong> QUALIFICATIONS 205
Appendix A – Contact DetailsDepartment for Education and Skills(DfES) WalesWelsh GovernmentCathays ParkCardiff CF10 3NQt: 0300 060 3300e: wag-en@mailuk.custhelp.comw: www.wales.gov.uk/topics/educationandskills/Department for Education (DfE)Sanctuary BuildingsGreat Smith StreetLondon SW1P 3BTt: 0370 000 2288f: 01928 738 248w: www.education.gov.ukDepartment of EducationNorthern IrelandRathgael HouseBalloo RoadRathgillBangor BT19 7PRt: 028 9127 9279e: mail@deni.gov.ukw: www.deni.gov.ukDuke of Edinburgh’s AwardGulliver HouseMadeira WalkWindsor SL4 1EUt: 01753 727 400f: 01753 810 666e: info@DofE.orgw: www.DofE.orgThain House226 Queensferry Road,Edinburgh EH4 2BPt: 0131 343 0920f: 0131 332 9920e: scotland@DofE.orgw: www.DofE.org/scotlandEdexcelHead Office190 High HolbornLondon WC1V 7BHt: 0845 618 0440w: www.edexcel.org.ukEducation Development InternationalInternational HouseSiskin Parkway EastMiddlemarch Business ParkCoventry CV3 4PEt: 024 7651 6500f: 024 7651 6505e: enquiries@ediplc.comw: www.ediplc.comEngineering Education Scheme inEnglandWeltech CentreRidgewayWelwyn Garden CityHerts AL7 2AAt: 01707 871 520e: info@thescheme.org.ukw: www.etrust.org.ukEngineering Education Scheme inScotlandScottish Engineering105 West George StreetGlasgow G2 1QLt: 0141 221 3181f: 0141 204 1202e: consult@scottishengineering.org.ukw: www.scottishengineering.org.ukIndustrial Careers Foundation8 Nightingale PlaceBuckingham MK18 1UFt: 01280 812 547e: geoff@icf.org.ukw: www.icf.org.ukInstitute of Commercial ManagementICM HouseCastleman WayRingwoodHampshire BH24 3BAt: 01202 490555f: 01202 490666e: info@icm.ac.ukw: www.icm.ac.ukifs School of Finance8th FloorPeninsular House36 Monument StreetLondon EC3R 8LJt: 0207 444 7111f: 0207 444 7115e: customerservices@ifslearning.ac.ukw: www.ifslearning.ac.ukInternational BaccalaureatePeterson HouseMalthouse AvenueCardiff GateCardiff CF23 8GLt: 029 2054 7777f: 029 2054 7778e: ibca@ibo.orgw: www.ibo.orgRoute des Morillons 15Grand-SaconnexGeneva CH-1218Switzerlandt: +41 22 309 2540f: +41 22 791 0277e: ibhq@ibo.orgw: www.ibo.orgLCM ExaminationsUniversity of West LondonTC326St Mary’s RoadEaling W5 5RFt: 020 8231 2364f: 020 8231 2433e: lcm.exams@uwl.ac.ukw: www.uwl.ac.uk/lcmexamsLearning and Skills ImprovementServiceFriars HouseManor House DriveCoventry CV1 2TEt: 024 7662 7900e: enquiries@lsis.org.ukw: www.lsis.org.ukLearning Materials for Change (LMC)ProjectGLADE – Centre for Global andDevelopment EducationThe GLADE CentreFrog LaneIlminsterSomerset TA19 0APt: 01460 55755f: 01460 55753e: glade@glade.orgw: www.glade.orgNational Assembly for WalesCardiff BayCardiff CF99 1NAt: 0845 010 5500e: assembly.info@wales.gov.ukw: www.assemblywales.org206 <strong>UK</strong> QUALIFICATIONS
Appendix A – Contact DetailsNational Open College Network(NOCN)The QuadrantParkway Business Park99 Parkway AvenueSheffield S9 4WGt: 0114 227 0500f: 0114 227 0501e: nocn@nocn.org.ukw: www.nocn.org.ukNCC Education LtdThe TowersTower Business ParkWilmslow RoadDidsburyManchester M20 2EZt: 01614 386 200f: 01614 386 240e: customer.service@nccedu.comw: www.nccedu.comNCFECitygateSt James’ BoulevardNewcastle upon Tyne NE1 4JEt: 0191 239 8000f: 0191 239 8001e: info@ncfe.org.ukw: www.ncfe.org.ukNorthern Ireland Council for theCurriculum, Examinations andAssessment29 Clarendon RoadClarendon DockBelfast BT1 3BGt: 028 9026 1200f: 028 9026 1234e: info@ccea.org.ukw: www.ccea.org.ukOffice of the <strong>Qualifications</strong> andExaminations Regulator (Ofqual)Spring PlaceCoventry Business ParkHerald AvenueCoventry CV5 6UBt: 0300 303 3344f: 0300 303 3348e: info@ofqual.gov.ukw: www.ofqual.gov.ukOpen UniversityWalton HallMilton Keynes MK7 6AAt: 01908 274 066f: 01908 654 914w: www.open.ac.ukOpen University in Scotland10 Drumsheugh GardensEdinburgh EH3 7QJt: 0131 226 3851f: 0131 220 6730e: scotland@open.ac.ukw: www3.open.ac.uk/near-you/ScotlandOxford, Cambridge and RSAExaminations1 Hills RoadCambridge CB1 2EUOCR Customer Contact CentreVocational <strong>Qualifications</strong>:t: 02476 851 509f: 02476 421 944e: vocational.qualifications@ocr.org.ukw: www.ocr.org.ukGeneral <strong>Qualifications</strong>:t: 01223 553998f: 01223 552627e: general.qualifications@ocr.org.ukw: www.ocr.org.ukPrince’s Trust VolunteersHead OfficeThe Prince’s Trust18 Park Square EastLondon NW1 4LHt: 020 7543 1234f: 020 7543 1200e: webinfops@princes-trust.org.ukw: www.princes-trust.org.ukThe Prince’s Trust – ScotlandHead Office6th FloorPortland House17 Renfield StreetGlasgow G2 5AHt: 0141 204 4409f: 0141 221 8221e: webinfosc@princes-trust.org.ukw: www.princes-trust.org.ukThe Prince’s Trust – CymruHead OfficeBaltic HouseMount Stuart SquareCardiff CF10 5FHt: 029 2043 7000f: 029 2043 7001e: webinfowa@princes-trust.org.ukw: www.princes-trust.org.ukThe Prince’s Trust – Northern IrelandHead OfficeBlock 5Jennymount CourtNorth Derby StreetBelfast BT15 3HNt: 028 9074 5454f: 028 9074 8416e: webinfoni@princes-trust.org.ukw: www.princes-trust.org.ukQuality Assurance Agency for HigherEducationSouthgate HouseSouthgate StreetGloucester GL1 1UBt: 01452 557000f: 01452 557070e: comms@qaa.ac.ukw: www.qaa.ac.uk183 St Vincent StreetGlasgow G2 5QDt: 0141 572 3420f: 0141 572 3421e: comms@qaa.ac.ukw: www.qaa.ac.ukScottish Credit and <strong>Qualifications</strong>Framework39 St Vincent PlaceGlasgowG1 2ERt: 0845 270 7371f: 0845 270 7372e: info@scqf.org.ukw: www.scqf.org.ukScottish GovernmentSt Andrew’s HouseRegent RoadEdinburgh EH1 3DGt: 0845 774 1741f: 01397 795 001e: ceu@scotland.gsi.gov.ukw: www.scotland.gov.uk<strong>UK</strong> QUALIFICATIONS 207
Appendix A – Contact DetailsScottish <strong>Qualifications</strong> AuthorityCustomer Contact CentreThe Optima Building58 Robertson StreetGlasgow G2 8DQt: 0845 279 1000f: 0845 213 5000e: customer@sqa.org.ukw: www.sqa.org.ukLowden24 Wester ShawfairDalkeithMidlothian EH22 1FDt: 0845 279 1000f: 0845 213 5000e: customer@sqa.org.ukw: www.sqa.org.ukScottish Wider Access ProgrammeSWAP: West300 Cathedral StreetGlasgowG1 2TAt: 0800 731 0949e: swapwest@scottishwideraccess.orgw: www.scottishwideraccess.orgSWAP: East25 Buccleuch PlaceEdinburghEH8 9LNt: 0800 731 0949e: swapeast@scottishwideraccess.orgw: www.scottishwideraccess.orgSWAP: NorthNorth ForumRoom G07Regent BuildingKing’s CollegeUniversity of AberdeenAberdeen AB24 3FXt: 01224 273008e: swapnorth@scottishwideraccess.orgw: www.scottishwideraccess.orgSEECc/o PO Box 1241EnfieldMiddlesexEN1 9UBt: 0845 217 7749e: office@seec.org.ukw: www.seec.org.ukTOEFLETS Europe <strong>UK</strong>707 High RoadLondon N12 0BTt: 020 8446 9944f: 0871 978 7521w: www.uk.etsglobal.orgTrinity College London89 Albert EmbankmentLondon SE1 7TPt: 020 7820 6100f: 020 7820 6161e: info@trinitycollege.co.ukw: www.trinitycollege.co.uk<strong>UK</strong> Commission for Employment andSkillsRenaissance HouseAdwick ParkWath-upon-DearneSouth Yorkshire S63 5NBt: 01709 774 800f: 01709 774 801e: info@ukces.org.ukw: www.ukces.org.ukUniversities Scotland53 Hanover StreetEdinburgh EH2 2PJt: 0131 226 1111f: 0131 226 1100e: info@universities-scotland.ac.ukw: www.universities-scotland.ac.ukUniversities <strong>UK</strong>24 Woburn House20 Tavistock SquareLondon WC1H 9HQt: 020 7419 4111f: 020 7388 8649e: info@universitiesuk.ac.ukw: www.universitiesuk.ac.ukWelsh Joint Education Committee245 Western AvenueCardiff CF5 2YXt: 029 2026 5000e: info@wjec.co.ukw: www.wjec.co.ukYoung Enterprise Scotland40 Wellington StreetGlasgowG2 6HJt: 0141 2020 650f: 0141 2020 654w: www.yes.org.ukYouth Link ScotlandRosebery House9 Haymarket TerraceEdinburgh EH12 5EZt: 0131 313 2488f: 0131 313 6800e: info@youthlinkscotland.orgw: www.youthlinkscotland.org208 <strong>UK</strong> QUALIFICATIONS <strong>UK</strong> QUALIFICATIONS 208
Appendix B – The UCAS TariffAdmission to higher education courses is generally dependentupon an individual’s achievement in level 3 qualifications, such asGCE A levels. Did you know that there are currently over 3,000level 3 (or equivalent) qualifications available in the <strong>UK</strong> alone?As if the number of qualifications available was not confusingenough, different qualifications can have different gradingstructures (alphabetical, numerical or a mixture of both).The UCAS Tariff is the system for allocating points toqualifications used for entry to HE. It allows students to use arange of different qualifications to help secure a place on anundergraduate course.Universities and colleges use the UCAS Tariff to makecomparisons between applicants with different qualifications.Tariff points are often used in entry requirements, although otherfactors are often taken into account. Entry Profiles provide a fullerpicture of what admissions tutors are seeking.The tables on the following pages show the qualifications coveredby the UCAS Tariff. There may have been changes to these tablessince this book was printed. You should visit www.ucas.com toview the most up-to-date tables.Further information?Although Tariff points can be accumulated in a variety of ways,not all of these will necessarily be acceptable for entry to aparticular HE course. The achievement of a points score thereforedoes not give an automatic entitlement to entry, and many otherfactors are taken into account in the admissions process.The Course Search facility at www.ucas.com is the best source ofreference to find out what qualifications are acceptable for entryto specific courses. Updates to the Tariff, including details on hownew qualifications are added, can be found atwww.ucas.com/students/ucas_tariff/.How does the Tariff work?ggggggStudents can collect Tariff points from a range of differentqualifications, eg GCE A level with BTEC.There is no ceiling to the number of points that can beaccumulated.There is no double counting. Certain qualifications within theTariff build on qualifications in the same subject. In thesecases only the qualification with the higher Tariff score will becounted. For example, this principle applies to:gGCE Advanced Subsidiary level and GCE Advanced levelgScottish Highers and Advanced HighersgSpeech, drama and music awards at grades 6, 7 and 8.Tariff points for the Advanced Diploma come from theProgression Diploma score plus the relevant Additional andSpecialist Learning (ASL) Tariff points. Please see theappropriate qualification in the Tariff tables to calculate theASL score.The Extended Project Tariff points are included within theTariff points for Progression and Advanced Diplomas.Extended Project points represented in the Tariff only countwhen the qualification is taken outside of these Diplomas.Where the Tariff tables refer to specific awardingorganisations, only qualifications from these awardingorganisations attract Tariff points. <strong>Qualifications</strong> with a similartitle, but from a different qualification awarding organisationdo not attract Tariff points.How do universities and collegesuse the Tariff?The Tariff provides a facility to help universities and collegeswhen expressing entrance requirements and when makingconditional offers. Entry requirements and conditional offersexpressed as Tariff points will often require a minimum level ofachievement in a specified subject (for example, ‘300 points toinclude grade A at A level chemistry’, or ‘260 points includingSQA Higher grade B in mathematics’).Use of the Tariff may also vary from department to department atany one institution, and may in some cases be dependent on theprogramme being offered.209 <strong>UK</strong> QUALIFICATIONS<strong>UK</strong> QUALIFICATIONS 209
Appendix B – The UCAS TariffWHAT QUALIFICATIONS ARE INCLUDED IN THE TARIFF?The following qualifications are included in the UCAS Tariff. See the number on the qualification title to find the relevant sectionof the Tariff table.1 AAT NVQ Level 3 in Accounting2 AAT Level 3 Diploma in Accounting (QCF)3 Advanced Diploma4 Advanced Extension Awards5 Advanced Placement Programme (US and Canada)6 Arts Award (Gold)7 ASDAN Community Volunteering qualification8 Asset Languages Advanced Stage9 British Horse Society (Stage 3 Horse Knowledge & Care, Stage 3 Riding and Preliminary Teacher's Certificate)10 BTEC Awards (NQF)11 BTEC Certificates and Extended Certificates (NQF)12 BTEC Diplomas (NQF)13 BTEC National in Early Years (NQF)14 BTEC Nationals (NQF)15 BTEC QCF <strong>Qualifications</strong> (Suite known as Nationals)16 BTEC Specialist <strong>Qualifications</strong> (QCF)17 CACHE Award, Certificate and Diploma in Child Care and Education18 CACHE Level 3 Extended Diploma for the Children and Young People’s Workforce (QCF)19 Cambridge ESOL Examinations20 Cambridge Pre-U21 Certificate of Personal Effectiveness (COPE)22 CISI Introduction to Securities and Investment23 City & Guilds Land Based Services Level 3 <strong>Qualifications</strong>24 Graded Dance and Vocational Graded Dance25 Diploma in Fashion Retail26 Diploma in Foundation Studies (Art & Design; Art, Design & Media)27 EDI Level 3 Certificate in Accounting, Certificate in Accounting (IAS)28 Essential Skills (Northern Ireland)29 Essential Skills Wales30 Extended Project (stand alone)31 Free-standing Mathematics32 Functional skills33 GCE (AS, AS Double Award, A level, A level Double Award and A level (with additional AS))34 Hong Kong Diploma of Secondary Education (from 2012 entry onwards)35 ifs School of Finance (Certificate and Diploma in Financial Studies)36 iMedia (OCR level Certificate/Diploma for iMedia Professionals)37 International Baccalaureate (IB) Diploma38 International Baccalaureate (IB) Certificate39 Irish Leaving Certificate (Higher and Ordinary levels)40 IT Professionals (iPRO) (Certificate and Diploma)41 Key Skills (Levels 2, 3 and 4)42 Music examinations (grades 6, 7 and 8)43 OCR Level 3 Certificate in Mathematics for Engineering44 OCR Level 3 Certificate for Young Enterprise45 OCR Nationals (National Certificate, National Diploma and National Extended Diploma)46 Principal Learning Wales47 Progression Diploma48 Rockschool Music Practitioners <strong>Qualifications</strong>49 Scottish <strong>Qualifications</strong>50 Speech and Drama examinations (grades 6, 7 and 8 and Performance Studies)51 Sports Leaders <strong>UK</strong>52 Welsh Baccalaureate Advanced Diploma (Core)Updates on the Tariff, including details on the incorporation of any new qualifications, are posted on www.ucas.com.210 <strong>UK</strong> QUALIFICATIONS
Appendix B – The UCAS TariffUCAS TARIFF TABLES1234AAT NVQ LEVEL 3IN ACCOUNTINGAAT LEVEL 3 DIPLOMAIN ACCOUNTINGADVANCED DIPLOMAADVANCEDEXTENSION AWARDSGRADETARIFF POINTSPASS 160GRADETARIFF POINTSPASS 160Advanced Diploma = ProgressionDiploma plus Additional &Specialist Learning (ASL). Pleasesee the appropriate qualification tocalculate the ASL score. Pleasesee the Progression Diploma(Table 47) for Tariff scoresGRADETARIFF POINTSDISTINCTION 40MERIT 20Points for Advanced ExtensionAwards are over and above thosegained from the A level grade5 67ADVANCED PLACEMENTPROGRAMME (US & CANADA)GRADE TARIFF POINTSGroup A5 1204 903 60Group B5 504 353 20Details of the subjects covered byeach group can be found atwww.ucas.com/students/ucas_tariff/tarifftablesARTS AWARD (GOLD)GRADE TARIFF POINTSPASS 35ASDAN COMMUNITYVOLUNTEERING QUALIFICATIONGRADE TARIFF POINTSCERTIFICATE 50AWARD 308910ASSET LANGUAGES ADVANCED STAGEGRADE TARIFF POINTS GRADE TARIFF POINTSSpeakingListeningGRADE 12 28 GRADE 12 25GRADE 11 20 GRADE 11 18GRADE 10 12 GRADE 10 11ReadingWritingGRADE 12 25 GRADE 12 25GRADE 11 18 GRADE 11 18GRADE 10 11 GRADE 10 11BRITISH HORSESOCIETYGRADE TARIFF POINTSStage 3 Horse Knowledge & CarePASS 35Stage 3 RidingPASS 35Preliminary Teacher’s CertificatePASS 35Awarded by Equestrian<strong>Qualifications</strong> (GB) Ltd (EQL)BTEC AWARDS (NQF)(EXCLUDING BTECNATIONAL QUALIFICATIONS)GRADETARIFF POINTSGroupAGroupBGroupCDISTINCTION 20 30 40MERIT 13 20 26PASS 7 10 13Details of the subjects covered byeach group can be found atwww.ucas.com/students/ucas_tariff/tarifftables11BTEC CERTIFICATES AND EXTENDED CERTIFICATES (NQF)(EXCLUDING BTEC NATIONAL QUALIFICATIONS)TARIFF POINTSGRADEGroup A Group B Group C Group D Extended CertificatesDISTINCTION 40 60 80 100 60MERIT 26 40 52 65 40PASS 13 20 26 35 20Details of the subjects covered by each group can be found at www.ucas.com/students/ucas_tariff/tarifftables12BTEC DIPLOMAS (NQF) (EXCLUDING BTECNATIONAL QUALIFICATIONS)TARIFF POINTSGRADEGroup A Group B Group CDISTINCTION 80 100 120MERIT 52 65 80PASS 26 35 40Details of the subjects covered by each group can befound at www.ucas.com/students/ucas_tariff/tarifftables<strong>UK</strong> QUALIFICATIONS 211
Appendix B – The UCAS TariffUCAS TARIFF TABLES13BTEC NATIONAL IN EARLY YEARS (NQF)GRADE TARIFF POINTS GRADE TARIFF POINTS GRADE TARIFF POINTSTheory PracticalDiploma Certificate D 120DDD 320 DD 200 M 80DDM 280 DM 160 P 40DMM 240 MM 120MMM 220 MP 80MMP 160 PP 40MPP 120PPP 80Points apply to the followingqualifications only: BTEC NationalDiploma in Early Years(100/1279/5); BTEC NationalCertificate in Early Years(100/1280/1)14BTEC NATIONALS (NQF)GRADE TARIFF POINTS GRADE TARIFF POINTS GRADE TARIFF POINTSDiploma Certificate AwardDDD 360 DD 240 D 120DDM 320 DM 200 M 80DMM 280 MM 160 P 40MMM 240 MP 120MMP 200 PP 80MPP 160PPP 1201516EXTENDEDDIPLOMABTEC QUALIFICATIONS (QCF)(SUITE OF QUALIFICATIONS KNOWN AS NATIONALS)DIPLOMA90 CREDITDIPLOMASUBSIDIARYDIPLOMACERTIFICATETARIFFPOINTSD*D*D* 420D*D*D 400D*DD 380DDD 360DDM 320DMM D*D* 280D*D 260MMM DD 240D*D* 210MMP DM D*D 200DD 180MPP MM DM 160D* 140PPP MP MM D 120MP 100PP M 80D* 70PP D 60P M 40P 20BTEC SPECIALIST (QCF)TARIFF POINTSGRADEDiploma Certificate AwardDISTINCTION 120 60 20MERIT 80 40 13PASS 40 20 7212 <strong>UK</strong> QUALIFICATIONS
Appendix B – The UCAS TariffUCAS TARIFF TABLES1719CACHE LEVEL 3 AWARD, CERTIFICATE AND DIPLOMA IN CHILD CARE & EDUCATIONAWARD CERTIFICATE DIPLOMAGRADE TARIFF POINTS GRADE TARIFF POINTS GRADE TARIFF POINTSA 30 A 110 A 360B 25 B 90 B 300C 20 C 70 C 240D 15 D 55 D 180E 10 E 35 E 1202018CACHE LEVEL 3 EXTENDEDDIPLOMA FOR THE CHILDRENAND YOUNG PEOPLE’SWORKFORCE (QCF)GRADETARIFF POINTSA* 420A 340B 290C 240D 140E 80CAMBRIDGE ESOLEXAMINATIONSGRADETARIFF POINTSCertificate of Proficiency in EnglishA 140B 110C 70Certificate in Advanced EnglishA 70CAMBRIDGE PRE-UGRADE TARIFF POINTS GRADE TARIFF POINTS GRADE TARIFF POINTSPrincipal Subject Global Perspectives and Research Short CourseD1 TBC D1 TBC D1 TBCD2 145 D2 140 D2 TBCD3 130 D3 126 D3 60M1 115 M1 112 M1 53M2 101 M2 98 M2 46M3 87 M3 84 M3 39P1 73 P1 70 P1 32P2 59 P2 56 P2 26P3 46 P3 42 P3 20212223CERTIFICATE OF PERSONALEFFECTIVENESS (COPE)GRADE TARIFF POINTSPASS 70Points are awarded forthe Certificate of PersonalEffectiveness (CoPE) awardedby ASDAN and CCEACISI INTRODUCTION TOSECURITIES AND INVESTMENTGRADEPASS WITHDISTINCTIONPASS WITHMERITTARIFF POINTS6040PASS 20GRADECITY AND GUILDS LAND BASED SERVICESLEVEL 3 QUALIFICATIONSEXTENDEDDIPLOMATARIFF POINTSDIPLOMASUBSIDIARYDIPLOMACERTIFICATEDISTINCTION* 420 280 140 70DISTINCTION 360 240 120 60MERIT 240 160 80 40PASS 120 80 40 202425GRADED DANCE AND VOCATIONAL GRADED DANCEGRADE TARIFF POINTS GRADE TARIFF POINTS GRADE TARIFF POINTSGraded DanceGrade 8 Grade 7 Grade 6DISTINCTION 65 DISTINCTION 55 DISTINCTION 40MERIT 55 MERIT 45 MERIT 35PASS 45 PASS 35 PASS 30Vocational Graded DanceAdvanced FoundationIntermediateDISTINCTION 70 DISTINCTION 65MERIT 55 MERIT 50PASS 45 PASS 40DIPLOMA IN FASHION RETAILGRADE TARIFF POINTSDISTINCTION 160MERIT 120PASS 80Applies to the NQF and QCFversions of the qualificationsawarded by ABC Awards<strong>UK</strong> QUALIFICATIONS 213
Appendix B – The UCAS TariffUCAS TARIFF TABLES26272829DIPLOMA IN FOUNDATIONSTUDIES (ART & DESIGN ANDART, DESIGN & MEDIA)GRADETARIFF POINTSDISTINCTION 285MERIT 225PASS 165Awarded by ABC, Edexcel, UALand WJECEDI LEVEL 3 CERTIFICATE INACCOUNTING, CERTIFICATE INACCOUNTING (IAS)GRADETARIFF POINTSDISTINCTION 120MERIT 90PASS 70ESSENTIAL SKILLS(NORTHERN IRELAND)GRADETARIFF POINTSLEVEL 2 10Only allocated at level 2 if studiedas part of a wider compositequalification such as 14-19Diploma or Welsh BaccalaureateESSENTIAL SKILLSWALESGRADETARIFF POINTSLEVEL 4 30LEVEL 3 20LEVEL 2 10Only allocated at level 2 if studiedas part of a wider compositequalification such as 14-19Diploma or Welsh Baccalaureate3031EXTENDED PROJECT(STAND ALONE)FREE-STANDINGMATHEMATICSGRADETARIFF POINTSGRADETARIFF POINTSA* 70A 20A 60B 17B 50C 13C 40D 10D 30E 7E 20Points for the Extended Projectcannot be counted if taken as partof Progression/Advanced DiplomaCovers free-standing Mathematics -Additional Maths, Using andApplying Statistics, Working withAlgebraic and Graphical Techniques,Modelling with Calculus3233FUNCTIONAL SKILLSGCE AND VCEGRADE TARIFF POINTSLEVEL 2 10Only allocated if studied as part ofa wider composite qualificationsuch as 14-19 Diploma or WelshBaccalaureateGRADETARIFFPOINTSGCE & AVCE DoubleAwardGRADETARIFFPOINTSGCE A level withadditional AS (9 units)GRADETARIFFPOINTSGCE A level& AVCEGRADETARIFFPOINTSGCE ASDouble AwardGRADETARIFFPOINTSGCE AS& AS VCEA*A* 280 A*A 200 A* 140 AA 120 A 60A*A 260 AA 180 A 120 AB 110 B 50AA 240 AB 170 B 100 BB 100 C 40AB 220 BB 150 C 80 BC 90 D 30BB 200 BC 140 D 60 CC 80 E 20BC 180 CC 120 E 40 CD 70CC 160 CD 110 DD 60CD 140 DD 90 DE 50DD 120 DE 80 EE 40DE 100 EE 60EE 8034HONG KONG DIPLOMA OF SECONDARY EDUCATIONGRADE TARIFF POINTS GRADE TARIFF POINTS GRADE TARIFF POINTSAll subjects exceptmathematicsMathematics compulsorycomponentMathematics optionalcomponents5** No value 5** No value 5** No value5* 130 5* 60 5* 705 120 5 45 5 604 80 4 35 4 503 40 3 25 3 40No value for 5** pending receipt of candidate evidence (post 2012)214 <strong>UK</strong> QUALIFICATIONS
Appendix B – The UCAS TariffUCAS TARIFF TABLES3536IFS SCHOOL OF FINANCE (NQF & QCF)GRADE TARIFF POINTS GRADE TARIFF POINTSCertificate in Financial Studies(CeFS)Diploma in Financial Studies(DipFS)A 60 A 120B 50 B 100C 40 C 80D 30 D 60E 20 E 40Applicants with the ifs Diploma cannot also count points allocated to theifs Certificate. Completion of both qualifications will result in a maximumof 120 UCAS Tariff pointsLEVEL 3 CERTIFICATE / DIPLOMAFOR iMEDIA USERS (iMEDIA)GRADETARIFF POINTSDIPLOMA 66CERTIFICATE 40Awarded by OCR3738INTERNATIONAL BACCALAUREATE (IB) DIPLOMAGRADE TARIFF POINTS GRADE TARIFF POINTS45 720 34 47944 698 33 45743 676 32 43542 654 31 41341 632 30 39240 611 29 37039 589 28 34838 567 27 32637 545 26 30436 523 25 28235 501 24 260GRADEINTERNATIONAL BACCALAUREATE (IB) CERTIFICATETARIFFPOINTSGRADETARIFFPOINTSGRADEHigher Level Standard Level CoreTARIFFPOINTS7 130 7 70 3 1206 110 6 59 2 805 80 5 43 1 404 50 4 27 0 103 20 3 11394041IRISH LEAVING CERTIFICATEGRADE TARIFF POINTS GRADE TARIFF POINTSHigherOrdinaryA1 90 A1 39A2 77 A2 26B1 71 B1 20B2 64 B2 14B3 58 B3 7C1 52C2 45C3 39D1 33D2 26D3 20IT PROFESSIONALS(iPRO)GRADE TARIFF POINTSDIPLOMA 100CERTIFICATE 80Awarded by OCRGRADEKEY SKILLSTARIFF POINTSLEVEL 4 30LEVEL 3 20LEVEL 2 10Only allocated at level 2 if studiedas part of a wider compositequalification such as 14-19Diploma or Welsh Baccalaureate<strong>UK</strong> QUALIFICATIONS 215
Appendix B – The UCAS TariffUCAS TARIFF TABLES42MUSIC EXAMINATIONSGRADE TARIFF POINTS GRADE TARIFF POINTS GRADE TARIFF POINTSPracticalGrade 8 Grade 7 Grade 6DISTINCTION 75 DISTINCTION 60 DISTINCTION 45MERIT 70 MERIT 55 MERIT 40PASS 55 PASS 40 PASS 25TheoryGrade 8 Grade 7 Grade 6DISTINCTION 30 DISTINCTION 20 DISTINCTION 15MERIT 25 MERIT 15 MERIT 10PASS 20 PASS 10 PASS 5Points shown are for the ABRSM, LCMM/University of West London, Rockschool and Trinity Guildhall/TrinityCollege London Advanced Level music examinations43OCR LEVEL 3 CERTIFICATE INMATHEMATICS FOR ENGINEERINGGRADETARIFF POINTSA* TBCA 90B 75C 60D 45E 304445OCR LEVEL 3 CERTIFICATEFOR YOUNG ENTERPRISEGRADETARIFF POINTSDISTINCTION 40MERIT 30PASS 20OCR NATIONALSGRADE TARIFF POINTS GRADE TARIFF POINTS GRADE TARIFF POINTSNational Extended Diploma National Diploma National CertificateD1 360 D 240 D 120D2/M1 320 M1 200 M 80M2 280 M2/P1 160 P 40M3 240 P2 120P1 200 P3 80P2 160P3 1204647PRINCIPAL LEARNING WALESGRADE TARIFF POINTSA* 210A 180B 150C 120D 90E 60PROGRESSION DIPLOMAGRADETARIFF POINTSA* 350A 300B 250C 200D 150E 100Advanced Diploma = ProgressionDiploma plus Additional &Specialist Learning (ASL). Pleasesee the appropriate qualification tocalculate the ASL score216 <strong>UK</strong> QUALIFICATIONS
Appendix B – The UCAS TariffUCAS TARIFF TABLES48GRADEROCKSCHOOL MUSIC PRACTITIONERS QUALIFICATIONSExtendedDiplomaDiplomaTARIFF POINTSSubsidiaryDiplomaExtendedCertificateCertificateDISTINCTION 240 180 120 60 30MERIT 160 120 80 40 20PASS 80 60 40 20 1049SCOTTISH QUALIFICATIONSGRADE TARIFF POINTS GRADE TARIFF POINTS GRADE TARIFF POINTS GROUP TARIFF POINTSAdvanced Higher Higher Scottish Interdisciplinary Project Scottish National CertificatesA 130 A 80 A 65 C 125B 110 B 65 B 55 B 100C 90 C 50 C 45 A 75D 72 D 36 Details of the subjects covered byeach Scottish National CertificateUngraded HigherNPA PC Passportcan be found at www.ucas.com/PASS 45 PASS 45students/ucas_tariff/tarifftablesCore SkillsHIGHER 2050SPEECH AND DRAMA EXAMINATIONSGRADE TARIFF POINTS GRADE TARIFF POINTS GRADE TARIFF POINTS GRADE TARIFF POINTSPCertLAM Grade 8 Grade 7 Grade 6DISTINCTION 90 DISTINCTION 65 DISTINCTION 55 DISTINCTION 40MERIT 80 MERIT 60 MERIT 50 MERIT 35PASS 60 PASS 45 PASS 35 PASS 20Details of the Speech and Drama <strong>Qualifications</strong> covered by the Tariff can be found at www.ucas.com/students/ucas_tariff/tarifftables51SPORTS LEADERS <strong>UK</strong>GRADETARIFF POINTSPASS 30These points are awarded to HigherSports Leader Award and Level 3Certificate in Higher SportsLeadership (QCF)52WELSH BACCALAUREATEADVANCED DIPLOMA (CORE)GRADE TARIFF POINTSPASS 120These points are awarded onlywhen a candidate achieves theWelsh Baccalaureate AdvancedDiploma<strong>UK</strong> QUALIFICATIONS 217
Appendix C – GCSE Subject AvailabilityDetails about individual specifications are available from the relevant awarding bodies.TitleAdditional Applied ScienceAdditional ScienceAdditional Science AAdditional Science BAncient HistoryAncient History (Short Course)Applications of Mathematics (Pilot)Applied BusinessApplied Business (Double)Applied ICT A (Double)Applied Science (Double)ArabicArabic: Spoken Language (Short Course)Arabic: Written Language (Short Course)Art and DesignArt and Design (Short Course)Art and Design (Applied)Art and Design: Critical and Contextual StudiesArt and Design: Fine ArtArt and Design: Fine Art (Short Course)Art and Design: Graphic CommunicationArt and Design: Graphic Communication (Short Course)Art and Design: Photography: Lens & Light Based MediaArt and Design: Photography: Lens & Light Based Media (Short Course)Art and Design: Textile DesignArt and Design: Textile Design (Short Course)Art and Design: 3-Dimensional DesignArt and Design: 3-Dimensional Design (Short Course)AstronomyBengaliBengali; Spoken Language (Short Course)Bengali: Written Language (Short Course)Biblical HebrewBiologyBiology ABiology BBusiness & Communication SystemsBusiness CommunicationsBusiness StudiesBusiness Studies (Short Course)Business Studies & EconomicsCateringChemistryChemistry AChemistry BChineseChinese: Spoken Language (Short Course)Chinese: Written Language (Short Course)Chinese (Mandarin)Chinese (Mandarin); Spoken Language (Short Course)Chinese (Mandarin); Written Language (Short Course)Citizenship StudiesCitizenship Studies (Short Course)Classical CivilisationClassical Civilisation (Short Course)Classical GreekClassical Greek (Short Course)Computer ScienceComputingConstruction and the Built EnvironmentCymraegCymraeg Ail IaithCymraeg Ail Iaith (Cwrs Byr)Cymraeg Ail Iaith CymhwysolCymraeg Ail Iaith Cymhwysol (Cwrs Byr)Awarding BodyAQA OCR WJECAQA Edexcel WJECOCROCROCROCRAQA Edexcel OCR WJECCCEA Edexcel ICAAE OCR WJECAQA Edexcel ICAAE OCR WJECCCEAAQA CCEA OCR WJECEdexcelEdexcelEdexcelAQA CCEA Edexcel OCR WJECAQA EdexcelAQA OCR WJECOCR WJECAQA Edexcel OCR WJECEdexcelAQA Edexcel OCR WJECEdexcelAQA Edexcel OCR WJECEdexcelAQA Edexcel OCR WJECEdexcelAQA Edexcel OCR WJECEdexcelEdexcelAQAAQAAQAOCRAQA CCEA Edexcel WJECOCROCRAQA CCEA OCREdexcelAQA CCEA Edexcel OCR WJECAQA EdexcelEdexcelWJECAQA CCEA Edexcel WJECOCROCREdexcelEdexcelEdexcelAQAAQAAQAAQA Edexcel OCRAQA Edexcel OCRAQA OCRAQA OCROCROCRAQAOCRCCEAWJECWJECWJECWJECWJEC218 <strong>UK</strong> QUALIFICATIONS
Appendix C – GCSE Subject AvailabilityTitleDanceDesign & TechnologyDesign & Technology (Short Course)Design & Technology: Electronics and Control SystemsDesign & Technology: Electronics and Control Systems (Short Course)Design & Technology: Electronic ProductsDesign & Technology: Food TechnologyDesign & Technology: Food Technology (Short Course)Design & Technology: GraphicsDesign & Technology: Graphics (Short Course)Design & Technology: Graphic ProductsDesign & Technology: Industrial TechnologyDesign & Technology: Industrial Technology (Short Course)Design & Technology: Product DesignDesign & Technology: Product Design (Short Course)Design & Technology: Resistant MaterialsDesign & Technology: Resistant Materials (Short Course)Design & Technology: Resistant Materials TechnologyDesign & Technology: Systems & Control TechnologyDesign & Technology: Textiles TechnologyDesign & Technology: Textiles Technology (Short Course)Digital Communication (Pilot)DramaDutchDutch: Spoken Language (Short Course)Dutch: Written Language (Short Course)EconomicsEconomics (Short Course)ElectronicsEngineeringEngineering (Double)EnglishEnglish LanguageEnglish LiteratureEnvironmental and Land-Based ScienceEnvironmental ScienceExpressive ArtsFilm Studies (Pilot)FrenchFrench: Spoken Language (Short Course)French: Written Language (Short Course)GaeilgeGeneral StudiesGeographyGeography (Short Course)Geography AGeography A (Short Course)Geography BGeography B (Short Course)GeologyGermanGerman:Spoken Language (Short Course)German:Written Language (Short Course)GreekGreek: Spoken Language (Short Course)Greek: Written Language (Short Course)GujaratiGujarati: Spoken Language (Short Course)Gujarati: Written Language (Short Course)Health & Social CareHealth & Social Care (Double)HistoryHistory (Pilot)History AHistory A (Short Course)History BHistory B (Short Course)Home EconomicsHome Economics: Child DevelopmentHome Economics: Food & NutritionHome Economics: TextilesAwarding BodyAQAOCRAQA OCROCROCRAQA EdexcelAQA Edexcel OCR WJECOCROCROCRAQA Edexcel WJECOCROCRAQA OCR WJECOCROCROCRAQA Edexcel WJECAQA WJECAQA Edexcel OCR WJECOCREdexcelAQA CCEA Edexcel OCR WJECOCROCROCRAQA CCEA OCRAQAAQA WJECAQA CCEA OCRAQA Edexcel OCRAQA CCEA Edexcel OCR WJECAQA CCEA Edexcel OCR WJECAQA CCEA Edexcel OCR WJECOCRAQAAQA OCRWJECAQA CCEA Edexcel OCR WJECAQA CCEA Edexcel OCRAQA CCEA Edexcel OCRCCEAAQACCEAOCRAQA Edexcel OCR WJECAQAAQA Edexcel OCR WJECAQAWJECAQA CCEA Edexcel OCR WJECAQA CCEA Edexcel OCRAQA CCEA Edexcel OCREdexcelEdexcelEdexcelOCROCROCRAQA CCEA Edexcel OCR WJECAQA CCEA Edexcel OCR WJECCCEA WJECOCRAQA Edexcel OCRAQAAQA Edexcel OCRAQA OCRCCEAAQA CCEA OCR WJECAQA OCR WJECWJEC<strong>UK</strong> QUALIFICATIONS 219
Appendix C – GCSE Subject AvailabilityTitleHospitalityHospitality and Catering (Double)Human Health & PhysiologyHumanitiesInformation & Communication TechnologyInformation & Communication Technology (Double Award)Information & Communication Technology (Short Course)IrishIrish Spoken Language (Short Course)Irish Written Language (Short Course)ItalianItalian: Spoken Language (Short Course)Italian: Written Language (Short Course)JapaneseJapanese: Spoken Language (Short Course)Japanese: Written Language (Short Course)Journalism in the Media and Communications Industry (JMC)LatinLatin (Short Course)LawLearning for Life and WorkLeisure & TourismLeisure & Tourism (Double)Llenyddiaeth GymraegManufacturingManufacturing (Double)MathematicsMathematics (Linear)Mathematics AMathematics BMedia StudiesMedia Studies (Double Award)Methods in Mathematics (Pilot)Modern HebrewModern Hebrew: Spoken Language (Short Course)Modern Hebrew: Written Language (Short Course)Motor Vehicle and Road User StudiesMoving Image ArtsMusicPanjabiPanjabi: Spoken Language (Short Course)Panjabi: Written Language (Short Course)Performing ArtsPerforming Arts (Double Award)Personal and Social Education (Short Course)PersianPersian: Spoken Language (Short Course)Persian: Written Language (Short Course)Physical EducationPhysical Education (Double Award)Physical Education (Short Course)PhysicsPhysics APhysics BPreparation for Working Life (Short Course)PolishPolish: Spoken Language (Short Course)Polish: Written Language (Short Course)PortuguesePortuguese: Spoken Language (Short Course)Portuguese: Written Language (Short Course)PsychologyPsychology (Short Course)Religious StudiesReligious Studies (Short Course)Religious Studies AReligious Studies A (Short Course)Religious Studies BReligious Studies B (Short Course)Religious Studies C (Pilot)Religious Studies C (Short Course) (Pilot)Awarding BodyCCEA WJECWJECAQAAQA OCR WJECAQA CCEA Edexcel OCR WJECEdexcelAQA CCEA OCR WJECCCEACCEACCEAAQA EdexcelAQA EdexcelAQA EdexcelEdexcelEdexcelEdexcelCCEAOCROCRAQA OCRCCEAAQA CCEA Edexcel OCR WJECAQA Edexcel OCR WJECWJECCCEA OCREdexcel OCRAQA CCEA WJECWJECAQA Edexcel OCRAQA Edexcel OCRAQA OCR WJECAQAAQA Edexcel OCR WJECAQAAQAAQACCEACCEAAQA CCEA Edexcel OCR WJECAQAAQAAQAAQA WJECAQA WJECWJECOCROCROCRAQA CCEA Edexcel OCR WJECAQAAQA Edexcel OCR WJECAQA CCEA Edexcel WJECOCROCRWJECAQAAQAAQAOCROCROCRAQA Edexcel OCR WJECAQACCEA EdexcelCCEA EdexcelAQA OCR WJECAQA OCR WJECAQA OCR WJECAQA OCR WJECOCROCR220 <strong>UK</strong> QUALIFICATIONS
Appendix C – GCSE Subject AvailabilityTitleRussianRussian: Spoken Language (Short Course)Russian: Written Language (Short Course)ScienceScience AScience BScience B (Science in Context)Science: Single AwardScience: Double Award AScience: Double Award BScience: Double AwardSociologySociology (Short Course)SpanishSpanish: Spoken Language (Short Course)Spanish: Written Language (Short Course)StatisticsTechnology & DesignTurkishTurkish: Spoken Language (Short Course)Turkish: Written Language (Short Course)UrduUrdu: Spoken Language (Short Course)Urdu: Written Language (Short Course)Use of Mathematics (Pilot)Awarding BodyEdexcelEdexcelEdexcelCCEA Edexcel WJECAQA OCR WJECAQA OCR WJECAQACCEACCEACCEACCEAAQA OCR WJECAQA WJECAQA CCEA Edexcel OCR WJECAQA CCEA Edexcel OCRAQA CCEA Edexcel OCRAQA EdexcelCCEAOCROCROCRAQA EdexcelAQA EdexcelAQA EdexcelAQA<strong>UK</strong> QUALIFICATIONS 221
Appendix D – Discontinued GCSE Subjects (Last Examinations 2002)The following are the subjects for which the General Certificate of Secondary Education (GCSE) examinations were available forexamination until 2002.A GCSE Combined Subject Syllabus consists of two related constituent subjects, which provide the basis for a single award GCSE. Someawarding bodies offered more than one syllabus in certain subjects.Qualification Title Notes Awarding BodyAccountingWJECAdditional MathematicsCCEAAgriculture & HorticultureAQAArabicEdexcelArtAQA Edexcel OCR WJECArt: UnendorsedAQAArt: CeramicsEdexcelArt: Craft StudiesEdexcelArt: Critical & Historical StudiesEdexcelArt: Drawing & PaintingAQA Edexcel OCR WJECArt: GraphicsAQA Edexcel OCR WJECArt: PhotographyAQA Edexcel OCR WJECArt: PrintmakingEdexcelArt: SculptureEdexcelArt: TextilesAQA Edexcel OCR WJECArt: Three Dimensional DesignAQA Edexcel OCR WJECAstronomyEdexcelBengaliAQABiblical HebrewEdexcelBusiness Studies In association with NDTEF Edexcel OCRBusiness Studies & Economics Nuffield – BP EdexcelCommunication StudiesAQACritical Studies in Art & DesignEdexcelDesign & TechnologyAQA OCRDesign & Technology: Automotive StudiesOCRDesign & Technology: Electronic ProductsEdexcelDesign & Technology: Food TechnologyWJECDesign & Technology: Graphic ProductsWJECDesign & Technology: Resistant Materials TechnologyWJECDesign & Technology: Systems & Control TechnologyWJECDesign & Technology: Textiles TechnologyWJECDrama & Theatre ArtsAQAEconomicsEdexcel WJECEnglish (+ grade for Speaking and Listening) AQA CCEA Edexcel OCR WJECEnglish English Post-16 AQA EdexcelEnvironmental StudiesAQAGeography Syllabuses A & B AQA EdexcelGeography Syllabus B Joint Syllabus (Avery Hill) OCR WJECGeography Syllabus C (Bristol Project) OCRGerman Modular CCEA Edexcel OCR WJECGreek (Classical)AQA OCR WJECHealth StudiesOCRHistory Syllabus A AQA Edexcel WJECHistory Syllabus B AQA WJECHistory Syllabus C AQA Edexcel WJECHistory Syllabus E (Themes of British & World History) EdexcelHome EconomicsCCEAHome Economics: Consumer StudiesAQAHome Economics: TextilesOCRInformation StudiesEdexcel OCRInformation SystemsCCEAInformation TechnologyAQA Edexcel OCR WJECKeyboarding ApplicationsWJECLatin Syllabus B (School Classics Project) OCRMathematics Syllabuses A & B AQA CCEA Edexcel OCR WJECMathematics MEI OCRMathematics Modular AQAMathematics SMP 11-16 OCRMathematics SMP Graduated Assessment OCRMusicEdexcelNautical StudiesAQA222 <strong>UK</strong> QUALIFICATIONS
Appendix D – Discontinued GCSE Subjects (Last Examinations 2002)Qualification Title Notes Awarding BodyOffice ApplicationsAQAPhysical Education: GamesEdexcelPoliticsAQAReligious StudiesAQA OCR WJECReligious Studies Syllabus A OCRReligious Studies Syllabus B (Judaism) OCRScience: Double AwardAQAScience: Double Award Combined CCEA Edexcel WJECScience: Double Award Syllabus A Co-ordinated OCRScience: Double Award Syllabus B Suffolk OCRScience: Single AwardAQAScience: Single Award Combined CCEA Edexcel WJECScience: Single Award Syllabus A Co-ordinated OCRScience: Single Award Syllabus B Suffolk OCRScience: Single Award Syllabus C Salters OCRScience: BiologyAQA CCEA OCR WJECScience: Biology Syllabus A OCRScience: Biology Syllabus C Salters OCRScience: Biology Syllabus D Nuffield OCRScience: Biology – HumanAQAScience: ChemistryAQA CCEA OCR WJECScience: Chemistry Syllabus A OCRScience: Chemistry Syllabus C Salters OCRScience: Chemistry Syllabus D Nuffield OCRScience: ElectronicsWJECScience: GeologyWJECScience: Human, Physiology & HealthAQAScience: PhysicsAQA CCEA Edexcel OCR WJECScience: Physics Syllabus A OCRScience: Physics Syllabus C Salters OCRScience: Physics Syllabus D Nuffield OCRScience: RuralOCRSocial ScienceOCR WJECUrduAQA EdexcelWorld DevelopmentWJECGCSE COMBINED COURSEQualification Title Notes Awarding BodyDesign & Technology & ArtWJECDesign & Technology & Business StudiesWJECDesign & Technology & CateringWJECDesign & Technology & ElectronicsWJECDesign & Technology & Information TechnologyWJECDesign & Technology (Electronic Products) & Business StudiesAQA OCRDesign & Technology (Food Technology) & Business StudiesAQA OCRDesign & Technology (Graphic Products) & Business StudiesAQA Edexcel OCRDesign & Technology (Resistant Materials Technology) & Business StudiesAQA Edexcel OCRDesign & Technology (Textiles Technology) & Business StudiesAQA Edexcel OCRDesign & Technology (Systems Control) & Business StudiesEdexcelFrench & Business StudiesAQA Edexcel OCRGerman & Business StudiesAQA Edexcel OCRGeography & Business StudiesAQA OCRGeography & History Syllabus A Schools History Project OCRGeography & History Syllabus B Modern World OCRGeography & History Syllabus C (British Social & Economic) OCRInformation Technology & Business StudiesAQA Edexcel OCRSpanish & Business StudiesAQA Edexcel OCRGCSE SHORT COURSEQualification Title Notes Awarding BodyArtAQA OCRArt Modular EdexcelArt: Drawing & PaintingOCRArt: GraphicsOCRArt: PhotographyOCRArt: TextilesOCRArt: Three Dimensional StudiesOCRDesign & TechnologyAQA OCR WJECDesign & Technology: Electronic ProductsEdexcel<strong>UK</strong> QUALIFICATIONS 223
Appendix D – Discontinued GCSE Subjects (Last Examinations 2002)FrenchOCRGeographyAQA OCRGeography Syllabus B EdexcelGermanEdexcel OCRHistory Syllabus A AQA EdexcelHistory Syllabus B AQAHistory Syllabus C AQAHistory Syllabus C (British Social & Economic History) OCRHistory Syllabus D (Schools History Project) EdexcelHistory Syllabus E (Themes of British & World History) EdexcelInformation TechnologyAQA Edexcel OCR WJECMusicEdexcelPhysical Education: GamesEdexcelReligious Education Syllabuses A & B Edexcel OCR WJECReligious Education Syllabuses A & D AQASpanishCCEA224 <strong>UK</strong> QUALIFICATIONS
Appendix E – GCE Advanced Subsidiary/Advanced subject availability(first teaching September 2008, except for applied subjects, which were first taught in September 2005)No of UnitsSubjectAwarding BodyASDbleAwdASA Level9-UnitAwardDbleAwdA LevelAccounting AQA 2 4OCR 2 4Anthropology AQA 2 4Applied Art and Design AQA 3 6 6 9 12Edexcel 3 6 6 9 12OCR 3 6 6 12Applied Business AQA 3 6 6 9 12CCEA 3 6 6 12Edexcel 3 6 6 9 12OCR 3 6 6 12Applied Business (Pilot) WJEC 2 4 4 8Applied Information and Communication Technology AQA 3 6 6 9 12CCEA 3 6 6 12Edexcel 3 6 6 9 12OCR 3 6 6 12Applied Information and Communication Technology(Pilot)WJEC 2 4 4 8Applied Science AQA 3 6 6 9 12OCR 3 6 6 12Applied Science (Pilot) WJEC 3 6Arabic Edexcel 1 2Archaeology AQA 2 4Art and Design AQA 2 4CCEA 2 4Edexcel 2 4OCR 2 4WJEC 2 4Art and Design (Art, Craft and Design) AQA 2 4Edexcel 2 4WJEC 2 4Art and Design (Critical and Contextual Studies) Edexcel 2 4OCR 2 4WJEC 2 4Art and Design (Fine Art) AQA 2 4Edexcel 2 4OCR 2 4WJEC 2 4Art and Design (Graphic Communication) AQA 2 4Edexcel 2 4OCR 2 4WJEC 2 4Art and Design (Photography: Lens-based and LightbasedAQA 2 4Media)Edexcel 2 4OCR 2 4WJEC 2 4Art and Design (Textile Design) AQA 2 4Edexcel 2 4OCR 2 4WJEC 2 4Art and Design (Three-Dimensional Design) AQA 2 4Edexcel 2 4OCR 2 4WJEC 2 4Bengali AQA 1 2Biblical Hebrew OCR 1 2<strong>UK</strong> QUALIFICATIONS 225
Appendix E – GCE Advanced Subsidiary/Advanced subject availabilitySubjectAwarding BodyASDbleAwdASBiology AQA 3 6No of UnitsA LevelCCEA 3 6Edexcel 3 6OCR 3 6WJEC 3 6Biology (Human) AQA 3 6OCR 3 6WJEC 3 6Business Studies AQA 2 4CCEA 2 4Edexcel 2 4OCR 2 4WJEC 2 4Chemistry AQA 3 6CCEA 3 6Edexcel 3 6WJEC 3 6Chemistry A OCR 3 6Chemistry B OCR 3 6Chinese Edexcel 1 3Citizenship Studies AQA 2 4Classics OCR 2 4Classics (Ancient History) OCR 2 4Classical Civilisation AQA 2 4OCR 2 4Classics (Classical Greek) OCR 2 4Classics (Latin) OCR 2 4Communication and Culture AQA 2 4Computing AQA 3 4OCR 2 4WJEC 2 4Critical Thinking AQA 2 4OCR 2 4Cymraeg Ail Iaith WJEC 3 6Cymraeg Iaith Gyntaf WJEC 3 6Dance AQA 2 4Design and Technology: Food Technology AQA 2 4Edexcel 2 4WJEC 2 4Design and Technology: Product Design (3D Design) AQA 2 4Design and Technology: Product Design OCR 2 4WJEC 2 4Design and Technology: Product Design(Graphic Products)Edexcel 2 4Design and Technology: Product Design(Resistant Materials Technology)Edexcel 2 4Design and Technology: Product Design (Textiles) AQA 2 4Design and Technology: Systems and ControlAQA 2 4TechnologyWJEC 2 4Drama and Theatre Studies AQA 2 4Edexcel 2 4WJEC 2 4Dutch OCR 1 2Economics AQA 2 4CCEA 2 4Edexcel 2 4OCR 2 4WJEC 2 49-UnitAwardDbleAwdA Level226 <strong>UK</strong> QUALIFICATIONS
Appendix E – GCE Advanced Subsidiary/Advanced subject availabilitySubjectAwarding BodyASDbleAwdASNo of UnitsEconomics & Business Edexcel 2 4Electronics AQA 3 6A LevelOCR 3 6WJEC 3 6Engineering Edexcel 3 6English Language Edexcel 2 4OCR 2 4WJEC 2 4English Language A AQA 2 4English Language B AQA 2 4English Language and Literature Edexcel 2 4OCR 2 4WJEC 2 4English Language and Literature A AQA 2 4English Language and Literature B AQA 2 4English Literature CCEA 2 4Edexcel 2 4OCR 2 4WJEC 2 4English Literature A AQA 2 4English Literature B AQA 2 4Environmental Studies AQA 2 4Film Studies WJEC 2 4French AQA 2 4CCEA 2 4Edexcel 2 4OCR 2 4WJEC 2 4General Studies Edexcel 2 4OCR 2 4General Studies A AQA 2 4General Studies B AQA 2 4Geography AQA 2 4CCEA 2 4Edexcel 2 4OCR 2 4WJEC 2 4Geology OCR 3 6WJEC 3 6German AQA 2 4CCEA 2 4Edexcel 2 4OCR 2 4WJEC 2 4Global Development Edexcel 2Government and Politics AQA 2 49-UnitAwardDbleAwdA LevelCCEA 2 4Edexcel 2 4Edexcel 2 4WJEC 2 4Greek Edexcel 1 2Gujarati OCR 1 2Health and Social Care AQA 3 6 6 9 12CCEA 3 6 6 12Edexcel 3 6 6 9 12OCR 3 6 6 12Health and Social Care (Pilot) WJEC 2 4 4 8<strong>UK</strong> QUALIFICATIONS 227
Appendix E – GCE Advanced Subsidiary/Advanced subject availabilitySubjectAwarding BodyASDbleAwdASHistory AQA 2 4No of UnitsA LevelCCEA 2 4Edexcel 2 4WJEC 2 4History A OCR 2 4History B OCR 2 4History of Art AQA 2 4CCEA 2 4Home Economics CCEA 2 4Home Economics (Food, Nutrition and Health) OCR 2 4Humanities OCR 2 4Information and Communication Technology AQA 2 4CCEA 2 4OCR 2 4WJEC 2 4Irish CCEA 2 4Italian Edexcel 2 4Japanese Edexcel 1 2Law AQA 2 49-UnitAwardDbleAwdA LevelOCR 2 4WJEC 2 4Leisure Studies AQA 3 6 6 9 12Edexcel 3 6OCR 3 6Mathematics AQA 3 6CCEA 3 6Edexcel 3 6OCR 3 6WJEC 3 6Mathematics (MEI) OCR 3 6Mathematics (Pilot) OCR 2 4Further Mathematics AQA 3 6CCEA 3 6Edexcel 3 6OCR 3 6WJEC 3 6Further Mathematics (MEI) OCR 3 6Further Mathematics (Pilot) OCR 2 4Pure Mathematics AQA 3 6CCEA 3 6Edexcel 3 6OCR 3 6WJEC 3 6Pure Mathematics (MEI) OCR 3 6Use of Mathematics AQA 3Use of Mathematics (Pilot) AQA 3 6Media: Communication and Production Edexcel 3 6Media Studies AQA 2 4OCR 2 4WJEC 2 4228 <strong>UK</strong> QUALIFICATIONS
Appendix E – GCE Advanced Subsidiary/Advanced subject availabilitySubjectAwarding BodyASDbleAwdASModern Hebrew AQA 1 2Moving Image Arts CCEA 2 4Music AQA 3 6No of UnitsA LevelCCEA 2 4Edexcel 3 6OCR 3 6WJEC 3 6Music Technology Edexcel 2 4Panjabi AQA 1 2Performance Studies OCR 2 4Performing Arts Edexcel 3 6OCR 3 6Persian OCR 1 2Philosophy AQA 2 4Physical Education AQA 2 4Edexcel 2 4OCR 2 4WJEC 2 4Physics CCEA 3 6Edexcel 3 6WJEC 3 6Physics A AQA 3 6OCR 3 6Physics B: Physics in context AQA 3 6Physics B: Advancing Physics OCR 3 6Portuguese OCR 1 2Polish AQA 1 2Psychology Edexcel 2 4OCR 2 4WJEC 2 4Psychology A AQA 2 4Psychology B AQA 2 4Religious Studies AQA 2 4CCEA 2 4Edexcel 2 4OCR 2 4WJEC 2 4Russian Edexcel 2 4Science OCR 3Science in Society AQA 2 4Sociology AQA 2 4OCR 2 4WJEC 2 4Spanish AQA 2 49-UnitAwardDbleAwdA LevelCCEA 2 4Edexcel 2 4OCR 2 4WJEC 2 4Statistics AQA 3 6Statistics (MEI) OCR 3Technology and Design: Systems and Control CCEA 2 4Travel and Tourism AQA 3 6 6 9 12Edexcel 3 6 6 9 12OCR 3 6 6 12Travel and Tourism (Pilot) WJEC 2 4 4 8Turkish OCR 1 2Urdu Edexcel 2 4World Development WJEC 2 4<strong>UK</strong> QUALIFICATIONS 229
Appendix F – Advanced Extension Award Subject AvailabilityFirst examined in June 2002, the Advanced Extension Award was introduced to challenge high achieving learners and to differentiatebetween the top ten percent of students nationally. Following the changes made to GCE A levels in 2008, specifically the introduction ofthe A* grade and ‘stretch and challenge’, it was decided AEAs were no longer required. They were therefore withdrawn after the June2009 examinations.The exception to this is the Mathematics AEA offered by Edexcel, which will continue to be available until at least August 2015.The following is a list of the Advanced Extension Awards that were previously available for entry to HE. A single awarding organisationoffered the relevant examination on behalf of all the awarding organisations. Candidates did not have to enter for the corresponding A levelwith that awarding organisation.SubjectBiology and Biology (Human)BusinessChemistryCritical ThinkingEconomicsEnglishFrenchGeographyGermanHistoryIrishLatinMathematicsPhysicsPsychologyReligious StudiesSpanishWelshWelsh Second LanguageAwarding BodyAQAOCRAQAOCRAQAOCROCRWJECCCEAEdexcelCCEAOCREdexcelCCEAAQAEdexcelEdexcelWJECWJEC230 <strong>UK</strong> QUALIFICATIONS
Appendix G – AVCE/ASVCE/AVCE Double Award Subject AvailabilityThe following is a list of the Advanced Vocational Certificate of Education (AVCE) qualifications which were available for first teaching fromSeptember 2000 (six- and 12-unit awards). First awarded in 2001 for the six-unit AVCE and in 2002 for the 12-unit AVCE, AVCEs havebeen replaced by A levels and AS in applied subjects for first teaching from September 2005. Final teaching of two-year AVCEqualifications began September 2004, and one-year AVCE qualifications began September 2005. Last resits for AVCE qualifications wereheld in January 2007.Title ASVCE AVCE AVCE Double AwardArt & Design 8 4 4Business 4 4 4Construction & the Built Environment 8 4 4Engineering 4 4 4Health & Social Care 4 4 4Hospitality & Catering 8 4 4Information & Communication Technology 4 4 4Leisure & Recreation 8 4 4Manufacturing 8 4 4Media: Communication & Production 8 4 4Performing Arts 8 4 4Retail & Distributive Services 8 4 8Science 8 4 4Travel & Tourism 8 4 4<strong>UK</strong> QUALIFICATIONS 231
Appendix H – Additional Admissions TestsAdditional Admissions Testscurrently in use for progressionto HE in the United KingdomBIOMEDICAL ADMISSIONS TEST (BMAT)Used for entry to Medicine and Veterinary SchoolEntry method: via Cambridge AssessmentEntry deadline: 1 October 2012Test date: 7 November 2012Duration of test: 2 hoursResults available: 21 November 2012Further information: www.bmat.org.ukGRADUATE MEDICAL SCHOOL ADMISSIONS TEST(GAMSAT)Used for graduate entry to MedicineEntry method: online via www.gamsatuk.orgEntry deadline: 10 August 2012Test date: 21 September 2012Duration of test: 5 1 /2 hoursResults available: approximately 8 weeks after test dateFurther information: www.gamsatuk.orgHEALTH PROFESSIONS ADMISSION TEST (HPAT)Used for entry into Health Professions courses at the Universityof UlsterEntry method: online via HPAT website www.hpat.org.uk/Entry deadline: January <strong>2013</strong>Test date: January/February <strong>2013</strong>Duration of test: 3 hoursFurther information: www.hpat.org.ukHISTORY APTITUDE TEST (HAT)Used for entry into all courses that include History at OxfordUniversityEntry method: online via Cambridge Assessmentwww.hatoxford.org.ukEntry deadline: 15 October 2012Test date: 7 November 2012Duration of test: 2 hoursFurther information: www.hatoxford.ac.ukTHE NATIONAL ADMISSIONS TEST FOR LAW (LNAT)Used for entry to Law for the following universities: University ofBirmingham, University of Bristol, Durham University, University ofGlasgow, King’s College, London, University of Nottingham,University of Oxford, University College, LondonEntry method: registration and test booking via LNAT websitewww.lnat.ac.ukRegistration for test starts: August 2012Test starts: September 2012Entry deadlines: Oxford University – October 2012; on-timeapplications to other LNAT universities – January <strong>2013</strong>; lateapplications to other LNAT universities – June <strong>2013</strong>Test date: Oxford applicants – October 2012; other on-timeapplicants – January <strong>2013</strong>; other late applicants – June <strong>2013</strong>Duration of test: 2 1 /4 hoursFurther information: www.lnat.ac.ukSIXTH TERM EXAMINATION PAPERS (STEP)Used for entry to Mathematics at the University of Cambridge andUniversity of WarwickEntry method: via applicant’s school or college, or test centreadministering the STEPEntry deadline: 30 April 2012Test date: 18, 20 and 27 June 2012Duration of test: 3 hours per paperResults available: 16 August 2012Further information:www.admissionstests.cambridgeassessment.org.uk/adtTHINKING SKILLS ASSESSMENT (TSA)Used for entry mainly to Computer Science, Natural Sciences,Philosophy, Psychology, Engineering and Economics at theUniversity of Cambridge and University of OxfordEntry method: the University of Cambridge will inform applicantsof all admission requirements. Applicants to the University ofOxford must be entered by their school, college or test centre.Entry deadline: University of Oxford: 15 October 2012. Universityof Cambridge: N/ATest date: University of Oxford: 7 November 2012. University ofCambridge: at interviewDuration of test: University of Oxford: 2 hours. University ofCambridge: 90 minutesFurther information:www.admissionstests.cambridgeassessment.org.uk/adt<strong>UK</strong> CLINICAL APTITUDE TEST (<strong>UK</strong>CAT)Used for entry to Medical and Dental SchoolsEntry method: via <strong>UK</strong>CAT websiteEntry deadline: 21 September 2012Test dates: 3 July 2012 – 5 October 2012Duration of test: 2 hoursFurther information: www.ukcat.ac.uk232 <strong>UK</strong> QUALIFICATIONS
Appendix I – English Language ProficiencyIn the case of a candidate whose mother tongue is other thanEnglish, the following may be acceptable as evidence ofproficiency in English. See also the <strong>UK</strong> Border Agency’s website(www.ukba.homeoffice.gov.uk) for information on Englishlanguage requirements for applicants who require a visa.ANGLIA EXAMINATION SYNDICATEggAcCEPT Proficiency is the Ascentis Anglia ESOL InternationalProficiency level assessment designed for non-native Englishspeakers requiring English for higher education. It ismanaged by Ascentis and Anglia Examinations.For information on the mapping of the qualification to theCEFR (Common European Framework of Reference), pleasesee www.anglia.org/institutions/CEFR/7006BRITISH INSTITUTES CERTIFICATESgBritish Institutes examinations test the following competencesin the English language: reading, free writing, listening,speaking and use of English at every level set out in theCEFR.gUniversities may accept the following certificates for entry:cESOL B2 VantagecESOL C1 Effective ProficiencycESOL C2 Mastery.gFor further information please visit www.britishinstitutes.orgCAMBRIDGE ESOL EXAMINATIONSCambridge English exams are accepted by almost all <strong>UK</strong>universities and colleges as proof of English language skills. Theyare also accepted by the <strong>UK</strong> Border Agency for Tier 4 studentvisas. They can be taken in over 2,700 centres in over 130countries. To find your nearest centre visit:www.CambridgeESOL.org/CentresVarious tests are offered:gCambridge English: Advanced, commonly known as theCertificate in Advanced English - CAE (NQF Level 2) (SeeUCAS Tariff)gCambridge English: Proficiency, commonly known as theCertificate of Proficiency in English - CPE, (NQF Level 3) (seeUCAS Tariff)gCambridge English: First, commonly known as the FirstCertificate in English – FCE, (NQF Level 1)gCambridge English: Business Certificates Higher, commonlyknown as Business English Certificate Higher - BEC H (NQFLevel 2)gCambridge English: Business Certificates Vantage, commonlyknown as Business English Certificate Vantage - BEC V (NQFLevel 1)gESOL Skills for Life Level 2 (NQF Level 2).For more information visit: www.CambridgeESOL.orgCAMBRIDGE INTERNATIONAL EXAMINATIONS (CIE)gGCE O level English Language (Syllabus numbers 1119,1120, 1123, 1124, 1125 and 1126) – grade C or bettergIGCSE English as a Second Language (Syllabus numbers0510, 0511 and 0526) – grade C or bettergIGCSE First Language English (Syllabus numbers 0500,0522, 0524 and 0561) – grade C or better.UNIVERSITY OF CENTRAL LANCASHIRE ENGLISHLANGUAGE EXAMINATIONSExaminations have reading, writing, listening, speaking and use ofEnglish components graded separately from the overall grade onthe transcript. Each examination is graded pass, merit ordistinction.gCertificate in English (Council of Europe Level B1) Level 2 -Independent UsergCertificate in English (Council of Europe Level B2) Level 2 -Independent User- pass or above sufficient for someundergraduate programmesgCertificate in English (Council of Europe Level C1) Level 3 -Proficient User - pass or above sufficient for mostundergraduate programmes and some postgraduateprogrammesgCertificate of Proficiency in English (Council of Europe LevelC2) Level 3 - Proficient User - pass or above sufficient formost postgraduate programmes.CERTIFICATE IN ESOL SKILLS FOR LIFEOffered by ASCENTIS Cambridge ESOL, City and Guilds, Edexcel,Education Development International plc, English Speaking Board,Learning Resource Network, National Open College Network andTrinity College London. The levels are set to equivalent NQFlevels.CITY AND GUILDSgEnglish for Office Skills – CEFR B2 and C1gInternational ESOL – CEFR A1–C2gInternational Spoken ESOL – CEFR A1–C2.EDEXCELgLevel 1/Level 2 Certificate in English Language – grade C orbettergIGCSE English as a Second Language – grade C or bettergIGCSE English Language – grade C or bettergGCSE English Language – grade C or better.EDUCATION DEVELOPMENT INTERNATIONAL (EDI)CERTIFICATES IN ENGLISH LANGUAGE SKILLS (ESOL)gEDI Entry 1 Certificate in ESOL International (JETSET Level 2)gEDI Entry 2 Certificate in ESOL International (JETSET Level 3)gEDI Entry 3 Certificate in ESOL International (JETSET Level 4)gEDI Level 1 Certificate in ESOL International (JETSET Level 5)gEDI Level 2 Certificate in ESOL International (JETSET Level 6)gEDI Level 3 Certificate in ESOL International (JETSET Level 7)ENGLISH SPEAKING BOARDgESB Entry Level Certificate in EFL Entry 1 (ESOL)gESB Entry Level Certificate in EFL Entry 2 (ESOL)gESB Entry Level Certificate in EFL Entry 3 (ESOL)gESB Level 1 Certificate in EFL (ESOL)gESB Level 2 Certificate in EFL (ESOL)gESB Level 3 Certificate in EFL (ESOL)HONG KONG EXAMINATIONS AND ASSESSMENTAUTHORITYgHong Kong Advanced Level Examination: Use of English –Grade E or bettergHong Kong Advanced Supplementary Level Examination: Useof English – Grade E or bettergHong Kong Certificate of Education (HKCEE) prior to 2007:English Language (Syllabus B) – Grade C or better. 2007onwards: English Language Level 3 or bettergHong Kong Diploma of Secondary Education (HKDSE) –English Language (see UCAS Tariff).<strong>UK</strong> QUALIFICATIONS 233
Appendix I– English Language ProficiencyINTERNATIONAL ENGLISH LANGUAGE TESTING SYSTEM(IELTS)IELTS is accepted by over 7,000 institutions worldwide, and isoffered in over 500 test centres up to four times a month. IELTSassesses all English language skills: reading, writing, listeningand speaking. The speaking module is assessed in a face-to-faceconversational interview with a qualified examiner.Candidates receive an IELTS Test Report Form which details theirtest scores. IELTS scores are given in bands from 1 - 9, includinghalf bands. Most universities and colleges in the <strong>UK</strong> will requirebetween bands 5.0 to 7.5, depending on the content of thecourse. IELTS Test Report Forms have a recommended validity oftwo years and can be verified by the institution receiving them viaa secure online service.IELTS is jointly managed by British Council, IDP: IELTS Australiaand the University of Cambridge ESOL Examinations. To find a listof test centres, which institutions are recognising the test and forgeneral information go to: www.ielts.org.LONDON CHAMBER OF COMMERCE AND INDUSTRYINTERNATIONAL QUALIFICATIONS (LCCI)gEnglish for Business (EFB) – Pass at level 3gEnglish for Commerce (EFC) – Pass at level 3gEnglish Language Skills Assessment (ELSA).MALAYSIAN UNIVERSITY ENGLISH TEST (MUET)For further information, please contact:Malaysian Examinations CouncilPersiaran 1Bandar Baru Selayang, 68100 Batu Caves,Selangor Darul Ehsan, Malaysiat: +60 (0)3 6136 9663 f: +60 (0)3 6136 1488e: ppa@mpm.edu.my w: www.mpm.edu.myMICHIGAN ENGLISH LANGUAGE ASSESSMENT BATTERY(MELAB)A score of 80 or above for admission to higher education in the<strong>UK</strong>, and 90 or above should be required for programmes withhigh literary content.THE PASSWORD TESTPassword is an online English language test designed forstudents preparing for academic study. It is most suitablefor students joining international foundation programmes,pre-sessional courses, pre-master’s programmes and courses inEnglish for academic purposes. Password is also used to pre-teststudents joining undergraduates and postgraduates programmes.The test is aligned to the CEFR and discriminates between CEFRlevel A2 to C1. Password takes one hour to complete, is securelydelivered online, and gives instant test results.The test is available throughout the year at secure test deliverycentres around the world. Scores are available online typicallywithin five business days and students can prepare using officialPTE Academic practice tests. Most institutions will require a PTEAcademic score in the range of 50-64. Some institutions may lista higher or lower score depending on the course.Further information is available at www.pearsonpte.com/testme.TRINITY COLLEGE LONDONGraded Examinations in Spoken English (GESE):gGrades 4-6 (Elementary) (NQF level Entry 2-Entry 3)gGrades 7-9 (Intermediate) (NQF level 1)gGrades 10-12 (Advanced) (NQF level 2-3).Integrated Skills in English (ISE):gISE II (NQF Level 1)gISE III (NQF Level 2)gISE IV (NQF Level 3).TEST OF ENGLISH AS A FOREIGN LANGUAGE (TOEFL)The TOEFL is offered in internet-based (iBT) and paper-based(PBT) formats. Please visit www.ets.org/toefl/locations to locateyour nearest test centre.The TOEFL iBT consists of four sections: Reading, Listening,Speaking and Writing, and the entire test is four hours long.Score are split into the four sections and an overall score isprovided.The test is recognised and accepted in over 8,500 institutionsglobally. View the complete list of universities and colleges thataccept TOEFL at www.ets.org/toefl/ukdirectory. Each institutionwill list their TOEFL score requirements on their website andthese may vary.In the paper-based test, a score of 550 or above (600 or above isrecommended for degrees with a literary content) is usuallyrequired. Comparable scores for the computer-based test are213 or above, and 250 and above. Comparable scores for theinternet-based test are 79 or above, and 100 and above.UNIVERSITY OF READINGTest in English for Educational Purposes (TEEP) – Reading,Listening and Writing reported on the performance certificate,both as independent scores and as an overall composite score.An additional Language Knowledge paper is expressed as‘average’, ‘above average’ or ‘below average’ and used to adjustthe overall grade in borerline cases. Minimal acceptance levelsfor joining academic courses usually vary from 5.0 to 7.5 overall.Further information, including the location of Password testcentres is available at: www.englishlanguagetesting.co.uk.PEARSON LANGUAGE TESTSPearson Test of English General (PTE General): consisting oftwo parts: a written paper and an oral exam. The written papertests listening, reading, comprehension and writing skills. Bothparts are externally assessed. Universities and colleges mayaccept Level 3 (Council of Europe Level B2), Level 4 (Council ofEurope Level C1) or Level 5 (Council of Europe Level C2) for entryat an undergraduate or postgraduate level.Pearson Test of English Academic (PTE Academic): Acomputer-based test of international academic Englishrecognised by over 2,500 programs worldwide includinghundreds of universities around the <strong>UK</strong>. Test takers receive anoverall score and sub-scores for reading, writing, speaking, andlistening.234 <strong>UK</strong> QUALIFICATIONS
Appendix J – National Courses available in Scotland(Intermediate to Advanced Higher Level)This is a list of current National Courses available. It does not include courses which have been, or are in the process of being, removed.For more information on National Courses, see www.sqa.org.ukTitle Intermediate 1 Intermediate 2 Higher Advanced HigherAccounting 4 4 4 4Administration 4 4 4 8Applied Mathematics: Mechanics 8 8 8 4Applied Mathematics: Statistics 8 8 8 4Applied Practical Electronics 4 8 8 8Architectural Technology 8 8 4 8Art and Design 4 4 4 8Art and Design: Design 8 8 8 4Art and Design: Expressive 8 8 8 4Automotive Skills 4 8 8 8Beauty 8 8 4 8Biology 4 4 4 4Biology (Revised) 8 8 4 8Biotechnology 8 4 4 8Building Construction 8 8 4 8Building Services Engineering 4 8 8 8Business Management 4 4 4 4Cantonese 4 4 4 4Care 4 4 4 8Care Issues for Society: Child Care 8 4 8 8Care Issues for Society: Older People 8 4 8 8Care Practice 8 8 4 8Chemistry 4 4 4 4Chemistry (Revised) 8 8 4 4Classical Greek 4 4 4 4Classical Studies 4 4 4 4Computing 8 4 4 4Computing Studies 4 8 8 8Construction Crafts 4 4 8 8Creative Cake Production 8 4 8 8Creative Digital Media 4 8 8 8Creative Industries 8 4 8 8Dance Practice 8 8 4 8Drama 4 4 4 4Early Education and Childcare 4 4 4 8Economics 8 4 4 4Electrical Installations Fundamentals 8 4 8 8Electronic and Electrical Fundamentals 8 4 8 8Energy 8 4 8 8Engineering Craft Skills 4 4 8 8Engineering Skills 4 4 8 8English 4 4 4 4English for Speakers of Other Languages (ESOL) 8 4 4 8Fabrication and Welding Engineering 8 8 4 8Financial Services 8 4 8 8French 4 4 4 4Gaelic (Learners) 4 4 4 4Gàidhlig 4 4 4 4Geography 4 4 4 4Geology 4 4 4 8German 4 4 4 4Graphic Communication 4 4 4 4Hairdressing 4 4 8 8Health and Safety in Care Settings 8 4 8 8Health and Social Care 8 8 4 8Health Sector 4 4 8 8History 4 4 4 4Home Economics – Fashion and Textile Technology 4 4 4 8Home Economics – Health and Food Technology 4 4 4 4Home Economics – Lifestyle and Consumer Technology 4 4 4 8Hospitality 4 4 8 8Hospitality – General Operations 8 4 8 8<strong>UK</strong> QUALIFICATIONS 235
Appendix J – National Courses available in Scotland (Intermediate to Advanced Higher Level)Title Intermediate 1 Intermediate 2 Higher Advanced HigherHospitality – Practical Cookery 4 4 8 8Hospitality – Professional Cookery 8 4 4 8Human Biology 8 8 4 8Human Biology (Revised) 8 8 4 8Information Systems 8 4 4 4Italian 4 4 4 4Laboratory Science 8 4 8 8Latin 4 4 4 4Managing Environmental Resources 4 4 4 8Mandarin (simplified) 4 4 4 4Mandarin (traditional) 4 4 4 4Maritime Skills 8 4 8 8Mathematics: Maths 1, 2 and 3 4 4 4 4Mathematics: Maths 1, 2 and Applications 4 4 8 8Mechatronics 8 8 4 8Media Studies 4 4 4 8Mental Health Care 8 8 4 8Modern Studies 4 4 4 4Music Performing 4 4 4 4Music Performing with Technology 4 4 4 4Personal Development 4 4 4 8Philosophy 8 4 4 8Photography 8 8 4 8Physical Education 4 4 4 4Physics 4 4 4 4Physics (Revised) 8 8 4 4Play in Early Eduation and Childcare 8 8 4 8Politics 8 8 4 8Product Design 8 4 4 4Psychology 4 4 4 8Religious, Moral and Philosophical Studies 4 4 4 4Retailing 8 4 8 8Retail Travel 8 8 4 8Rural Skills 4 8 8 8Russian 4 4 4 8Selling Overseas Tourist Destinations 8 4 8 8Sociology 8 4 4 8Spanish 4 4 4 4Sport and Recreation 4 4 8 8Technological Studies 8 4 4 4Travel and Tourism 4 4 4 8Uniformed and Emergency Services 4 8 8 8Urdu 8 8 4 8Woodworking Skills 4 4 8 8236 <strong>UK</strong> QUALIFICATIONS
Appendix K – National Qualification Group Awards (Scotland)NATIONAL QUALIFICATIONS GROUP AWARDS (SCOTLAND) AVAILABLE TO CENTRES NOW:Title Type of NQGA LevelAccounting National Certificate 5Achieving Excellence in Sport National Progression Award 6Acting and Performance National Progression Award 6Acting and Theatre Performance National Certificate 6A ctivity Tourism National Certificate 6A ctivity Tourism National Progression Award 4Administration National Certificate 5Administration: Information Technology and Audio National Progression Award 5Administration: Medical (Administrative Secretary) National Progression Award 5Administration: Medical (Receptionist) National Progression Award 5Administration: Office Skills and Services National Progression Award 5Advertising and Public Relations National Certificate 6Aeronautical Engineering National Certificate 6Animal Care National Certificate 5Animal Technology National Progression Award 6Applied Sciences National Certificate 5Applied Sciences National Certificate 6Aquaculture National Progression Award 4Aquaculture National Progression Award 5Army Preparation National Certificate 4Art and Design: Digital Media National Progression Award 5Art and Design: Digital Media National Progression Award 6Art and Design National Certificate 6Bakery National Certificate 5Bakery National Progression Award 4Beauty and Digital Communication National Progression Award 4Beauty Care National Certificate 6Beauty Care and Make up National Certificate 5Building Services Engineering National Certificate 6Building Services Engineering National Progression Award 5Built Environment National Certificate 6Business National Certificate 5Business National Certificate 4Business and Marketing National Progression Award 4Business and Marketing National Progression Award 5Business Improvement Techniques National Progression Award 5Business with IT National Progression Award 5Business with IT National Progression Award 6Child, Health and Social Care National Certificate 5Civil Engineering National Certificate 6Computer Aided Design & Technology National Certificate 6Computer Arts and Animation National Certificate 5Computer Arts and Animation National Certificate 6Computer Games Development National Certificate 5Computer Games Development National Progression Award 5Computer Games Development National Progression Award 6Computers and Digital Photography National Progression Award 5Computer Networks and Systems National Progression Award 5Computer Technical Support National Certificate 5Computer Technical Support National Certificate 6Conservation of Masonry National Progression Award 6Construction National Progression Award 5Construction Operations National Progression Award 5Contemporary Gaelic Songwriting and Production National Progression Award 5Cosmetology National Progression Award 4Countryside Management National Certificate 5Creative Beauty National Progression Award 4Creative Facial Techniques and Digital Media National Progression Award 4Creative Printmaking with Photography National Certificate 6Crofting National Progression Award 5Dance National Progression Award 5Dealing with Solvent Emissions in Dry Cleaning National Progression Award 6Digital Literacy National Progression Award 3Digital Media Animation National Progression Award 5<strong>UK</strong> QUALIFICATIONS 237
Appendix K – National Qualification Group Awards (Scotland) available to centres nowTitle Type of NQGA LevelDigital Media Basics National Progression Award 4Digital Media Computing National Certificate 4Digital Media Computing National Certificate 5Digital Media Computing National Certificate 6Digital Media Editing National Progression Award 5Digital Media Production National Progression Award 6Digital Production Skills National Progression Award 5Doing Businness Online National Progression Award 5Early Education and Childcare National Certificate 6Electrical Engineering National Certificate 5Electrical Engineering National Certificate 6Electronic Engineering National Certificate 5Electronic Engineering National Certificate 6Employability and Citizenship National Certificate 3Engineering Practice National Certificate 5Engineering Systems National Certificate 5Engineering Systems National Certificate 6Enterprise and Business National Progression Award 6Enterprise and Employability National Progression Award 5Enterprise and Employability National Progression Award 5Events Coordination National Certificate 5Exercise and Fitness Leadership National Progression Award 6Fabrication and Welding National Certificate 5Fabrication and Welding National Certificate 6Fashion, Design and Manufacture National Certificate 6Financial Services National Progression Award 6Fish Health and Nutrition National Progression Award 5Fish Husbandry National Progression Award 5Fitted Interiors National Progression Award 5Food Safety Logistics National Progression Award 5Formwork National Progression Award 5Gamekeeping National Certificate 5Geographical Information Systems: An Introduction National Progression Award 6Greenkeeping National Certificate 5Hairdressing National Certificate 5Hairdressing National Certificate 6Harris Tweed National Progression Award 5Health and Social Care National Certificate 6Horse Care National Certificate 5Hospitality National Certificate 4Hospitality National Certificate 5Insulation and Building Treatments National Progression Award 5Interior Systems National Progression Award 5Internet Technology National Progression Award 4Internet Technology National Progression Award 5Journalism National Progression Award 6Laboratory Science National Progression Award 6Land-based Engineering National Certificate 6Make - Up Artistry National Certificate 6Manufacturing Engineering National Certificate 5Manufacturing Engineering National Certificate 6Measurement and Control Engineering National Certificate 6Mechanical Engineering National Certificate 6Mechanical Maintenance Engineering National Certificate 5Media National Certificate 6Model Making: TV and Film National Certificate 6Music National Certificate 6Music Business National Progression Award 6Music Performing National Progression Award 6Musical Theatre National Progression Award 6Organising Volunteering Events in Sport National Progression Award 6PC Passport: Advanced National Progression Award 6PC Passport: Beginner National Progression Award 4PC Passport: Intermediate National Progression Award 5Pharmacy Services National Certificate 6Photography National Certificate 6Plant Maintenance and Repair National Progression Award 5Plant Operations National Progression Award 5Play in a Sports Environment National Progression Award 6Playwork and Childcare National Progression Award 5Professional Cookery National Certificate 5238 <strong>UK</strong> QUALIFICATIONS
Appendix K – National Qualification Group Awards (Scotland) available to centres nowTitle Type of NQGA LevelProfessional Cookery National Certificate 6Professional Theatre Preparation National Progression Award 6Radio Broadcasting National Progression Award 5Roadbuilding National Progression Award 5Roads Maintenance National Progression Award 5Rural Skills National Certificate 4Rural Skills National Progression Award 5Safe Operation of Continuous Batch Washers National Progression Award 6Scottish Bagpipes National Progression Award 2Scottish Bagpipes National Progression Award 3Scottish Bagpipes National Progression Award 4Scottish Bagpipes National Progression Award 5Scottish Bagpipes National Progression Award 6Scottish Pipe Band Drumming National Progression Award 3Scottish Pipe Band Drumming National Progression Award 4Scottish Pipe Band Drumming National Progression Award 5Scottish Pipe Band Drumming National Progression Award 6Screen Printing National Certificate 5Shipping and Maritime Operations National Certificate 6Social Software National Progression Award 4Software Development National Progression Award 4Sound Production National Certificate 6Sound Production: Live National Progression Award 6Sound Production: Recording National Progression Award 6Sport and Fitness National Certificate 5Sport and Fitness: Individual Sports National Progression Award 5Sport and Fitness: Outdoor Sports National Progression Award 5Sport and Fitness: Team Sports National Progression Award 5Sporting Events: Personal Best National Progression Award 4Sports Coaching: Angling National Progression Award 5Sports Coaching: Athletics National Progression Award 6Sports Coaching: Athletics National Progression Award 4Sports Coaching: Athletics National Progression Award 5Sports Coaching: Badminton National Progression Award 6Sports Coaching: Badminton National Progression Award 4Sports Coaching: Badminton National Progression Award 5Sports Coaching: Basketball National Progression Award 6Sports Coaching: Basketball National Progression Award 4Sports Coaching: Basketball National Progression Award 5Sports Coaching: Bowling National Progression Award 4Sports Coaching: Bowling National Progression Award 5Sports Coaching: Canoeing National Progression Award 6Sports Coaching: Canoeing National Progression Award 4Sports Coaching: Canoeing National Progression Award 5Sports Coaching: Cricket National Progression Award 6Sports Coaching: Cricket National Progression Award 4Sports Coaching: Cricket National Progression Award 5Sports Coaching: Curling National Progression Award 4Sports Coaching: Curling National Progression Award 5Sports Coaching: Curling National Progression Award 6Sports Coaching: Cycling National Progression Award 4Sports Coaching: Cycling National Progression Award 5Sports Coaching: Dance Sport National Progression Award 4Sports Coaching: Dance Sport National Progression Award 5Sports Coaching: Diving National Progression Award 4Sports Coaching: Diving National Progression Award 5Sports Coaching: Equestrian National Progression Award 6Sports Coaching: Equestrian National Progression Award 4Sports Coaching: Equestrian National Progression Award 5Sports Coaching: Football National Progression Award 6Sports Coaching: Football National Progression Award 4Sports Coaching: Football National Progression Award 5Sports Coaching: Golf National Progression Award 4Sports Coaching: Golf National Progression Award 5Sports Coaching: Gymnastics National Progression Award 6Sports Coaching: Gymnastics National Progression Award 4Sports Coaching: Gymnastics National Progression Award 5Sports Coaching: Hockey National Progression Award 6Sports Coaching: Hockey National Progression Award 4Sports Coaching: Hockey National Progression Award 5Sports Coaching: Judo National Progression Award 4<strong>UK</strong> QUALIFICATIONS 239
Appendix K – National Qualification Group Awards (Scotland) available to centres nowTitle Type of NQGA LevelSports Coaching: Judo National Progression Award 5Sports Coaching: Modern Pentatholon National Progression Award 4Sports Coaching: Modern Pentatholon National Progression Award 5Sports Coaching: Mountaineering National Progression Award 4Sports Coaching: Mountaineering National Progression Award 5Sports Coaching: Netball National Progression Award 6Sports Coaching: Netball National Progression Award 4Sports Coaching: Netball National Progression Award 5Sports Coaching: Orienteering National Progression Award 4Sports Coaching: Rowing National Progression Award 6Sports Coaching: Rowing National Progression Award 5Sports Coaching: Rugby League National Progression Award 4Sports Coaching: Rugby League National Progression Award 5Sports Coaching: Rugby Union National Progression Award 6Sports Coaching: Rugby Union National Progression Award 4Sports Coaching: Rugby Union National Progression Award 5Sports Coaching: Shooting National Progression Award 4Sports Coaching: Shooting National Progression Award 5Sports Coaching: Squash National Progression Award 6Sports Coaching: Squash National Progression Award 4Sports Coaching: Squash National Progression Award 5Sports Coaching: Swimming National Progression Award 6Sports Coaching: Swimming National Progression Award 4Sports Coaching: Swimming National Progression Award 5Sports Coaching: Synchronised Swimming National Progression Award 4Sports Coaching: Synchronised Swimming National Progression Award 5Sports Coaching: Table Tennis National Progression Award 6Sports Coaching: Table Tennis National Progression Award 4Sports Coaching: Table Tennis National Progression Award 5Sports Coaching: Tae Kwon Do National Progression Award 4Sports Coaching: Tae Kwon Do National Progression Award 5Sports Coaching: Tennis National Progression Award 6Sports Coaching: Tennis National Progression Award 4Sports Coaching: Tennis National Progression Award 5Sports Coaching: Triathlon National Progression Award 4Sports Coaching: Triathlon National Progression Award 5Sports Coaching: Volleyball National Progression Award 4Sports Coaching: Water Polo National Progression Award 4Sports Coaching: Water Polo National Progression Award 5Sports Coaching: Weightlifting National Progression Award 4Sports Coaching: Weightlifting National Progression Award 5Sports Development National Progression Award 6Stringed Musical Instrument Making and Repair National Certificate 5Supply Chain Operations National Progression Award 5Technical Theatre National Certificate 6Technical Theatre in Practice National Progression Award 6Television Production National Progression Award 5Travel and Tourism National Certificate 5Travel and Tourism National Certificate 6Water Operations National Progression Award 6Water Operations: An Introduction National Progression Award 5Web Design Fundamentals National Progression Award 5Website Enterprise National Progression Award 5Wellness Therapies National Certificate 6Working with Asylum Seekers and Refugees National Progression Award 5Working with Communities National Certificate 6240 <strong>UK</strong> QUALIFICATIONS
UCAS is the organisation responsible for managingapplications to higher education courses in the <strong>UK</strong>.Choosing what and where to study are very importantdecisions and UCAS is committed to supportingapplicants and their advisers.Every year we help over 600,000 applicants apply touniversity or college in the <strong>UK</strong>.<strong>UK</strong> <strong>Qualifications</strong> <strong>2013</strong>