View Program Guide - The Leadership Alliance

The Leadership Alliance National Symposium 2013Cultivating Excellenceand Empowering Great MindsFloor Plans.......................................................................................................... 2Symposium At-A-Glance................................................................................. 5Agenda................................................................................................................ 6Keynote Speaker.............................................................................................. 11Oral Presentations by TIME.......................................................................... 12Oral Presentations by ROOM........................................................................ 23Oral Presentations by NAME........................................................................ 33Poster Presentations by NUMBER................................................................ 57Poster Presentations by NAME..................................................................... 61New Doctoral Scholars................................................................................... 72Doctoral Scholar Participants........................................................................ 74Faculty, Administrators, and Other Participants........................................ 75Graduate Student Participants....................................................................... 79Novartis Institutes for BioMedical Research Students............................... 80Undergraduate Participants........................................................................... 80Who’s Who at the Symposium....................................................................... 90Leadership Alliance Executive Office Staff................................................. 104Presentation Categories KeyAB Applied Biosciences, Molecular Processes and Genetics, BiochemistryBB Basic Biosciences, Human Biology & Disease, Public Health, Biomedical EngineeringEN Engineering, Mechanical, Electrical & Materials EngineeringES Earth Science, Environment Sciences, Geosciences, Marine SciencesHU Humanities, Literature, Language Arts, History, MediaPE Policy & Ethics, Politics, Policy & Legislation, Ethics, Philosophy & ReasoningPS Physical Science, Chemistry, Math, Physics, Computer Sciences, Computer EngineeringSS Social Science, Sociology, Economics, Psychology, and Behavior Sciences

2 | Hilton Floor Plan - Conference & Events RoomsGIFT SHOPFRONT DESKCONCIERGEPRIVATEDININGSENSESRESTAURANTBARHOTELENTRANCEJRP.D.R.LOBBYLEVELBRIDALGARDENWILLOWWILLOWTERRACEPOOL

Cultivating Excellence and Empowering Great Minds | 3GLENBROOKHIGHRIDGELONGRIDGEWESTOVERBREAKAREAIIISPRINGDALEMEZZANINELEVELTHEGARDENPAVILIONCOVEIIIBUSINESSCENTERBELLTOWNIIIIIIWATERSIDECONFERENCEROOMSOAKBOARDROOMPRE-FUNCTIONGRAND BALLROOM FOYERGRAND BALLROOMIIIBRIDALGARDENPOOLHEALTHCLUBALDER LINDENFOYERGLEN FOYERELM ASPENGLENI II I II III II ITHE GROVE FOYERTHE GROVEIIIIII

Leadership Alliance National SymposiumJuly 26-­‐28, 2013Symposium At-A-GlanceAt-­‐A-­‐GlanceTimeGeneral SessionsUndergraduate SessionsGraduate SessionsDoctoral ScholarsCoordinators, Mentors, Guests, Administrators11:00am -­‐ 3:00pm11:00am -­‐ 3:00pm12:00pm -­‐ 2:30pm 2:00pm-­‐3:00pm3:00pm -­‐4:15pmDay 1 -­‐ Orientation, Networking & Alumni Career PanelRegistration PowerPoint Presentation Upload IFunding Sessions by Discipline Informal Networking LunchModerators Training Graduate Students3:00pm -­‐5:15pmGrantsmanship 101 Graduate Students and Doctoral Scholars4:20pm -­‐5:15pm5:30pm -­‐ 6:30pm5:30pm -­‐ 6:30pm7:00pm -­‐ 9:15pm9:30pm -­‐ 10:30pm9:00am -­‐ 3:00pm7:30am -­‐ 8:45am7:15am-­‐8:30amOrientation/Networking Sessions by Discipline*NEW* Graduate Research Fellowship Programs Undergraduate Seniors, First and Second Year Graduate Students in STEMPowerPoint PresentationUpload IIDay 2 -­‐ Student Presentations & Panel DiscussionsRegistration Poster SetupMeet & Greet with Program OfficersDoctoral ScholarsDinner/Welcome/Alumni Research & Career Panel PresentationsReception for Doctoral Scholars, FacultyMentors, Coordinators, Graduate StudentsCoordinators Community Meeting and Group Photo7:30am -­‐ 8:30amNetworking BreakfastsBreakfast for Graduate Students and Doctoral Scholars:*NEW* Professional Societies: Making the Best of Professional Connections8:45am -­‐ 9:45am9:45am -­‐ 10:45am11:15am -­‐ 12:45pm1:00pm -­‐ 2:30pm2:45pm -­‐ 4:15pm4:20pm -­‐ 4:30pm4:45pm -­‐ 6:00pm6:00pm -­‐ 6:45pm 7:00pm -­‐ 9:00pm9:00pm -­‐ 12:00am7:30am -­‐ 10:00am8:00am -­‐ 9:45am 10:00am -­‐ 11:30am10:00am -­‐ 12:00pm12:00pm -­‐ 1:00pm Graduate School Application & Interview Process Breakfast PanelsStudent Poster Presentations Session I (Odd Poster Numbers)Student Poster Presentations Session II (Even Poster Numbers)Student Oral Presentations Session I -­‐Only BioSciences & Applied BioSciences PresentLunch Panel: The Graduate School Experience(PhD Program)Lunch Panel: The Graduate School Experience (MD-­‐PhD Program)Lunch for Graduate Students and Doctoral Scholars:*NEW* Utilizing Professional Development, Social Support, Mentoring, and Networking for Success Student Oral Presentations Session II -­‐ All disciplines will presentBreak/Snack/Professional Headshots*Student Oral Presentations Session III -­‐ All disciplines will presentGroup Photos: Mellon Initiative Cohort/Individual Professional Headshots/Free TimeDinner & Keynote SpeakerDance PartyDay 3 -­‐ Recruiting Fair & Next StepsExhibitors Set-­‐up for Recruiting FairBreakfast Panel:BioSciencesBreakfast Panel:MD-­‐PhDBreakfast Panel:Social Sciences & HumanitiesBreakfast Panel:Engineering & Physical SciencesBreakfast for Graduate Students and Doctoral Scholars:*NEW* Using Social Media to Efectively Enhance Your FutureLeadership Alliance Doctoral Scholar NetworkRecruiting Fair/ExhibitorsFill out Surveys/Closing Remarks/Adjournment* Headshots can be taken all day Saturday.*Headshots can be taken all day Saturday.

6 | The Leadership Alliance National Symposium 2013Agenda 2013Friday, July 2611:00am – 3:00pmLeadership Alliance Conference Registration....................................................................................................Mezzanine11:00am – 3:00pmPowerPoint Upload Session I.........................................................................................................................................Alder12:00pm – 2:30pmInformal Networking Lunch – Everyone.................................................................................................. Garden Pavilion2:00pm – 3:00pmModerators Training.................................................................................................................................................The GlenModerator: Jabbar Bennett, Associate Dean, Graduate School, Division of Biology and Medicine, Brown UniversityUndergraduates:3:00pm – 4:15pmFunding Your Education by Discipline4:20pm – 5:15pmOrientation/Networking Session by DisciplineBiosciences....................................................................................................................................Grand Ballroom IModerators: Sheila Thomas, Assistant Professor of Medicine, Assistant Dean of Diversity and Minority Affairs forGSAS and DMS, Harvard University; Nikia Laurie, Assistant Professor, Ann & Robert H. Lurie Children’s Hospital ofChicago Research Center, Northwestern University Feinberg School of MedicineFunding Your Education Panel:Erika Barr, Special Projects Coordinator, Office of Intramural Training and Education, NIHTiffani Fonseca, Fellowships Programs Coordinator, ASMChristine O’Brien, Ford Fellowship, National Academy of SciencesSocial Sciences and Humanities............................................................................................... Grand Ballroom IIModerators: Karen Jackson-Weaver, Associate Dean of Academic Affairs and Diversity, Princeton University; TravisBoyce, Assistant Professor of Africana Studies and Social Science, University of Northern ColoradoFunding Your Education Panel:Saul Fisher, Executive Director for Grants and Academic Initiatives and Visiting Associate Professor, Mercy CollegeChris Cash, Director of Student Assistance Programs, Institute for Broadening ParticipationLeislie Godo-Solo, Associate Director, Institute for Recruitment of TeachersEngineering and Physical Sciences............................................................................................................ Grove IIModerator: Michelle Nearon, Assistant Dean Office for Diversity and Equal Opportunity, Yale UniversityFunding Your Education Panel:Aileen Walter, Vice President, Scholarships and University Relations, National Action Council for Minorities in EngineeringSara Xayarath Hernandez, Director of Diversity Programs, Engineering College, Cornell University/ Institute forBroadening ParticipationDon Brunson, Assistant Dean, Graduate School and Director, Enhancing Diversity in Graduate Education Program,Vanderbilt University

Cultivating Excellence and Empowering Great Minds | 73:00pm – 5:15pmDeveloping Grantsmanship Skills.............................................................................................................................Grove IGraduate Students and Doctoral ScholarsModerator: Lloyd Douglas, Associate Director Office of Sponsored Projects, University of North Carolina atGreensboro/CUR, and Mary Farwell, Professor of Biology, East Carolina university/CUR5:30pm – 6:30pm(New) Graduate Research Fellowship Programs (GRFP)..................................................................................... Grove II(This session is for seniors, first and second year graduate students - STEM)Moderator: Pushpa Murthy, Program Director, Graduate Research Fellowship Programs, National Science Foundation5:30pm – 6:45pmPower Point Upload Session II......................................................................................................................................Alder5:30pm – 6:30pmDoctoral Scholars Meet & Greet..................................................................................................................................AspenModerator: Jabbar Bennett, Associate Dean, Graduate School, Division of Biology and Medicine, Brown UniversityChristine O’Brien, Ford Fellowship, National Academy of SciencesTiffani Fonseca, Fellowships Programs Coordinator, ASMNicole Restrick, Fellowships Manager, Assistant Director, Abe Fellowship Program, Social Science Research CouncilAnastacia Berzat, Scientific Program Manager, Office of Education, Diversity & Inclusion, Novartis Institutesfor Biomedical ResearchLaina King, Director of Diversity in Life Science Programs, Keystone SymposiaChris Cash, Director of Student Assistance Programs, Institute for Broadening ParticipationRebecca Keiser, Associate Deputy Administrator for Strategy and Policy, NASAMary Crowe, Associate Provost of Experiential Learning, Florida Southern College, Council on Undergraduate ResearchBrooke Bruthers, Diversity Programs Coordinator, The American Physiological SocietyErika Barr, Special Projects Coordinator, Office of Intramural Training and Education, NIH7:00pm – 9:15pmWelcome, Dinner, Alumni Career Panel.........................................................................................Grand Ballroom I & IIModerator: Chinonye Nnakwe, Director of Graduate Diversity Recruitment, University of ChicagoPanelists:Kisha Piggott, Ophthalmology and Visual Sciences MD-PhD, Washington University in St. LouisEric Villegas, Research Microbiologist, U.S. Environmental Protection AgencyAlyssa Garcia, Assistant Professor of Women’s Studies, Pennsylvania State UniversityLa Marr Jurelle Bruce, African American Studies and American Studies, Yale University9:30pm – 10:30pmReception.......................................................................................................................................................................Grove IFaculty, Coordinators, Administrators, Doctoral Scholars,Graduate Students, and Guests

8 | The Leadership Alliance National Symposium 2013Saturday, July 279:00am – 3:00pmLeadership Alliance Conference Registration....................................................................................................Mezzanine7:15am – 8:30amCoordinators Community Meeting/Group Photo.........................................................................................................Elm7:30am – 8:30amPosters Setup................................................................................................................................................. Garden Pavilion8:30am – 6:00pmProfessional Headshots.......................................................................................................................................Charter Oak7:30am – 8:30amUndergraduate Networking BreakfastsBiosciences....................................................................................................................................Grand Ballroom ISocial Sciences and Humanities............................................................................................... Grand Ballroom IIEngineering and Physical Sciences............................................................................................................ Grove IINetworking Breakfast: Doctoral Scholars & Graduate Students(New) Professional Societies: Making the Best of Professional Connections......................................................Grove IModerator: Nancy Schwartz, Associate Dean for Postdoctoral Affairs and Co-director of the Office of GraduateAffairs, University of ChicagoPanelists:Caryl McFarlane, Sr. Program Officer/Director Mellon Y& Pickering Programs, Woodrow Wilson NationalFellowship FoundationLaina King, Director of Diversity in Life Science Programs, Keystone SymposiaNicole Restrick, Fellowships Manager, Assistant Director, Abe Fellowship Program, Social Science Research CouncilPamela Scott-Johnson, Psychology Associate Professor & Chair of Psychology, Morgan State UniversityTiffani Fonseca, Fellowships Programs Coordinator, ASMBrooke Bruthers, Diversity Programs Coordinator, The American Physiological Society8:45am – 10:45amStudent Poster Presentations....................................................................................................................... Garden Pavilion8:45am – 9:45am – Student Poster Presentations Session I (Odd poster numbers)9:45am – 10:45am – Student Poster Presentations Session II (Even poster numbers)11:15am – 12:45pmStudent Oral Presentations Session IBiosciences: Elm I, Elm II, Aspen I, Aspen II, Glen I, Glen II, Glen III, AlderSocial Sciences & Humanities: Springdale IILunch served 1:00 pm.Sessions conducted from 1:30 – 2:30 pm.• Breakfast served 8:00-8:45am. Sessions begin at 8:45am •1:00pm – 2:30pmPanel Discussion for Undergraduates Interested in the PhD: .............................................................Grand Ballroom IThe Graduate School ExperienceModerator: Pamela Scott-Johnson, Interim Dean of the College of Liberal Arts, Morgan State UniversityPanelists:Larry Perry, Religious Studies, University of VirginiaJose Solis, Civil Engineering, University of Colorado BoulderJewell Debnam, Cultural 20th Century, Michigan State UniversityTeresa Ramirez, Molecular Pharmacology and Physiology, Brown University

Cultivating Excellence and Empowering Great Minds | 91:00pm – 2:30pmPanel Discussion for Undergraduates Interested in the MD-PhD: .................................................. Grand Ballroom IIThe Graduate School ExperienceModerator: Nancy Schwartz, Associate Dean for Postdoctoral Affairs and Co-director of the Office of GraduateAffairs, University of ChicagoPanelists:Andrew Drysdale, MD-PhD Candidate, Weill Cornell Medical CollegeJose-Marc Techner, MD-PhD Candidate, Northwestern University Feinberg School of MedicineMaria Sacta, MD-PhD Candidate, Weill Cornell Medical CollegeTashalee Brown, MD-PhD Candidate, Weill Cornell Medical College1:00pm – 2:30pm(New) Panel Discussion for Graduate Students and Doctoral Scholars: .....................................................Grove I & IIUtilizing Professional Development, Social Support, Mentoring, and Networking for SuccessModerator: Jabbar Bennett, Associate Dean, Graduate School, Division of Biology and Medicine, Brown UniversityPanelists:Mentoring – Roger Chalkley, Senior Associate Dean for Biomedical Research Education and Training, Vanderbilt UniversityProfessional Development – Deborah Collins, Associate Director, The Leadership AllianceSocial Support – Louise Hainline, Professor Psychology, Brooklyn CollegeNetworking – Tyrone Barksdale, Assistant to the Provost/Special Projects Analyst, Howard UniversityPost Doc - Eric Villegas, Research Microbiologist, National Exposure Research laboratory (EPA)Industry - Anastacia Berzat, Scientific Program Manager at Novartis Institutes for Biomedical Research2:45pm – 4:15pmStudent Oral Presentations Session IIBiosciences: Elm I, Elm II, Aspen I, Aspen II, Glen I, Glen II, Glen III, AlderSocial Sciences & Humanities: Belltown, Cove I, Cove II, Waterside, Springdale I, Springdale IIEngineering & Physical Science: Westover, Glenbrook, High Ridge, Long Ridge• Break, 4:20 pm – 4:40 pm •4:45pm – 6:00pmStudent Oral Presentations Session IIIBioscience: Elm I, Elm II, Aspen I, Aspen II, Glen I, Glen II, Glen III, AlderSocial Sciences & Humanities: Belltown, Cove I, Cove II, Waterside, Springdale I, Springdale IIEngineering & Physical Science: Westover, Glenbrook, High Ridge, Long Ridge6:00pm – 6:45pmLeadership Alliance Mellon Initiative Group Photo.......................................................................TBA by photographer7:00pmDinner, Keynote Speaker...................................................................................................................Grand Ballroom I & IIDr. Terrell Strayhorn, Professor, Researcher, Provocateur, The Ohio State University9:00pm – 12:00amDance............................................................................................................................................................................... Grove

10 | The Leadership Alliance National Symposium 2013Sunday, July 287:30am – 10:00amExhibitors Set-up for Recruiting Fair...................................................................................................Grand Ballroom IIIBreakfast served 8:00 – 8:45 am.Sessions conducted from 8:45 – 9:45 am.• Breakfast served 8:00-8:45am. Sessions begin at 8:45am •8:00am – 9:45amUndergraduate Breakfast and Panels: The Graduate School Application & Interview ProcessBiosciences....................................................................................................................................Grand Ballroom IModerator: Nancy Schwartz, Associate Dean for Postdoctoral Affairs and Co-Director of the Office of GraduateAffairs, University of ChicagoPanelists:Sheila Thomas, Assistant Professor of Medicine, Assistant Dean of Diversity and Minority Affairs for GSAS and DMS,Harvard UniversityJoel Oppenheim, Senior Associate Dean for Biomedical Sciences, New York University Langone Medical CenterRoger Chalkley, Senior Associate Dean for Biomedical Research Education and Training, Vanderbilt UniversityMD-PhD..................................................................................................................................... Grand Ballroom IIModerator: Ruth Gotian, Administrative Director, Tri-Institutional MD-PhD Program, Weill Cornell Medical CollegePanelists:Arlene Kohler, Administrative Director, NYU MD-PhD ProgramBrian Sullivan, Executive Director, Washington University in St Louis, MD-PhD ProgramPatrice Spitalnik, Associate Director, Columbia MD-PhD ProgramMichelle Grundy, Assistant Director of the MSTP, Vanderbilt UniversitySocial Sciences and Humanities................................................................................................................The GlenModerator: Geneva Baxter, Associate Dean of Undergraduate Studies, Spelman CollegePanelists:Pamela Scott-Johnson, Associate Professor and Psychology Department Chair, Morgan State UniversityKaren Jackson-Weaver, Associate Dean of Academic Affairs and Diversity, Princeton UniversityEngineering and Physical Sciences............................................................................................................ The ElmModerator: Michelle Nearon, Assistant Dean Office for Diversity and Equal Opportunity, Yale UniversityPanelists:Don Brunson, Assistant Dean, Graduate School and Director, Enhancing Diversity in Graduate Education Program,Vanderbilt UniversitySonya Gwak, Associate Director for Student Affairs and Graduate Admissions, University of Pennsylvania(New) Using Social Media to Effectively Enhance Your FutureGraduate Student & Doctoral Scholar Breakfast......................................................................................The Aspen I & IIModerator: Mary Crowe, Associate Provost of Experiential Learning, Florida Southern College, Council onUndergraduate ResearchFaculty Breakfast.............................................................................................................................................................Alder10:00am – 12:00pmRecruiting Fair.........................................................................................................................................Grand Ballroom III10:00am – 11:30amLeadership Alliance Doctoral Scholar Network...........................................................................................................Cove12:00pm – 1:00pmFill out surveys, Closing Remarks, Adjournment..........................................................................Grand Ballroom I & II

Terrell L. StrayhornKeynote SpeakerTerrell L. Strayhorn, Ph.D.Dr. Terrell Lamont Strayhorn is Associate Professor of Higher Education at The OhioState University in the School of Educational Policy & Leadership within the Collegeof Education and Human Ecology, where he also serves as Director of the Center forInclusion, Diversity, & Academic Success (IDEAs), Faculty Research Associate in theKirwan Institute for the Study of Race & Ethnicity, Senior Research Associate in theTodd A. Bell National Resource Center for African American Males, and faculty affiliatein the Departments of Black Studies, Sexuality Studies, and Engineering Education.Professor Strayhorn maintains an active and highly visible research agenda focusing onmajor policy issues in education: student access and achievement, equity and diversity,impact of college on students, and student learning and development. Acclaimed higher education researcherand policy analyst, Strayhorn has authored 7 books and monographs including The Evolving Challenges of BlackCollege Students (Stylus Publishing, 2010), College Students’ Sense of Belonging (Routledge, 2012), Living at theIntersections (IAP, 2013) over 40 book chapters, and more than 80 refereed journal articles, reviews, and scientificreports. He is a highly sought after public speaker and presenter; to date, he has authored over 150 international,national, and state conference papers or keynotes. Named “one of the most highly visible new scholars in his field,”by the Journal of Blacks in Higher Education, Strayhorn has received numerous national awards and honors; hewas recently named one of the nation’s Top Emerging Scholars by Diverse Issues in Higher Education and one ofthe “Top 20 in Education” by BusinessFirst. Strayhorn is co-editor of Spectrum: A Journal on Black Men, publishedby Indiana University Press; associate editor of the Journal of Higher Education, and serves on several editorialboards. Grants totaling more than $2 million have supported his research program including funds from the U.S.Department of Education, National Science Foundation, and several professional associations.

12 | Student Oral Presentations by TIMEOral Presentations by TimeBB = Basic BiosciencesAB = Applied BiosciencesEN = EngineeringPE = Policy & EthicsPS = Physical ScienceES = Earth ScienceSS = Social ScienceHU = Humanities11:15 AM AB Hayford Agyemang Myelination and Pediatric SIV (SimianImmunodeficiency Virus)11:15 AM AB Aja Crim-Logan Computer Based Treatment for Cognitive BehavioralTherapy11:15 AM BB Kevin De Jesus Elucidating a Mitochondrial ProtectiveTranscriptional NetworkGlen IIIGlen IIAspen II11:15 AM BB Michelle Okoreeh MTAP Inactivation in Cancer Alder11:15 AM AB Uchenna Okoro Characterization and Screening of MonoclonalAntibodies Targeting Abnormal Protein Conformations11:15 AM AB Angel Ortiz Rodriguez Interferon-gamma Mediated Degradation ofHemeOoxygenase-1 (HO-1) Via Induction ofthe Immunoproteasome in Human PrimaryMacrophages: Implications for HIV AssociatedNeurocognitive Disorder11:15 AM BB Folasade Sofela Effects of Hypoxia on gamma-Secretase Activity inNeuronal Cells11:15 AM AB Camila Uechi Investigating the Mechanisms of Atrial FibrillationThrough the Use of Computational Human AtrialModels11:30 AM BB Kristian Black Development of Fluorescent RNA Biosensors for theQuantification of Intracellular Metabolites11:30 AM AB Timothy Borjas The Effect of Necrostatin-1 on PancreaticInflammation and Cancer11:30 AM AB Joshua Cole Elucidating the Modulatory Effects of FlaxseedderivedLignans on Protein Expression ofMacrophage Co-receptors: Implications for HIVNeuroprotection11:30 AM AB Jeffrey Luery Diurnal Changes of Neuron Excitability Within theSuprachiasmatic Nucleus Using Voltage-SensitiveDye Imaging11:30 AM AB Luis Millán-Barea Francisella Infectivity Potentiator Protein B FipB,and FipA are Important Protectors Against IncorrectDisulfide Bond Formation Caused by Copper Stressin Francisella novicida11:30 AM AB Isabel Morgan Socioeconomic Status and Child CognitiveOutcomes at Age 7; Maternal Cortisol as a PossibleMediator11:30 AM BB Babajide Oluwadare Determining the Contribution of FibroblastConnexin Expression to the Conduction Propertiesof Injured Cardiac Tissue11:30 AM BB Kelsey Wanhainen Structural and Biophysical Studies of TREM2 inNeurological Diseases11:45 AM BB Laura Agosto-Rosa Signal-Induced Alternative Splicing in Primary TCells and Cell LinesElm IAspen IGlen IElm IIAspen IIAlderAspen IGlen IIIElm IGlen IIElm IIGlen IAspen II

Cultivating Excellence and Empowering Great Minds | 1311:45 AM BB Cristhian Cadena Impact of Defective Viral Genomes SequenceModifications in Their Immunostimulatory Activity11:45 AM BB Cecile Gaston Novel Role of the Neuronal Guidance Cue, Netrin-1in Abdominal Aortic Aneurysm Formation11:45 AM BB Joshua Rosario Sepulveda Structure Analysis of Human Red Cell SpectrinUsing Homobifunctional Crosslinkers and HighResolution Mass Spectrometry11:45 AM BB Alicia Sanchez Arginine Vasopressin Neurons in SuprachiasmaticNucleus of Transgenic Mice Deficient in FGF8 andFGFR111:45 AM BB Javier Sierra-Pagán Characterization of the Role of Hdac3 and Hopx inCardiac Cell Differentiation In Vitro11:45 AM BB Andrei Smid Skp2 E3-ligase Inhibitors as Probes for Cell CycleAnalysis in Cancer11:45 AM AB Zoe Spafford The Spacial Organization of Skilled Behavior Withinan Identified Neural Circuit12:00 PM BB Rajshekhar Basak The Mechanism of Acrolein-Induced LungEndothelial Permeability12:00 PM BB Lindsey Brier Assessing the Effects of RNase H rRNA Depletionon Technical Variability in RNA SequencingExperiments12:00 PM BB Erran Briggs II The Study of the HIV-1 5’UTR Monomer-Dimer Equilibrium by Native Size ExclusionChromatography12:00 PM BB Timothy Brown Insect Cell Expression and Purification of PTEN -- AKey Signaling Phosphatase and Tumor Suppressor12:00 PM AB Rachel Lee Ultrasonic Actuation Reduces Brain InflammatoryResponse to Neural Microelectrode Insertion12:00 PM BB Bryan Morales Assessing the Effects of Sleep Homeostasis inActivity-Dependent Plasticity: The SpatiotemporalExpression of Plasticity-Related Proteins Within aSleep Deprivation Study Using the Model OrganismMus musculus12:00 PM BB Pauline Xu Quantitative Phosphoproteomic Analysis UsingHigh-Resolution Tandem Mass SpectrometryAspen IGlen IIIElm IGlen IElm IIAlderGlen IIElm IIAspen IIAspen IAlderGlen IIIGlen II12:00 PM BB Amy Zhang A Quirky Inhibitory Circuit in the Cerebral Cortex Glen I12:15 PM BB Stephanie Castillo Dissecting Interactions Between BamA and BamDVia Binding and Fluorescence Studies12:15 PM BB Irene Lee Use of Immune Complex Vaccine as a NovelImmunogen to Generate Broad HIV-1 NeutralizingAntibodies12:15 PM AB Robert Myers Neoplastic Transformation of Neural Precursor Cellsto Model Glioblastoma Multiforme (GBM)12:15 PM BB Diana Nwokoye Spatial and Temporal Expression Patterns of MBD2:Protein Implicated in Autistic-like Phenotypes12:15 PM AB Natalia Quijano-Cardé MR-Visible Lipids as a Biomarker of Cell Stress inProstate Cancer Cells Treated With Anticancer DrugsElm IElm IAspen IGlen IGlen IIAlder

14 | Student Oral Presentations by TIME12:15 PM BB Zakariyah Sharif-Sidi Bioinformatic Analysis of the Transcription FactorsInvolved in Cochlear Synapse Formation12:15 PM BB Emilio Soto The Role of Sensory Cortex in Cue-induced Relapseto Drug Addiction12:15 PM BB Kyle Tucker Cell Cycle Effects of Delta Np63 alpha and SAMD9Lon Lung Squamous Cell Carcinoma12:30 PM HU Andrew Anguiano The Economy of Online Courtship: Memoirs ofDesperation and Fabrication in Internet-MediatedDating12:30 PM AB Sandy Chan Effect of Aspirin on Microhemorrhage Diameters inRodent Brains12:30 PM BB Arianna Espinoza Using Fluorescence Anisotropy to Understand HowMARCKS-ED Peptide Binds to Microvesicles12:30 PM AB Marilyn Le The Effects of Reverse Transcriptase Inhibitors onLINE-1 Retrotransposon Expression in HumanFibroblasts12:30 PM AB LeaAnn Love African American Women and Triple NegativeBreast Cancer: Examining the Stigmas of SelfTouching that Prevent Its Early Detection12:30 PM AB Madeline Pelz Imaging and Characterization of HippocampalCircuits Implicated in Temporal Lobe Epilepsy12:30 PM BB Carlos Santos-Perez DAX1 and WT1: Novel Regulatros of the LHßTranscription12:30 PM BB Ephrath Tesfaye Changes in the Synaptic Plasticity of theHypothalamic Paraventricular Nucleus FollowingHypertension in the AOF Menopausal Mouse Model12:30 PM BB Saiah Yates Phosphorylation of Threonine 45 of Histone H3 andthe Effects of Alanine and Aspartic Acid Mutations2:45 PM BB Gifty Addae Investigating Novel Proteins And MicroRNAs InLeukemogenesis2:45 PM HU Annecaroline Clark Harm Reduction in the United States: The EarlyDevelopment of New York City’s Syringe and NeedleExchange Policy, 1985-19892:45 PM BB Rebecca de Frates The Role of Cdc42 in Cerebellar Granule CellDevelopment2:45 PM PS Aisha Dorta A Quantitative Analysis of the BiologicalTerraformation of a Planet2:45 PM BB Bianca Flores The Effects of Mycobacterium vaccae onSerotonergic Systems, Immune Activation, andBehavior in the Forced Swim Test2:45 PM HU Cynthia Garcia Reclaiming Space and Preserving Cultural History inthe Mission District of San Francisco2:45 PM SS Jemima Georges An Examination of the Impacts PrehistoricCahokians Had on Their Natural Environment2:45 PM AB Claudio Macias Self-assembled Supramolecular Nanobelts forAntibiotic Delivery2:45 PM HU Carrie Moore Fitting into the Story: Western Romance andBlackness in Toni Morrison’s “Tar Baby”Aspen IIGlen IIIElm IISpringdale IIGlen IIElm IAspen IAlderGlen IAspen IIGlen IIIElm IIAspen ICove IAlderGlenbrookElm IWatersideBelltownGlen ICove II

Cultivating Excellence and Empowering Great Minds | 152:45 PM ES Mary Ng Characterizing Precipitation in East Africa Westover2:45 PM BB Adewola Osunsade Assessing the Functionality of Protein Kinase CIsozymes Using Wildtype and Constitutively ActiveForms of PKC-alpha and PKC-epsilon2:45 PM HU Darien Pollock 21st Century American Street Philosophy and thePhilosophy of Mass Incarceration2:45 PM BB Daniel Powell Elucidating Cellular and Molecular Mechanisms ofEstrogen Dependent TAF4B Upregulation2:45 PM SS Melisa Rojas Examining Reciprocal Communication in Youthwith Autism Spectrum Disorders Following a Peer-Mediated Theatre Intervention2:45 PM AB LaTonya Simon Synthesis and Characterization of PhotodegradableOxime Derived MicroparticlesAspen IISpringdale IGlen IIISpringdale IIGlen II2:45 PM BB Ryan Spector The Role of CDC25A in Neuronal Apoptosis Elm II2:45 PM PS Anna Stephenson Manipulating Atoms to Create Artificial Materials High Ridge2:45 PM PS George Torres Deconstructing Graphs and Their Eigenspectra Long Ridge3:00 PM AB Raymond Barry The Effects of the Microbiome on Health and Disease Glen I3:00 PM HU Henry Capps III The Prison Tragedy: The Failure of NarcoticsCriminalization in New York City’s War on Drugs3:00 PM PS Corie Jade Carter Microbial Ecology of Biological Nitrogen Fixation inMT Soils3:00 PM SS Princess Cobbs Health Care Utilization by Young Adults ThatHave Been Affected by the Criminal Justice SystemCompared to Those That Have Not3:00 PM HU Evan Coles The Literature of Black Marxism: A Critical Look atReligious DominationSpringdale IGlenbrookSpringdale IICove II3:00 PM HU Lauren Highsmith The Divide: Modernism and Afro-Modernism Waterside3:00 PM EN Dorcas Huang Modeling Cellular Response to Nanopatterned BulkMetallic Glasses3:00 PM HU David Hutchinson All I Do Know Is That I Like Being Liked:Conceptualizing Same-Sex Desire in Richard BruceNugent’s “Gentleman Jigger”3:00 PM BB Melissa Leung Efficacy of the novel JAK2 inhibitor G6, inMyeloproliferative Neoplasms3:00 PM BB Davys Lopez Localization of the Polarity Regulator PAC-1 byComponents of the Cadherin-Catenin Complex3:00 PM ES Brian Matilla Convection Initiation along the Rocky MountainFront Range3:00 PM PS Alexis Morris Description of the Behaviors and ElectronCorrelation in LaNiO3 and NdNiO3 Through FirstPrinciples TheoryLong RidgeCove IAlderAspen IIWestoverHigh Ridge3:00 PM SS Daniel Nissani Characterizing Forms of Mathematical Discourse Belltown3:00 PM BB Gordon Pherribo Optimizing shRNA to Target Specific RNA-BindingProtein Transcripts3:00 PM AB Mayra Rios Expression Level of Transient Receptor PotentialVanilloid-4 (TRPV4) in Mice During LungDevelopmentAspen IElm II

Cultivating Excellence and Empowering Great Minds | 173:15 PM AB Raquel Tripp Separation of Maternal and Fetal Components ofProducts of Conception (POC) Using Laser CaptureMicrodissection and Evaluation of Direct PCR forPaternity Testing in Sexual Assault Cases3:15 PM SS Sade Williams Am I Who I Say I Am or What They Say I Am?:Identity Construction in Juvenile CourtroomProceedings3:30 PM AB Aida Alazar A Small Molecule Screen To Identify Modulators OfC-cell Development In Zebrafish Embryos3:30 PM SS Morgan Clark Not Just a Game: Racialization, Othering andHypersex in Video Games3:30 PM BB James Damiano Mechanism of JAK2 Autoinhibition Identified byMolecular Dynamics SimulationElm IIWatersideGlen IIBelltownAspen II3:30 PM EN Jana Dodson SEM and EDS Characterization of Bulk Metallic Glass Long Ridge3:30 PM BB Daniel Guzman Analysis of the IgE Response in NippostrongylusBrasiliensis-Infected Mice3:30 PM HU Nikeeyia Howell Demystifying the Strangeness: An Intertextual Analysisof Mark Twain’s No.44, The Mysterious Stranger3:30 PM EN Maxwell Kesselly Utilization of Solar Energy in Residential Homes toAchieve Complete Net-Zero Energy Solar Homes3:30 PM PS Melissa Kreider Synthesis of a Dense, High Aspect Ratio ZincOxide Nanowire Forest Using the PS-PMMA BlockCopolymer3:30 PM BB Shannon Litke Neurotensin Attenuates the Methamphetamine-Induced Increase in Phosphorylation ofDARPP-32, Dopamine and cyclic AMP-RegulatedPhosphoprotein, Via the Nitric Oxide/cyclic GMPSignaling Pathway in Striatal Neurons of Mice3:30 PM BB OnyemaechiNwanaji-EnweremThe Biological Significance of Soluble Co-InhibitoryReceptors, B-/T-Lymphocyte Attenuator (BTLA),and its Ligand, Hepatitis Virus Entry Protein(HVEM), in the Development of Sepsis in MiceGlen ICove IIWestoverHigh Ridge3:30 PM SS Rafael Perez The Effects of Social Stress on HDAC6-Related Proteins Springdale II3:30 PM SS Yaritza Perez Learned Helplessness or Tradition: An Examinationof the Transgenerational Use and Perspective ofCorporal Punishment and Authoritarianism inAfrican American and Hispanic FamiliesAlderElm IWaterside3:30 PM BB Adrian Rivera siRNA Library Screen of ZMYND11 Interacting Partners Aspen I3:30 PM HU Emily Rogers “Invisible Wounds” or Invisible Politics?Neoliberalism, Post-Traumatic Stress Disorder, andImagined US Vulnerability in the “War on Terror”3:30 PM ES Franklin Roman-Rodriguez Bacterial Cultures From Tadpoles of the BullfrogLithobates catesbeianus (Previously Rana catesbeiana)3:30 PM BB Rochelle Sadeghi Spontaneous Changes in Immortalized MammalianCell Lines Result in Cell Competition3:30 PM BB Phillip Stephens Understanding the Genetic Pathways ControllingForaging Behavior in C. Elegans Using DoubleMutant AnalysisSpringdale IGlenbrookGlen IIIElm II

18 | Student Oral Presentations by TIME3:30 PM SS Andrew Tuck Identifying Motivations for Medication Adherencein HIV-Positive Methamphetamine-Using Men WhoHave Sex With Men3:45 PM BB Jaime Aponte Impact of RAGE Deletion and MitochondrialBiogenesis3:45 PM EN Rebecca Betances Cellular Responses to Nanopatterned Bulk MetallicGlasses3:45 PM HU Donald Brown Universalism, Particularism, and the Limits Therein:Post-World War II Politics on Race3:45 PM PE Paul Cato Polyphony, Responsibility, & Active Love: AReconsideration of Dostoevsky’s and Lévinas’Philosophies of Love3:45 PM BB Avani Comer Functional Analysis of Crohn’s Disease andMycobacteria in Ashkenazi Jews3:45 PM BB Sherry Gee Role of ANO-1 in Endothelial Cell Proliferation andMigration3:45 PM PS Joseph Geraghty Synthesis of Enantiopure Nantenine Analogs asSerotonin 5-HT2A Receptor Antagonists3:45 PM SS Guadalupe Gonzalez The Role of Gender and Stage of Acquisition in theLanguage Processing of L2 Learners3:45 PM AB Natalia Herrera Generating an Antibody Against Retinoic AcidReceptor-Related Orphan Receptor Alpha (Rora) toDefine its Transcriptional Targets3:45 PM BB Claudia Lovell The Role of BET Proteins in Embryonic Stem CellFate Decisions3:45 PM HU Danielle McColgan Historicizing Health Promotion: Anti-DrugPrevention in New York City From 1978-1989Cove IElm ILong RidgeSpringdale ICove IIGlen IGlen IIIGlenbrookBelltownAspen IElm IICove I3:45 PM SS Shayna McCormack Bipolar Disorder and Medicinal Nonadherence Springdale II3:45 PM BB Karen Rico Relationship Between Acyl-CoA Thioesterase 7 andSaturated Fatty Acid-Induced JNK Activation3:45 PM BB Kathryn Sanchez Assessing Hippocampal Metabolism of MPS VIIMice by High Resolution Respirometry3:45 PM PS Jayilssa Torres Co and Zr oxides/ Si (001) Epitaxial Growth andSurface Analysis: Ultra High Vacuum SystemValidation3:45 PM AB Osaze Udeagbala Searching for Drug Leads: A Live Cytotoxicity AssayAgainst Giardia lamblia3:45 PM EN Stephen Vicchio A Combinatorial Study of the Dealloying of Au/Ag/Pd Metal Alloys For Improved Fuel Cell Catalysts3:45 PM SS Sagirah Wheeler Words of Encouragement: Listening to the Past inOrder to Prepare for the FutureAspen IIAlderHigh RidgeGlen IIWestoverWaterside4:00 PM SS Emily Artalejo Female Paramilitary Experience in Northern Ireland Springdale I4:00 PM SS William Beischel Executive Functioning in Sexually Compulsive Gayand Bisexual Men4:00 PM EN Alexander Bruch High Finesse Cavity for Characterizing the OpticalLoss in Thin Films of Barium TitanateCove ILong Ridge

Cultivating Excellence and Empowering Great Minds | 194:00 PM BB Can Buldun The Effects of Haloperidol, Clozapine andRisperidone on Glutamatergic Synapses4:00 PM BB Marco Carpenter Identifying Schizophrenia Associated Gene Targetsof the Transcription Factor c-myb4:00 PM AB Oluwadara Coker Investigating the Role of Non-Coding RNAsin Immunoglobulin Heavy Chain LocusRearrangements4:00 PM BB Joshua Frenster Fluorescent Reporter System for DirectingHematopoietic Lineage Specification4:00 PM EN Michael Hawkins Using Ultraviolet Light to Inactivate theBacteriophage MS24:00 PM PS Lena Ibrahim Effects of Rigidity of Bent-Core Liquid CrystalSpacer Groups4:00 PM SS Alexandra Jones Examining the Mind of a Student: How UnconsciousBiases and Heuristics Influence Academic Decision-MakingAlderGlen IIAspen IGlen IIIGlenbrookHigh RidgeBelltown4:00 PM PE Matthew McCauley Talking About God: A Univocal Approach Waterside4:00 PM BB Michael Okoreeh Novel Regulators of Early B Cell Survival andProliferation4:00 PM SS Coralie Pardo Sex Differences in CREB Expression AfterAdministration of Cocaine, Methamphetamine, andCannabinoids4:00 PM BB Nicholas Pizzi Analysis of Hey1 Expression in Lamprey PharyngealArches4:00 PM BB Sarah Schrader Modeling IDH1 Mutations in Neural Cell TypesDerived from Human Embryonic Stem CellsElm ISpringdale IIAspen IIElm II4:00 PM SS Tyler Sharp Love Prejudice: An Underestimated Social Problem Cove II4:00 PM BB Vaughn Spurrier NMR Studies of the Q5A, G6S Unmyristylated FelineImmunodeficiency Virus Matrix Protein4:00 PM PS Kevin Trujillo Developing Photovoltaic Cells Using SemiconductingPolymers – Novel Methods of Harvesting SolarEnergy4:45 PM AB Javier Castillo The Effect of Innate Immune Modulation via Toll-Like Receptor 9 on the Amelioration of CerebralAmyloid Angiopathy in Alzheimer’s Disease4:45 PM SS Stanley Collins Social Capital Inside the Courtroom: An Analysisof the Networks That Assist Youth In Navigating theJuvenile Justice System4:45 PM SS Fartun Dirie Antenatal Care and Healthcare Access inMozambique: An Issue of Spatial Inequality?4:45 PM AB Damla Gonullu The Association Between Peripheral BloodLeukocyte Telomere Length and FemaleReproductive Aging4:45 PM BB Jere` Hutson Purification and Characterization of TAT-Cre for ExVivo Gene DeletionGlen IWestoverGlen IICove IIBelltownElm IElm II

20 | Student Oral Presentations by TIME4:45 PM AB Catrina Johnson Contribution of the E74-Like Factor 3 to the Toll-Like Receptor-Driven Catabolic Responses inArticular Chondrocytes: Potential Role in CartilageDestruction in OsteoarthritisAspen II4:45 PM AB Ahmed Malik Role of Huntington’s Disease Protein in Translation Alder4:45 PM BB Shenee’ Martin The Study of TDP-1 and FUST-1 in C. elegans toUnderstand Their Role in Amyotrophic LateralSclerosis4:45 PM SS Dana Muñiz The Culture of Work: The Economy of the SugarMills and Company Towns at the Caribbean Basin inthe 20th CenturyAspen ICove I4:45 PM ES StellJo Passes Radon Project Westover4:45 PM PE Viviana Rivera-Burgos Did Hurricane Sandy Dent the Vote? Evidence Froma Large-Scale Study in New York City4:45 PM HU Veronica Rivera-Negron (De)Composing the Self: Embodied Imagery,Theatrical Space and Gender in the Performance ofTeresa Hernández4:45 PM SS Miata Rogers The Effect of Academic Resources on CollegeRetention Rates4:45 PM AB Amber Shaffer Does Depression Lead to Incident Diabetes inAfrican Americans?: The Jackson Heart Study4:45 PM AB Kathryn Wu Hypermethylation of CpG Sites Upstream ofHexanucleotide Repeat Expansions in the C9ORF72Gene of ALS and FTD Patients5:00 PM AB Kristen Bascombe Determining the Source of and Maximizing theYield from DNA on Touched Objects by MicroscopicVisualization and Direct PCR5:00 PM ES Isatis Cintron Real Time in situ Source Characterization for BC inTotal Aerosol5:00 PM BB Sean Dougherty Hyperoxia Protects Against Isoflurane-inducedApoptosis in the Rat Neonatal Brain5:00 PM AB Ugomma Eze Requirement of FUS in mES-Derived Motor NeuronSurvival; Implications for ALS5:00 PM AB Matthew Gonzalez The Role of UCP1 and IAPP in the Progression ofDiabetes5:00 PM BB Jose Grullon Functional Analysis and Localization of NIS, MCT1,and MCT4 Proteins5:00 PM SS Elsa Hardy Cultures of Power: Harlem Children’s Zone andPoverty Intervention EffortsSpringdale ISpringdale IIWatersideGlen IGlen IIIGlen IIIWestoverAspen IGlen IIGlen IElm IICove I5:00 PM PE Justin Henderson Could Your DNA Soon Be in a Federal or State Database? Belltown5:00 PM SS Steven Jefferson China in the World: The Representation of EthnicMinorities in the Media5:00 PM SS Katryna Mahoney Black Activists in ‘White Africa’: Exploring sub-Saharan Migrant-Activism in Morocco5:00 PM PE N’Kosi Oates Geographic Neighborhood Poverty and PoliticalParticipationCove IISpringdale IISpringdale I

Cultivating Excellence and Empowering Great Minds | 215:00 PM AB Fei Peng The Role of Aldosterone in Endothelial Cell Migration Elm I5:00 PM HU Stephon Richardson The Black New Left: African-American RadicalGroups of the Late 1950s to the Early ‘60s5:00 PM AB Julian Roby Immature Neuron Proliferation in Correlation toCognition in Aging Vervet Monkeys5:00 PM AB Joseph Villanueva Joint Repair: Engineering Tissue Scaffolds UsingPolyethylene Glycol Hydrogels5:15 PM AB Nicole Bowman High Fat Diet Drives Epigenetic Changes: A Role forDNA Methyltransferase5:15 PM AB Kaitland Brannon Styryl-Based Compounds as Novel PotentialTherapeutic Agents for Alzheimer’s Disease5:15 PM SS Mario Castillo Kill/Capture: The Chichimec War in North CentralMexico, 1550-16005:15 PM BB Bao Ying Chen Defining Protein Phosphatase 2A Complexes andSubstrates That Regulate Ethylene Biosynthesis inArabidopsis5:15 PM BB Jessica Hartling Iron Responsive Element (IRE)-mRNAConformation Changes Induced by Manganese Ion(Mn2+)5:15 PM SS Noe Lopez Living In Between Nations: Discussing MixtecTransnationalism in the United States and Mexico5:15 PM SS Ashley Lowery Surveillance of Youth Tobacco Involvement UsingGoogle Trends5:15 PM BB Aaron Neal mRNA Expression of Clock Genes Per1 and Bmal inthe Hippocampus and the Amygdala5:15 PM PE Hailey Neubauer The Influence of the War on Drugs on Felons’ VotingRights Legislation and Voter Turnout in the SouthWatersideAlderAspen IIGlen IIIAlderSpringdale IIElm IIAspen ICove IBelltownGlen IIWaterside5:15 PM AB Nakul Talathi NRF2 Expression in Diabetic Wound Healing Tissue Glen I5:15 PM AB Joshua Taliaferro Utilizing Microfluidics to Study Platelet Activity andThrombus Formation In Vitro5:15 PM AB MacKenzie Taylor Novel Bisphosphonates and OsteoblastDifferentiation and Mineralization5:15 PM SS Tayler Ulmer African Immigration to America and the Tri-Concious Identity5:15 PM PE Princess Williams Are More Women Needed in the CongressionalBlack Caucus?5:30 PM BB Cristina Castro-Rivera Endosomal Recycling of KATP Channels: The Roleof EHD Proteins5:30 PM HU Taelor Clay Impact of Stereotype Threat on Women andMinorities5:30 PM SS Nykhala Coston The Public Perception of Interracial Dating varies asa Function of Prejudice, Environmental Diversity,and Racial Identity5:30 PM BB Imaani Easthausen Synthesis of a Multimodal Imaging Agent for theVisualization of Pancreatic Beta Cells in vivoElm IAspen IICove IISpringdale IElm IICove IICove IGlen I

22 | Student Oral Presentations by TIME5:30 PM BB Elshaddai Ephrem Role of IRF1 in Lupus: Defining Downstream Targets Elm I5:30 PM BB Kafi Friday Understanding the Mechanisms of Ceftriaxone-Dependent Regulation of Glutamate Transport in theBrain5:30 PM BB Rosa Leon Buprenorphine’s Potential Antidepressant-like Effectson a Chronic Mild Stress Model5:30 PM AB Carolina Lopez Regulation of the SYT-SSX2 Fusion Protein byt(X;18) in Synovial Sarcoma5:30 PM BB Andrew Morton Targeting HSR1 Affects the Heat Shock Response inHuman Brain Cancer Cells5:30 PM SS Carlos Puentes Does Cognitive Vulnerability to Sleep Loss Relate toMood Response?5:30 PM HU Marlen Rosas Protest in Perspective: Prospects of Continuity inPopular Mobilizations in Brazil5:30 PM BB Shanira Suazo Development of Bioorthogonal Profiling of DNAMethylation (BPDM) Technology to Study theMechanisms of DNA-Methyltransferases in theEpigenome.5:30 PM SS Brian Walsh The Association Between Juvenile Arrest, HealthInsurance, and Health Care Utilization5:30 PM HU Gillian Wood The Dangers of Expectant Evaluation: The Problemof Judgment in Washington Square and The Portraitof a Lady5:45 PM BB Jasmine Allen Investigating the Potential for Myogenin to Promotethe Amplification of MyHC Expressing Adenoviral Vectors5:45 PM SS Princess Brown The Effects of Utilizing Rap Music in UnderservedClassrooms to Improve Student Academic Performance5:45 PM SS Dina Dajani Decreased Cerebro-Cerebellar FunctionalConnectivity in Autism5:45 PM BB Felipe Giuste Elucidating the Role of Neuromedin U Receptor inErythropoiesis5:45 PM SS Mark Harris Juvenile Socialization and Courtroom Interactions: AQualitative Analysis of Client Outcomes5:45 PM BB Nicholas Hernandez Effects of Post-Translation Modifications on Rate ofBACE1 InternalizationAlderAspen IAspen IIGlen IIBelltownSpringdale IGlen IIIWatersideSpringdale IIAspen IICove IBelltownElm IWatersideGlen I5:45 PM BB Debria Joe BACE1 Localization and Trafficking in Neurons Glen II5:45 PM PE Aurora Llamas Re-thinking Cultural Values: A PhilosophicalApproach to Socialized Inequality5:45 PM SS Ariel Mosley Why Can’t I be Sexy, Smart, and Beautiful Enough?:Examining Women’s Internalization of Stigma5:45 PM BB Kasiemobi Nwaedozie Methamphetamine, Inflammation and the Ubiquitin/Proteasome Pathway: Impact on Neurodegeneration5:45 PM PE Alfonso Pacheco Political Opinion and Congress: A Study on theFailure of Comprehensive Immigration Reform5:45 PM AB Ornella Rutagarama Detection and Analysis of Genomic MutationsLinked to APOBEC-Mediated Cytidine Deamination5:45 PM BB Michael Snyder Inducible, Reversible Depletion of EndogenousProteins in Mammalian CellsSpringdale IICove IIAlderSpringdale IGlen IIIElm II

Cultivating Excellence and Empowering Great Minds | 23Oral Presentations by RoomAlder, AB/BBSharrol Bachas, John Hopkins University, 11:15 - 12:30Michelle Okoreeh MTAP Inactivation in Cancer 11:15 AMTimothy Borjas The Effect of Necrostatin-1 on Pancreatic Inflammation and Cancer 11:30 AMAndrei Smid Skp2 E3-ligase Inhibitors as Probes for Cell Cycle Analysis in Cancer 11:45 AMTimothy BrownNatalia Quijano-CardéLeaAnn LoveInsect Cell Expression and Purification of PTEN -- A Key Signaling Phosphataseand Tumor SuppressorMR-Visible Lipids as a Biomarker of Cell Stress in Prostate Cancer Cells TreatedWith Anticancer DrugsAfrican American Women and Triple Negative Breast Cancer: Examining theStigmas of Self Touching that Prevent Its Early DetectionAlder, AB/BBCiara Gimblet, University of Pennsylvania, 2:45 - 4:0012:00 PM12:15 PM12:30 PMRebecca de Frates The Role of Cdc42 in Cerebellar Granule Cell Development 2:45 PMMelissa Leung Efficacy of the novel JAK2 inhibitor G6, in Myeloproliferative Neoplasms 3:00 PMLiorimar Ramos MedinaShannon LitkeKathryn SanchezRole of Hyperacetylation of Histone H4K12 in Modulating Executive CognitiveFunctioning in Mice Exposed to Early Life StressNeurotensin Attenuates the Methamphetamine-Induced Increase inPhosphorylation of DARPP-32, Dopamine and cyclic AMP-RegulatedPhosphoprotein, Via the Nitric Oxide/cyclic GMP Signaling Pathway in StriatalNeurons of MiceAssessing Hippocampal Metabolism of MPS VII Mice by High ResolutionRespirometry3:15 PM3:30 PM3:45 PMCan Buldun The Effects of Haloperidol, Clozapine and Risperidone on Glutamatergic Synapses 4:00 PMAlder, AB/BBMaria Sacta, Weill Cornell Medical College, 4:45 - 5:45Ahmed Malik Role of Huntington’s Disease Protein in Translation 4:45 PMJulian RobyKaitland BrannonKafi FridayKasiemobi NwaedozieImmature Neuron Proliferation in Correlation to Cognition in Aging VervetMonkeysStyryl-Based Compounds as Novel Potential Therapeutic Agents for Alzheimer’sDiseaseUnderstanding the Mechanisms of Ceftriaxone-Dependent Regulation ofGlutamate Transport in the BrainMethamphetamine, Inflammation and the Ubiquitin/Proteasome Pathway: Impacton Neurodegeneration5:00 PM5:15 PM5:30 PM5:45 PMAspen I, AB/BBAndrew Drysdale, Weill Cornell Medical College, 11:15 - 12:30Angel Ortiz RodriguezJoshua ColeCristhian CadenaInterferon-gamma Mediated Degradation of HemeOoxygenase-1 (HO-1)Via Induction of the Immunoproteasome in Human Primary Macrophages:Implications for HIV Associated Neurocognitive DisorderElucidating the Modulatory Effects of Flaxseed-derived Lignans on ProteinExpression of Macrophage Co-receptors: Implications for HIV NeuroprotectionImpact of Defective Viral Genomes Sequence Modifications in TheirImmunostimulatory Activity11:15 AM11:30 AM11:45 AM

24 | Student Oral Presentations by ROOMErran Briggs IIIrene LeeMarilyn LeThe Study of the HIV-1 5’UTR Monomer-Dimer Equilibrium by Native SizeExclusion ChromatographyUse of Immune Complex Vaccine as a Novel Immunogen to Generate Broad HIV-1Neutralizing AntibodiesThe Effects of Reverse Transcriptase Inhibitors on LINE-1 RetrotransposonExpression in Human Fibroblasts12:00 PM12:15 PM12:30 PMAspen I, AB/BBTomas Meijome, University of Pennsylvania, 2:45 - 4:00Gifty Addae Investigating Novel Proteins And MicroRNAs In Leukemogenesis 2:45 PMGordon Pherribo Optimizing shRNA to Target Specific RNA-Binding Protein Transcripts 3:00 PMPhillip ThomasAn Unbiased Screen Identifies New Pf1 Interactors With Biological Significance inChromatin Modification and Transcriptional Control3:15 PMAdrian Rivera siRNA Library Screen of ZMYND11 Interacting Partners 3:30 PMNatalia HerreraOluwadara CokerGenerating an Antibody Against Retinoic Acid Receptor-Related Orphan ReceptorAlpha (Rora) to Define its Transcriptional TargetsInvestigating the Role of Non-Coding RNAs in Immunoglobulin Heavy ChainLocus Rearrangements3:45 PM4:00 PMAspen I, AB/BBIboro Umana, University of Chicago, 4:45 - 5:45Shenee’ MartinSean DoughertyJessica HartlingRosa LeonThe Study of TDP-1 and FUST-1 in C. elegans to Understand Their Role inAmyotrophic Lateral SclerosisHyperoxia Protects Against Isoflurane-induced Apoptosis in the Rat NeonatalBrainIron Responsive Element (IRE)-mRNA Conformation Changes Induced byManganese Ion (Mn2+)Buprenorphine’s Potential Antidepressant-like Effects on a Chronic Mild StressModel4:45 PM5:00 PM5:15 PM5:30 PMAspen II, AB/BBMonique Foster, New York University, 11:15 - 12:30Kevin De Jesus Elucidating a Mitochondrial Protective Transcriptional Network 11:15 AMKristian BlackDevelopment of Fluorescent RNA Biosensors for the Quantification of IntracellularMetabolites11:30 AMLaura Agosto-Rosa Signal-Induced Alternative Splicing in Primary T Cells and Cell Lines 11:45 AMLindsey BrierZakariyah Sharif-SidiAssessing the Effects of RNase H rRNA Depletion on Technical Variability in RNASequencing ExperimentsBioinformatic Analysis of the Transcription Factors Involved in Cochlear SynapseFormation12:00 PM12:15 PMCarlos Santos-Perez DAX1 and WT1: Novel Regulatros of the LHß Transcription 12:30 PMAspen II, AB/BBTeresa Ramirez, Brown University, 2:45 - 4:00Adewola OsunsadeDavys LopezKervin CharlesAssessing the Functionality of Protein Kinase C Isozymes Using Wildtype andConstitutively Active Forms of PKC-alpha and PKC-epsilonLocalization of the Polarity Regulator PAC-1 by Components of the Cadherin-Catenin ComplexA Role for R-Ras in Formation of HFS-LTP and Contextual DiscriminationLearning via Activation by RasGRF12:45 PM3:00 PM3:15 PM

Cultivating Excellence and Empowering Great Minds | 25James Damiano Mechanism of JAK2 Autoinhibition Identified by Molecular Dynamics Simulation 3:30 PMKaren RicoRelationship Between Acyl-CoA Thioesterase 7 and Saturated Fatty Acid-InducedJNK Activation3:45 PMNicholas Pizzi Analysis of Hey1 Expression in Lamprey Pharyngeal Arches 4:00 PMAspen II, AB/BBKendra Vann, Vanderbilt University, 4:45 - 5:45Catrina JohnsonContribution of the E74-Like Factor 3 to the Toll-Like Receptor-Driven CatabolicResponses in Articular Chondrocytes: Potential Role in Cartilage Destruction inOsteoarthritis4:45 PMJoseph Villanueva Joint Repair: Engineering Tissue Scaffolds Using Polyethylene Glycol Hydrogels 5:00 PMMacKenzie Taylor Novel Bisphosphonates and Osteoblast Differentiation and Mineralization 5:15 PMCarolina Lopez Regulation of the SYT-SSX2 Fusion Protein by t(X;18) in Synovial Sarcoma 5:30 PMJasmine AllenBelltown, HU/SS/PECory Hunter, Princeton University, 2:45 - 4:00Jemima GeorgesInvestigating the Potential for Myogenin to Promote the Amplification of MyHCExpressing Adenoviral VectorsAn Examination of the Impacts Prehistoric Cahokians Had on Their NaturalEnvironment5:45 PM2:45 PMDaniel Nissani Characterizing Forms of Mathematical Discourse 3:00 PMMichael RabadiExploring the Temporal Limits of Visual Processing of Familiar and UnfamiliarObjects at the Subordinate-Category Level3:15 PMMorgan Clark Not Just a Game: Racialization, Othering and Hypersex in Video Games 3:30 PMGuadalupe Gonzalez The Role of Gender and Stage of Acquisition in the Language Processing of L2 Learners 3:45 PMAlexandra JonesBelltown, HU/SS/PECraig Holloway, Yale University, 4:45 - 5:45Examining the Mind of a Student: How Unconscious Biases and HeuristicsInfluence Academic Decision-Making4:00 PMFartun Dirie Antenatal Care and Healthcare Access in Mozambique: An Issue of Spatial Inequality? 4:45 PMJustin Henderson Could Your DNA Soon Be in a Federal or State Database? 5:00 PMAshley Lowery Surveillance of Youth Tobacco Involvement Using Google Trends 5:15 PMCarlos Puentes Does Cognitive Vulnerability to Sleep Loss Relate to Mood Response? 5:30 PMDina Dajani Decreased Cerebro-Cerebellar Functional Connectivity in Autism 5:45 PMCove I, HU/SS/PELarry Perry, University of Virginia, 2:45 - 4:00Annecaroline ClarkDavid HutchinsonHarm Reduction in the United States: The Early Development of New York City’sSyringe and Needle Exchange Policy, 1985-1989All I Do Know Is That I Like Being Liked: Conceptualizing Same-Sex Desire inRichard Bruce Nugent’s “Gentleman Jigger”2:45 PM3:00 PMDayana De La Torre Drug Busts in New York City: Law Enforcement and Crime in the 1980s 3:15 PMAndrew TuckIdentifying Motivations for Medication Adherence in HIV-PositiveMethamphetamine-Using Men Who Have Sex With Men3:30 PMDanielle McColgan Historicizing Health Promotion: Anti-Drug Prevention in New York City From 1978-1989 3:45 PMWilliam Beischel Executive Functioning in Sexually Compulsive Gay and Bisexual Men 4:00 PM

26 | Student Oral Presentations by ROOMCove I, HU/SS/PEDaisy Camacho, UCLA, 4:45 - 5:45Dana MuñizThe Culture of Work: The Economy of the Sugar Mills and Company Towns at theCaribbean Basin in the 20th Century4:45 PMElsa Hardy Cultures of Power: Harlem Children’s Zone and Poverty Intervention Efforts 5:00 PMNoe LopezNykhala CostonPrincess BrownLiving In Between Nations: Discussing Mixtec Transnationalism in the UnitedStates and MexicoThe Public Perception of Interracial Dating varies as a Function of Prejudice,Environmental Diversity, and Racial IdentityThe Effects of Utilizing Rap Music in Underserved Classrooms to Improve StudentAcademic PerformanceCove II, HU/SS/PESarah Ohle, University of Colorado Boulder, 2:45 - 4:005:15 PM5:30 PM5:45 PMCarrie Moore Fitting into the Story: Western Romance and Blackness in Toni Morrison’s “Tar Baby” 2:45 PMEvan Coles The Literature of Black Marxism: A Critical Look at Religious Domination 3:00 PMLaura Ortiz Witchcraft and Gender in Shakespeare’s Tragedies and Histories 3:15 PMNikeeyia HowellPaul CatoDemystifying the Strangeness: An Intertextual Analysis of Mark Twain’s No.44,The Mysterious StrangerPolyphony, Responsibility, & Active Love: A Reconsideration of Dostoevsky’s andLévinas’ Philosophies of Love3:30 PM3:45 PMTyler Sharp Love Prejudice: An Underestimated Social Problem 4:00 PMCove II, HU/SS/PESimon Howard, Tufts University, 4:45 - 5:45Stanley CollinsSocial Capital Inside the Courtroom: An Analysis of the Networks That AssistYouth In Navigating the Juvenile Justice System4:45 PMSteven Jefferson China in the World: The Representation of Ethnic Minorities in the Media 5:00 PMTayler Ulmer African Immigration to America and the Tri-Concious Identity 5:15 PMTaelor Clay Impact of Stereotype Threat on Women and Minorities 5:30 PMAriel MosleyWhy Can’t I be Sexy, Smart, and Beautiful Enough?: Examining Women’sInternalization of Stigma5:45 PMElm I, AB/BBSofia Gayle, Yale University, 11:15 - 12:30Uchenna OkoroLuis Millán-BareaJoshua Rosario SepulvedaPauline XuStephanie CastilloArianna EspinozaCharacterization and Screening of Monoclonal Antibodies Targeting AbnormalProtein ConformationsFrancisella Infectivity Potentiator Protein B FipB, and FipA are ImportantProtectors Against Incorrect Disulfide Bond Formation Caused by Copper Stress inFrancisella novicidaStructure Analysis of Human Red Cell Spectrin Using HomobifunctionalCrosslinkers and High Resolution Mass SpectrometryQuantitative Phosphoproteomic Analysis Using High-Resolution Tandem MassSpectrometryDissecting Interactions Between BamA and BamD Via Binding and FluorescenceStudiesUsing Fluorescence Anisotropy to Understand How MARCKS-ED Peptide Binds toMicrovesicles11:15 AM11:30 AM11:45 AM12:00 PM12:15 PM12:30 PM

Cultivating Excellence and Empowering Great Minds | 27Elm I, AB/BBRhea Richardson, Stanford University, 2:45 - 4:00Bianca FloresThe Effects of Mycobacterium vaccae on Serotonergic Systems, Immune Activation,and Behavior in the Forced Swim Test2:45 PMStephanie Rivera Morales Plasmodium falciparum Strain Specific Malaria Infection Symptoms and Immunity 3:00 PMTasnia Ali Role of ITGAD in Early Activation of Memory CD4+ T Cells 3:15 PMOnyemaechiNwanaji-EnweremThe Biological Significance of Soluble Co-Inhibitory Receptors, B-/T-LymphocyteAttenuator (BTLA), and its Ligand, Hepatitis Virus Entry Protein (HVEM), in theDevelopment of Sepsis in Mice3:30 PMJaime Aponte Impact of RAGE Deletion and Mitochondrial Biogenesis 3:45 PMMichael Okoreeh Novel Regulators of Early B Cell Survival and Proliferation 4:00 PMElm I, AB/BBCarlos Vera, University of Colorado Boulder, 4:45 - 5:45Damla GonulluThe Association Between Peripheral Blood Leukocyte Telomere Length and FemaleReproductive Aging4:45 PMFei Peng The Role of Aldosterone in Endothelial Cell Migration 5:00 PMJoshua Taliaferro Utilizing Microfluidics to Study Platelet Activity and Thrombus Formation In Vitro 5:15 PMElshaddai Ephrem Role of IRF1 in Lupus: Defining Downstream Targets 5:30 PMFelipe Giuste Elucidating the Role of Neuromedin U Receptor in Erythropoiesis 5:45 PMElm II, AB/BBPrincess Gilbert, UCLA, 11:15 - 12:30Camila UechiBabajide OluwadareJavier Sierra-PagánInvestigating the Mechanisms of Atrial Fibrillation Through the Use ofComputational Human Atrial ModelsDetermining the Contribution of Fibroblast Connexin Expression to theConduction Properties of Injured Cardiac TissueCharacterization of the Role of Hdac3 and Hopx in Cardiac Cell Differentiation InVitro11:15 AM11:30 AM11:45 AMRajshekhar Basak The Mechanism of Acrolein-Induced Lung Endothelial Permeability 12:00 PMKyle TuckerSaiah YatesElm II, AB/BBSantas Rosario, University of Miami, 2:45 - 4:00Cell Cycle Effects of Delta Np63 alpha and SAMD9L on Lung Squamous CellCarcinomaPhosphorylation of Threonine 45 of Histone H3 and the Effects of Alanine andAspartic Acid Mutations12:15 PM12:30 PMRyan Spector The Role of CDC25A in Neuronal Apoptosis 2:45 PMMayra RiosRaquel TrippPhillip StephensExpression Level of Transient Receptor Potential Vanilloid-4 (TRPV4) in MiceDuring Lung DevelopmentSeparation of Maternal and Fetal Components of Products of Conception (POC)Using Laser Capture Microdissection and Evaluation of Direct PCR for PaternityTesting in Sexual Assault CasesUnderstanding the Genetic Pathways Controlling Foraging Behavior in C. ElegansUsing Double Mutant Analysis3:00 PM3:15 PM3:30 PMClaudia Lovell The Role of BET Proteins in Embryonic Stem Cell Fate Decisions 3:45 PMSarah SchraderModeling IDH1 Mutations in Neural Cell Types Derived from Human EmbryonicStem Cells4:00 PM

28 | Student Oral Presentations by ROOMElm II, AB/BBZakiya Whatley, Duke University, 4:45 - 5:45Jere` Hutson Purification and Characterization of TAT-Cre for Ex Vivo Gene Deletion 4:45 PMJose Grullon Functional Analysis and Localization of NIS, MCT1, and MCT4 Proteins 5:00 PMBao Ying ChenDefining Protein Phosphatase 2A Complexes and Substrates That Regulate EthyleneBiosynthesis in Arabidopsis5:15 PMCristina Castro-Rivera Endosomal Recycling of KATP Channels: The Role of EHD Proteins 5:30 PMMichael Snyder Inducible, Reversible Depletion of Endogenous Proteins in Mammalian Cells 5:45 PMGlen I, AB/BBMichael Burel, New York University, 11:15 - 12:30Folasade Sofela Effects of Hypoxia on gamma-Secretase Activity in Neuronal Cells 11:15 AMKelsey Wanhainen Structural and Biophysical Studies of TREM2 in Neurological Diseases 11:30 AMAlicia SanchezArginine Vasopressin Neurons in Suprachiasmatic Nucleus of Transgenic MiceDeficient in FGF8 and FGFR111:45 AMAmy Zhang A Quirky Inhibitory Circuit in the Cerebral Cortex 12:00 PMRobert MyersMadeline PelzGlen I, AB/BBKevin Leclerc, Columbia University, 2:45 - 4:00Neoplastic Transformation of Neural Precursor Cells to Model GlioblastomaMultiforme (GBM)Imaging and Characterization of Hippocampal Circuits Implicated in TemporalLobe Epilepsy12:15 PM12:30 PMClaudio Macias Self-assembled Supramolecular Nanobelts for Antibiotic Delivery 2:45 PMRaymond Barry The Effects of the Microbiome on Health and Disease 3:00 PMSydney LomnesHost and Parasite Communities: How Interactions Between Chaetogaster limnaeiand Echinostoma sp. Affect Snail Hosts3:15 PMDaniel Guzman Analysis of the IgE Response in Nippostrongylus Brasiliensis-Infected Mice 3:30 PMAvani Comer Functional Analysis of Crohn’s Disease and Mycobacteria in Ashkenazi Jews 3:45 PMVaughn SpurrierGlen I, AB/BBAshley Schloss, Yale University, 4:45 - 5:45Amber ShafferNMR Studies of the Q5A, G6S Unmyristylated Feline Immunodeficiency VirusMatrix ProteinDoes Depression Lead to Incident Diabetes in African Americans?: The JacksonHeart Study4:00 PM4:45 PMMatthew Gonzalez The Role of UCP1 and IAPP in the Progression of Diabetes 5:00 PMNakul Talathi NRF2 Expression in Diabetic Wound Healing Tissue 5:15 PMImaani EasthausenSynthesis of a Multimodal Imaging Agent for the Visualization of Pancreatic BetaCells in vivo5:30 PMNicholas Hernandez Effects of Post-Translation Modifications on Rate of BACE1 Internalization 5:45 PMGlen II, AB/BBMercedes Burns, University of Maryland, Baltimore County, 11:15 - 12:30Aja Crim-Logan Computer Based Treatment for Cognitive Behavioral Therapy 11:15 AMIsabel MorganSocioeconomic Status and Child Cognitive Outcomes at Age 7; Maternal Cortisol asa Possible Mediator11:30 AMZoe Spafford The Spacial Organization of Skilled Behavior Within an Identified Neural Circuit 11:45 AM

Cultivating Excellence and Empowering Great Minds | 29Bryan MoralesDiana NwokoyeAssessing the Effects of Sleep Homeostasis in Activity-Dependent Plasticity:The Spatiotemporal Expression of Plasticity-Related Proteins Within a SleepDeprivation Study Using the Model Organism Mus musculusSpatial and Temporal Expression Patterns of MBD2: Protein Implicated in AutisticlikePhenotypes12:00 PM12:15 PMSandy Chan Effect of Aspirin on Microhemorrhage Diameters in Rodent Brains 12:30 PMGlen II, AB/BBDiana Lizarazo, Brown University, 2:45 - 4:00LaTonya Simon Synthesis and Characterization of Photodegradable Oxime Derived Microparticles 2:45 PMAndrea Shergalis Stabilities of Rhenium Complexes Formed by N2S2 and N3S Ligands 3:00 PMBosoye Olateru-Olagbegi The Use of Sodium Nitrite in the Reversal of Vascular Dysfunction 3:15 PMAida AlazarA Small Molecule Screen To Identify Modulators Of C-cell Development InZebrafish Embryos3:30 PMOsaze Udeagbala Searching for Drug Leads: A Live Cytotoxicity Assay Against Giardia lamblia 3:45 PMMarco Carpenter Identifying Schizophrenia Associated Gene Targets of the Transcription Factor c-myb 4:00 PMGlen II, AB/BBJenniffer Stetler, University of Missouri-Columbia, 4:45 - 5:45Javier CastilloThe Effect of Innate Immune Modulation via Toll-Like Receptor 9 on theAmelioration of Cerebral Amyloid Angiopathy in Alzheimer’s Disease4:45 PMUgomma Eze Requirement of FUS in mES-Derived Motor Neuron Survival; Implications for ALS 5:00 PMAaron NealmRNA Expression of Clock Genes Per1 and Bmal in the Hippocampus and theAmygdala5:15 PMAndrew Morton Targeting HSR1 Affects the Heat Shock Response in Human Brain Cancer Cells 5:30 PMDebria Joe BACE1 Localization and Trafficking in Neurons 5:45 PMGlen III, AB/BBAngel Byrd, Brown University, 11:15 - 12:30Hayford Agyemang Myelination and Pediatric SIV (Simian Immunodeficiency Virus) 11:15 AMJeffrey LueryCecile GastonRachel LeeDiurnal Changes of Neuron Excitability Within the Suprachiasmatic Nucleus UsingVoltage-Sensitive Dye ImagingNovel Role of the Neuronal Guidance Cue, Netrin-1 in Abdominal AorticAneurysm FormationUltrasonic Actuation Reduces Brain Inflammatory Response to NeuralMicroelectrode Insertion11:30 AM11:45 AM12:00 PMEmilio Soto The Role of Sensory Cortex in Cue-induced Relapse to Drug Addiction 12:15 PMEphrath TesfayeChanges in the Synaptic Plasticity of the Hypothalamic Paraventricular NucleusFollowing Hypertension in the AOF Menopausal Mouse ModelGlen III, AB/BBJoan Marcano, University of Colorado Boulder, 2:45 - 4:00Daniel PowellSelamawi TilahunElucidating Cellular and Molecular Mechanisms of Estrogen Dependent TAF4BUpregulationAnalysis of Sperm Telomere Length in Men With Clinical Infertility and ItsExtensive Variation Within Specimens12:30 PM2:45 PM3:00 PMCarolina Larrain Characterization of Ontogenetic Columns in Reeler Mice 3:15 PMRochelle SadeghiSpontaneous Changes in Immortalized Mammalian Cell Lines Result in CellCompetition3:30 PM

30 | Student Oral Presentations by ROOMSherry Gee Role of ANO-1 in Endothelial Cell Proliferation and Migration 3:45 PMJoshua Frenster Fluorescent Reporter System for Directing Hematopoietic Lineage Specification 4:00 PMGlen III, AB/BBCiara Torres Vargas, Columba University, 4:45 - 5:45Kathryn WuKristen BascombeHypermethylation of CpG Sites Upstream of Hexanucleotide Repeat Expansions inthe C9ORF72 Gene of ALS and FTD PatientsDetermining the Source of and Maximizing the Yield from DNA on TouchedObjects by Microscopic Visualization and Direct PCR4:45 PM5:00 PMNicole Bowman High Fat Diet Drives Epigenetic Changes: A Role for DNA Methyltransferase 5:15 PMShanira SuazoOrnella RutagaramaDevelopment of Bioorthogonal Profiling of DNA Methylation (BPDM) Technologyto Study the Mechanisms of DNA-Methyltransferases in the Epigenome.Detection and Analysis of Genomic Mutations Linked to APOBEC-MediatedCytidine DeaminationGlenbrook, PS/EN/ESJose Solis, University of Colorado Boulder, 2:45 - 4:005:30 PM5:45 PMAisha Dorta A Quantitative Analysis of the Biological Terraformation of a Planet 2:45 PMCorie Jade Carter Microbial Ecology of Biological Nitrogen Fixation in MT Soils 3:00 PMTimothy SalazarFranklinRoman-RodriguezJoseph GeraghtyAnalyzing Biocontrol Capability; Mecinus janthiniformis and Linaria dalmatica: ABlessed Communion? (ABCs of Weevils and Toadflax)Bacterial Cultures From Tadpoles of the Bullfrog Lithobates catesbeianus(Previously Rana catesbeiana)Synthesis of Enantiopure Nantenine Analogs as Serotonin 5-HT2A ReceptorAntagonists3:15 PM3:30 PM3:45 PMMichael Hawkins Using Ultraviolet Light to Inactivate the Bacteriophage MS2 4:00 PMHigh Ridge, PS/EN/ESBrittny Davis, University of Maryland, Baltimore County, 2:45 - 4:00Anna Stephenson Manipulating Atoms to Create Artificial Materials 2:45 PMAlexis MorrisPeter LowrieMelissa KreiderJayilssa TorresDescription of the Behaviors and Electron Correlation in LaNiO3 and NdNiO3Through First Principles TheoryX-Ray Vision: Using X-Ray Interference Patterns to Track the Growth of SiliconOxide LayersSynthesis of a Dense, High Aspect Ratio Zinc Oxide Nanowire Forest Using the PS-PMMA Block CopolymerCo and Zr oxides/ Si (001) Epitaxial Growth and Surface Analysis: Ultra HighVacuum System Validation3:00 PM3:15 PM3:30 PM3:45 PMLena Ibrahim Effects of Rigidity of Bent-Core Liquid Crystal Spacer Groups 4:00 PMLong Ridge, PS/EN/ESDennis Gardner Jr., University of Colorado Boulder, 2:45 - 4:00George Torres Deconstructing Graphs and Their Eigenspectra 2:45 PMDorcas Huang Modeling Cellular Response to Nanopatterned Bulk Metallic Glasses 3:00 PMHassan OmarDevelopment of Bulk Metallic Glasses and Experimental Calibration of BlowMolding Procedures3:15 PMJana Dodson SEM and EDS Characterization of Bulk Metallic Glass 3:30 PMRebecca Betances Cellular Responses to Nanopatterned Bulk Metallic Glasses 3:45 PM

Cultivating Excellence and Empowering Great Minds | 31Alexander BruchHigh Finesse Cavity for Characterizing the Optical Loss in Thin Films of BariumTitanate4:00 PMSpringdale I, HU/SS/PEAmaury Sosa, New York University, 2:45 - 4:00Darien Pollock 21st Century American Street Philosophy and the Philosophy of Mass Incarceration 2:45 PMHenry Capps IIIThe Prison Tragedy: The Failure of Narcotics Criminalization in New York City’sWar on Drugs3:00 PMGabriel Augusto Sanchez Poverty and Race in the United States 3:15 PMEmily Rogers“Invisible Wounds” or Invisible Politics? Neoliberalism, Post-Traumatic StressDisorder, and Imagined US Vulnerability in the “War on Terror”3:30 PMDonald Brown Universalism, Particularism, and the Limits Therein: Post-World War II Politics on Race 3:45 PMEmily Artalejo Female Paramilitary Experience in Northern Ireland 4:00 PMSpringdale I, HU/SS/PEFelicia Moralez, University of Notre Dame, 4:45 - 5:45Viviana Rivera-BurgosDid Hurricane Sandy Dent the Vote? Evidence From a Large-Scale Study in NewYork City4:45 PMN’Kosi Oates Geographic Neighborhood Poverty and Political Participation 5:00 PMPrincess Williams Are More Women Needed in the Congressional Black Caucus? 5:15 PMMarlen Rosas Protest in Perspective: Prospects of Continuity in Popular Mobilizations in Brazil 5:30 PMAlfonso PachecoPolitical Opinion and Congress: A Study on the Failure of ComprehensiveImmigration Reform5:45 PMSpringdale II, HU/SS/PECory Hunter, Princeton University, 12:30Andrew AnguianoThe Economy of Online Courtship: Memoirs of Desperation and Fabrication inInternet-Mediated Dating12:30 PMSpringdale II, HU/SS/PEColleen Tripp, Brown University, 2:45 - 4:00Melisa RojasPrincess CobbsExamining Reciprocal Communication in Youth with Autism Spectrum DisordersFollowing a Peer-Mediated Theatre InterventionHealth Care Utilization by Young Adults That Have Been Affected by the CriminalJustice System Compared to Those That Have Not2:45 PM3:00 PMJillian Haynes Candidate Physiological Markers of Perceived Stress 3:15 PMRafael Perez The Effects of Social Stress on HDAC6-Related Proteins 3:30 PMShayna McCormack Bipolar Disorder and Medicinal Nonadherence 3:45 PMCoralie PardoSpringdale II, HU/SS/PEDevon Wade, Columbia University, 4:45 - 5:45Veronica Rivera-NegronKatryna MahoneySex Differences in CREB Expression After Administration of Cocaine,Methamphetamine, and Cannabinoids(De)Composing the Self: Embodied Imagery, Theatrical Space and Gender in thePerformance of Teresa HernándezBlack Activists in ‘White Africa’: Exploring sub-Saharan Migrant-Activism inMorocco4:00 PM4:45 PM5:00 PMMario Castillo Kill/Capture: The Chichimec War in North Central Mexico, 1550-1600 5:15 PM

32 | Student Oral Presentations by ROOMGillian WoodThe Dangers of Expectant Evaluation: The Problem of Judgment in WashingtonSquare and The Portrait of a Lady5:30 PMAurora Llamas Re-thinking Cultural Values: A Philosophical Approach to Socialized Inequality 5:45 PMWaterside, HU/SS/PEJewell Debnam, Columbia University, 4:45 - 5:45Cynthia GarciaReclaiming Space and Preserving Cultural History in the Mission District of SanFrancisco2:45 PMLauren Highsmith The Divide: Modernism and Afro-Modernism 3:00 PMSade WilliamsYaritza PerezAm I Who I Say I Am or What They Say I Am?: Identity Construction in JuvenileCourtroom ProceedingsLearned Helplessness or Tradition: An Examination of the TransgenerationalUse and Perspective of Corporal Punishment and Authoritarianism in AfricanAmerican and Hispanic Families3:15 PM3:30 PMSagirah Wheeler Words of Encouragement: Listening to the Past in Order to Prepare for the Future 3:45 PMMatthew McCauley Talking About God: A Univocal Approach 4:00 PMWaterside, HU/SS/PENarayani Lasala, Princeton University, 2:45 - 3:45Miata Rogers The Effect of Academic Resources on College Retention Rates 4:45 PMStephon RichardsonHailey NeubauerBrian WalshMark HarrisWestover, PS/EN/ESJenn Demers, Dartmouth College, 2:45-4:00The Black New Left: African-American Radical Groups of the Late 1950s to theEarly ‘60sThe Influence of the War on Drugs on Felons’ Voting Rights Legislation and VoterTurnout in the SouthThe Association Between Juvenile Arrest, Health Insurance, and Health CareUtilizationJuvenile Socialization and Courtroom Interactions: A Qualitative Analysis of ClientOutcomes5:00 PM5:15 PM5:30 PM5:45 PMMary Ng Characterizing Precipitation in East Africa 2:45 PMBrian Matilla Convection Initiation along the Rocky Mountain Front Range 3:00 PMMiguel FriasMaxwell KessellyStephen VicchioKevin TrujilloWestover, PS/EN/ESJose Solis, University of Colorado Boulder, 4:45-5:00Seismic Soil Structure Interaction and Lateral Earth Pressures Near Buried WaterReservoir Structures in Southern CaliforniaUtilization of Solar Energy in Residential Homes to Achieve Complete Net-ZeroEnergy Solar HomesA Combinatorial Study of the Dealloying of Au/Ag/Pd Metal Alloys For ImprovedFuel Cell CatalystsDeveloping Photovoltaic Cells Using Semiconducting Polymers – Novel Methods ofHarvesting Solar Energy3:15 PM3:30 PM3:45 PM4:00 PMStellJo Passes Radon Project 4:45 PMIsatis Cintron Real Time in situ Source Characterization for BC in Total Aerosol 5:00 PM

Cultivating Excellence and Empowering Great Minds | 33Oral Presentations by NameGifty Addae......................................2:45 PM, Aspen IPresentation Title: Investigating Novel Proteins AndMicroRNAs In LeukemogenesisResearch Mentor: Christina SpevakResearch Institution: Weill Cornell Medical CollegeHome Institution: UMass BostonCo-Authors: Christopher Park and Christina Spevak,Weill Cornell/Rockefeller/Sloan-KetteringTri-InstitutionalBBLaura Agosto-Rosa......................11:45 AM, Aspen IIPresentation Signal-Induced Alternative Splicing inPrimary T Cells and Cell LinesResearch Mentor: Kristen LynchResearch Institution: University of PennsylvaniaHome Institution: UPR-Rio PiedrasCo-Authors: Kristen W. Lynch, Nicole M. Martínez andMichael Mallory, University of PennsylvaniaBBHayford Agyemang.......................11:15 AM, Glen IIIPresentation Title: Myelination and Pediatric SIV(Simian Immunodeficiency Virus)Research Mentor: Mark BurkeResearch Institution: Howard UniversityHome Institution: Gordon State CollegeCo-Authors: Mark Burke, Howard UniversityABAida Alazar.......................................3:30 PM, Glen IIPresentation Title: A Small Molecule Screen ToIdentify Modulators Of C-cell DevelopmentIn Zebrafish EmbryosResearch Mentor: Jacques VillefrancResearch Institution: Cornell UniversityHome Institution: Brown UniversityCo-Authors: Jacques Villefranc, Viviana Anelli andYariv Houvras, Weill Cornell/Rockefeller/Sloan-Kettering Tri-InstitutionalABTasnia Ali............................................. 3:15 PM, Elm IPresentation Title: Role of ITGAD in Early Activationof Memory CD4+ T CellsResearch Mentor: Ciara TorresResearch Institution: Columbia UniversityHome Institution: Rochester Institute of TechnologyCo-Authors: Donna Farber and Naomi Yudanin,Columbia UniversityABJasmine Allen................................. 5:45 PM, Aspen IIPresentation Title: Investigating the Potential forMyogenin to Promote the Amplification of MyHCExpressing Adenoviral VectorsResearch Mentor: Leslie LeinwandResearch Institution: University of Colorado BoulderHome Institution: University of South FloridaCo-Authors: Stephen Langer and Leslie Leinwand,University of Colorado at BoulderBBAndrew Anguiano................12:30 PM, Springdale IIPresentation Title: The Economy of Online Courtship:Memoirs of Desperation and Fabrication inInternet-Mediated DatingResearch Mentor: Wendy AndersonResearch Institution: Washington University in St. LouisHome Institution: San Jose State UniversityHUJaime Aponte....................................... 3:45 PM, Elm IPresentation Title: Impact of RAGE Deletion andMitochondrial BiogenesisResearch Mentor: Ravichandran RamasamyResearch Institution: New York UniversitySackler InstituteHome Institution: UPR-MayaguezCo-Authors: Ravichandran Ramasamy, RadhaAnanthakrishnan and Ann Marie Schmidt, NewYork University - BioMedical SciencesBBEmily Artalejo.......................... 4:00 PM, Springdale IPresentation Title: Female Paramilitary Experiencein Northern IrelandResearch Mentor: Brendan O’LearyResearch Institution: University of PennsylvaniaHome Institution: Saint Mary’s UniversityCo-Authors: Brendan O’Leary, Universityof PennsylvaniaSSRaymond Barry................................ 3:00 PM, Glen I5Presentation Title: The Effects of the Microbiomeon Health and DiseaseResearch Mentor: Martin BlaserResearch Institution: New York UniversitySackler InstituteHome Institution: University of North CarolinaChapel HillCo-Authors: Martin Blaser and Guillermo Perez-Perez,New York University - BioMedical Sciences; TadasuIizumi, New York University - Arts & SciencesAB

34 | Student Oral Presentations by NAMERajshekhar Basak.............................12:00 PM, Elm IIPresentation Title: The Mechanism of Acrolein-InducedLung Endothelial PermeabilityResearch Mentor: Sharon RoundsResearch Institution: Brown UniversityHome Institution: City College of New YorkCo-Authors: Qing Lu, Sharon Rounds and JulieNewton, Brown UniversityBBKristen Bascombe........................... 5:00 PM, Glen IIIPresentation Title: Determining the Source of andMaximizing the Yield from DNA on TouchedObjects by Microscopic Visualization andDirect PCRResearch Mentor: Grace Axler-DiPerteResearch Institution: New York UniversitySackler InstituteHome Institution: University of GeorgiaCo-Authors: Georgia Grace Axler-DiPerte, New YorkCity Office of Chief Medical ExaminerABWilliam Beischel................................4:00 PM, Cove IPresentation Title: Executive Functioning in SexuallyCompulsive Gay and Bisexual MenResearch Mentor: Jeffrey ParsonsResearch Institution: Hunter CollegeHome Institution: Loyola University of ChicagoCo-Authors: Jeffrey Parsons, Ana Ventuneac and LeonaHess, Hunter CollegeSSRebecca Betances...................... 3:45 PM, Long RidgePresentation Title: Cellular Responses to NanopatternedBulk Metallic GlassesResearch Mentor: Jagannath PadmanabhanResearch Institution: Yale UniversityHome Institution: UPR-MayaguezCo-Authors: Themis Kyriakides and JagannathPadmanabhan, Yale UniversityENKristian Black...............................11:30 AM, Aspen IIPresentation Title: Development of Fluorescent RNABiosensors for the Quantification of IntracellularMetabolitesResearch Mentor: Robert BateyResearch Institution: University of Colorado BoulderHome Institution: Louisiana State University-Baton RougeCo-Authors: Robert Batey and Joan Marcano-Velázquez, University of Colorado at BoulderBBTimothy Borjas................................ 11:30 AM, AlderPresentation Title: The Effect of Necrostatin-1 onPancreatic Inflammation and CancerResearch Mentor: George MillerResearch Institution: New York University SacklerInstituteHome Institution: University of PennsylvaniaCo-Authors: George Miller and Lena Tomkoetter,New York University - BioMedical SciencesABNicole Bowman............................... 5:15 PM, Glen IIIPresentation Title: High Fat Diet Drives EpigeneticChanges: A Role for DNA MethyltransferaseResearch Mentor: Teresa ReyesResearch Institution: University of PennsylvaniaHome Institution: Bryn Mawr CollegeCo-Authors: Teresa Reyes, Nicola Grissom and JeeseCarlin, University of PennsylvaniaABKaitland Brannon...............................5:15 PM, AlderPresentation Title: Styryl-Based Compounds as NovelPotential Therapeutic Agents for Alzheimer’sDiseaseResearch Mentor: Thomas WisniewskiResearch Institution: New York UniversitySackler InstituteHome Institution: Xavier University of LouisianaCo-Authors: Thomas Wisneiwski, Shan Liu and EileenDo, New York University - BioMedical SciencesABLindsey Brier................................ 12:00 PM, Aspen IIPresentation Title: Assessing the Effects of RNase HrRNA Depletion on Technical Variability in RNASequencing ExperimentsResearch Mentor: John HogeneschResearch Institution: University of PennsylvaniaHome Institution: University of HoustonCo-Authors: John Hogenesch and Nicholas Lahens,University of PennsylvaniaBBErran Briggs II...............................12:00 PM, Aspen IPresentation Title: The Study of the HIV-1 5’UTRMonomer-Dimer Equilibrium by Native SizeExclusion ChromatographyResearch Mentor: Michael SummersResearch Institution: University of Maryland, Baltimore CountyHome Institution: Kalamazoo CollegeCo-Authors: Erran D. Briggs, Kalamazoo College; SarahA. Monti and Michael F. Summers, University ofMaryland, Baltimore CountyBB

Cultivating Excellence and Empowering Great Minds | 35Donald Brown.......................... 3:45 PM, Springdale IPresentation Title: Universalism, Particularism, and theLimits Therein: Post-World War II Politics on RaceResearch Mentor: Vaughn RasberryResearch Institution: Stanford UniversityHome Institution: Vaughn Rasberry, StanfordUniversity School of Humanities & SciencesHUPrincess Brown..................................5:45 PM, Cove IPresentation Title: The Effects of Utilizing Rap Musicin Underserved Classrooms to Improve StudentAcademic PerformanceResearch Mentor: Constance EllisonResearch Institution: Howard UniversityHome Institution: Claflin UniversityCo-Authors: Constance Ellison, Howard UniversitySSTimothy Brown.................................12:00 PM, AlderPresentation Title: Insect Cell Expression andPurification of PTEN -- A Key SignalingPhosphatase and Tumor SuppressorResearch Mentor: Mario AmzelResearch Institution: Johns Hopkins UniversityHome Institution: University of Texas at El PasoCo-Authors: Andres Hernandez, Sandra Gabelli andL. Mario Amzel, Johns Hopkins UniversityBBAlexander Bruch....................... 4:00 PM, Long RidgePresentation Title: High Finesse Cavity forCharacterizing the Optical Loss in Thin Filmsof Barium TitanateResearch Mentor: Hong TangResearch Institution: Yale UniversityHome Institution: Elon UniversityCo-Authors: Hong Tang, Xiankai Sun and Xu Han, YaleUniversityENCan Buldun.........................................4:00 PM, AlderPresentation Title: The Effects of Haloperidol,Clozapine and Risperidone on GlutamatergicSynapsesResearch Mentor: Edward ZiffResearch Institution: New York UniversitySackler InstituteHome Institution: Jacobs University BremenCo-Authors: Edward Ziff, New York University -BioMedical SciencesBBCristhian Cadena.......................... 11:45 AM, Aspen IPresentation Title: Impact of Defective ViralGenomes Sequence Modifications in TheirImmunostimulatory ActivityResearch Mentor: Carolina LopezResearch Institution: University of PennsylvaniaHome Institution: Sam Houston State UniversityCo-Authors: Carolina B. López, Xiomara Mercado-López and Yan Sun, University of PennsylvaniaBBHenry Capps III....................... 3:00 PM, Springdale IPresentation Title: The Prison Tragedy: The Failureof Narcotics Criminalization in New York City’sWar on DrugsResearch Mentor: Samuel RobertsResearch Institution: Columbia UniversityHome Institution: University of South CarolinaCo-Authors: Samuel K. Roberts, Columbia UniversityHUMarco Carpenter...............................4:00 PM, Glen IIPresentation Title: Identifying Schizophrenia AssociatedGene Targets of the Transcription Factor c-mybResearch Mentor: Jerry StitzelResearch Institution: University of Colorado BoulderHome Institution: Clark UniversityCo-Authors: Jerry Stitzel and Coral Cabrera-Montalvo,University of Colorado at BoulderBBCorie Jade Carter....................... 3:00 PM, GlenbrookPresentation Title: Microbial Ecology of BiologicalNitrogen Fixation in MT SoilsResearch Mentor: John PetersResearch Institution: Montana State University-BozemanHome Institution: University of Great FallsCo-Authors: John Peters, Ambrien Risingsun andLaura B., Montana State UniversityPSJavier Castillo....................................4:45 PM, Glen IIPresentation Title: The Effect of Innate ImmuneModulation via Toll-Like Receptor 9 on theAmelioration of Cerebral Amyloid Angiopathyin Alzheimer’s DiseaseResearch Mentor: Thomas WisniewskiResearch Institution: New York UniversitySackler InstituteHome Institution: Paris 7 UniversityCo-Authors: Thomas Wisniewski and Henrieta Scholtzova,New York University - BioMedical SciencesAB

36 | Student Oral Presentations by NAMEMario Castillo.........................5:15 PM, Springdale IIPresentation Title: Kill/Capture: The Chichimec Warin North Central Mexico, 1550-1600Research Mentor: Mark LycettResearch Institution: University of ChicagoHome Institution: CSU Dominguez HillsCo-Authors: Mark Lycett and Madeline McLeester,University of ChicagoSSStephanie Castillo............................. 12:15 PM, Elm IPresentation Title: Dissecting Interactions BetweenBamA and BamD Via Binding and FluorescenceStudiesResearch Mentor: Marcelo SousaResearch Institution: University of Colorado BoulderHome Institution: University of Central FloridaCo-Authors: Marcelo Sousa, University of Coloradoat BoulderBBCristina Castro-Rivera......................5:30 PM, Elm IIPresentation Title: Endosomal Recycling of KATPChannels: The Role of EHD ProteinsResearch Mentor: William CoetzeeResearch Institution: New York UniversitySackler InstituteHome Institution: UPR-MayaguezCo-Authors: Monique Foster and William Coetzee,New York University - Arts & SciencesBBPaul Cato.......................................... 3:45 PM, Cove IIPresentation Title: Polyphony, Responsibility, & ActiveLove: A Reconsideration of Dostoevsky’s andLévinas’ Philosophies of LoveResearch Mentor: Richard RosengartenResearch Institution: University of ChicagoHome Institution: Swarthmore CollegeCo-Authors: Richard Rosengarten, Universityof ChicagoPESandy Chan.....................................12:30 PM, Glen IIPresentation Title: Effect of Aspirin onMicrohemorrhage Diameters in Rodent BrainsResearch Mentor: Chris SchafferResearch Institution: Cornell UniversityHome Institution: Cornell UniversityCo-Authors: Morgan Brophy, Chris Schaffer andNozomi Nishimura, Cornell UniversityABKervin Charles............................... 3:15 PM, Aspen IIPresentation Title: A Role for R-Ras in Formation ofHFS-LTP and Contextual Discrimination Learningvia Activation by RasGRF1Research Mentor: Michael DarcyResearch Institution: Tufts University BioMedical SciencesHome Institution: Michaeal Darcy and Larry Feig, TuftsUniversity School of Graduate Biomedical SciencesBBBao Ying Chen...................................5:15 PM, Elm IIPresentation Title: Defining Protein Phosphatase 2AComplexes and Substrates That Regulate EthyleneBiosynthesis in ArabidopsisResearch Mentor: Alison DeLongResearch Institution: Brown UniversityHome Institution: Grinnell CollegeCo-Authors: Matthew Booker, Victoria Cabotand Alison DeLong, Brown UniversityBBIsatis Cintron................................ 5:00 PM, WestoverPresentation Title: Real Time in situ SourceCharacterization for BC in Total AerosolResearch Mentor: Darin TooheyResearch Institution: University of Colorado BoulderHome Institution: UPR-Rio PiedrasCo-Authors: Darin Toohey, University of Coloradoat BoulderESAnnecaroline Clark...........................2:45 PM, Cove IPresentation Title: Harm Reduction in the UnitedStates: The Early Development of New York City’sSyringe and Needle Exchange Policy, 1985-1989Research Mentor: Samuel RobertsResearch Institution: Columbia UniversityHome Institution: Smith CollegeCo-Authors: Samuel K. Roberts, Columbia UniversityHUMorgan Clark................................ 3:30 PM, BelltownPresentation Title: Not Just a Game: Racialization,Othering and Hypersex in Video GamesResearch Mentor: Karen Jackson-WeaverResearch Institution: Princeton UniversityHome Institution: Spelman CollegeCo-Authors: Karen Jackson-Weaver,Princeton UniversitySS

Cultivating Excellence and Empowering Great Minds | 37Taelor Clay....................................... 5:30 PM, Cove IIPresentation Title: Impact of Stereotype Threaton Women and MinoritiesResearch Mentor: Greg WaltonResearch Institution: Stanford UniversityHome Institution: Morgan State UniversityCo-Authors: Gregory Walton and Lauren Aguilar,Stanford University School of Humanities& SciencesHUPrincess Cobbs........................3:00 PM, Springdale IIPresentation Title: Health Care Utilization by YoungAdults That Have Been Affected by the CriminalJustice System Compared to Those That Have NotResearch Mentor: Christopher WildemanResearch Institution: Yale UniversityHome Institution: Chaminade University of HonoluluCo-Authors: Christopher Wildeman and Emily Wang,Yale UniversitySSOluwadara Coker.............................4:00 PM, Aspen IPresentation Title: Investigating the Role ofNon-Coding RNAs in ImmunoglobulinHeavy Chain Locus RearrangementsResearch Mentor: Uttiya BasuResearch Institution: Columbia UniversityHome Institution: Rochester Institute of TechnologyCo-Authors: Uttiya Basu, Gerson Rothschild andJunghyun Lim, Columbia UniversityABJoshua Cole.................................... 11:30 AM, Aspen IPresentation Title: Elucidating the Modulatory Effectsof Flaxseed-derived Lignans on Protein Expressionof Macrophage Co-receptors: Implications forHIV NeuroprotectionResearch Mentor: Jennifer KingResearch Institution: University of PennsylvaniaHome Institution: Boston UniversityCo-Authors: Jennifer King, Melpo Christofidou-Solomidou and Kelly L. Jordan-Sciutto,University of PennsylvaniaABEvan Coles........................................ 3:00 PM, Cove IIPresentation Title: The Literature of Black Marxism: ACritical Look at Religious DominationResearch Mentor: Karen Jackson-WeaverResearch Institution: Princeton UniversityHome Institution: Princeton UniversityCo-Authors: Karen Jackson-Weaver, Princeton UniversityHUStanley Collins................................. 4:45 PM, Cove IIPresentation Title: Social Capital Inside the Courtroom:An Analysis of the Networks That Assist Youth InNavigating the Juvenile Justice SystemResearch Mentor: Carla SheddResearch Institution: Columbia UniversityHome Institution: Morehouse CollegeCo-Authors: Carla Shedd, Columbia UniversitySSAvani Comer...................................... 3:45 PM, Glen IPresentation Title: Functional Analysis of Crohn’sDisease and Mycobacteria in Ashkenazi JewsResearch Mentor: Monica BowenResearch Institution: Yale UniversityHome Institution: Rutgers UniversityCo-Authors: Monica Bowen, Yale UniversityBBNykhala Coston.................................5:30 PM, Cove IPresentation Title: The Public Perception of InterracialDating varies as a Function of Prejudice,Environmental Diversity, and Racial IdentityResearch Mentor: Jasmin CloutierResearch Institution: University of ChicagoHome Institution: McKendree UniversityCo-Authors: Jasmin Cloutier and Tianyi Li,University of ChicagoSSAja Crim-Logan............................. 11:15 AM, Glen IIPresentation Title: Computer Based Treatment forCognitive Behavioral TherapyResearch Mentor: Hedy KoberResearch Institution: Yale UniversityHome Institution: Hunter CollegeCo-Authors: Ashley Schloss, Yale UniversityABDina Dajani................................... 5:45 PM, BelltownPresentation Title: Decreased Cerebro-CerebellarFunctional Connectivity in AutismResearch Mentor: Stewart MostofskyResearch Institution: Johns Hopkins UniversityHome Institution: University of MiamiCo-Authors: Mary Beth Nebel, Deana Crocetti andStewart Mostofsky, Johns Hopkins UniversitySS

38 | Student Oral Presentations by NAMEJames Damiano.............................. 3:30 PM, Aspen IIPresentation Title: Mechanism of JAK2 AutoinhibitionIdentified by Molecular Dynamics SimulationResearch Mentor: Stevan HubbardResearch Institution: New York UniversitySackler InstituteHome Institution: Harvard UniversityCo-Authors: Stevan Hubbard and KavithaGnanasambandan, New York University -BioMedical SciencesBBRebecca de Frates................................2:45 PM, AlderPresentation Title: The Role of Cdc42 in CerebellarGranule Cell DevelopmentResearch Mentor: Eve GovekResearch Institution: Weill Cornell Medical CollegeHome Institution: University of WashingtonCo-Authors: Eve Govek and Mary Hatten,Rockefeller UniversityBBKevin De Jesus..............................11:15 AM, Aspen IIPresentation Title: Elucidating a MitochondrialProtective Transcriptional NetworkResearch Mentor: Cole HaynesResearch Institution: Weill Cornell Medical CollegeHome Institution: UPR-HumacaoCo-Authors: Cole Haynes, Mark Pellegrino and AmritaNargund, Sloan-Kettering InstituteBBDayana De La Torre...........................3:15 PM, Cove IPresentation Title: Drug Busts in New York City: LawEnforcement and Crime in the 1980sResearch Mentor: Samuel RobertsResearch Institution: Columbia UniversityHome Institution: Williams CollegeCo-Authors: Samuel K. Roberts, Columbia UniversityHUFartun Dirie.................................. 4:45 PM, BelltownPresentation Title: Antenatal Care and HealthcareAccess in Mozambique: An Issue of SpatialInequality?Research Mentor: Michael WhiteResearch Institution: Brown UniversityHome Institution: University of St. ThomasCo-Authors: Michael White, Brown UniversitySSJana Dodson.............................. 3:30 PM, Long RidgePresentation Title: SEM and EDS Characterization ofBulk Metallic GlassResearch Mentor: Christine BroadbridgeResearch Institution: Yale UniversityHome Institution: Georgetown UniversityCo-Authors: Christine Broadbridge, SouthernConnecticut State UniversityENAisha Dorta................................ 2:45 PM, GlenbrookPresentation Title: A Quantitative Analysis of theBiological Terraformation of a PlanetResearch Mentor: Karen Jackson-WeaverResearch Institution: Princeton UniversityHome Institution: Brooklyn College CUNYCo-Authors: Karen Jackson-Weaver, PrincetonUniversityPSSean Dougherty...............................5:00 PM, Aspen IPresentation Title: Hyperoxia Protects AgainstIsoflurane-induced Apoptosis in the Rat NeonatalBrainResearch Mentor: Lourdes Martin HernandezResearch Institution: New York UniversitySackler InstituteHome Institution: Virginia Polytechnic Instituteand State UniversityCo-Authors: Lourdes A. Martin Hernandez, BorisBiskoun and Thomas JJ Blanck, New YorkUniversity - BioMedical SciencesBBImaani Easthausen............................. 5:30 PM, Glen IPresentation Title: Synthesis of a Multimodal ImagingAgent for the Visualization of Pancreatic Beta Cellsin vivoResearch Mentor: Thomas ReinerResearch Institution: Weill Cornell Medical CollegeHome Institution: Bard CollegeCo-Authors: Jason Lewis, Thomas Reiner and ChristianBrand, Memorial Sloan Kettering Cancer CenterBBElshaddai Ephrem............................... 5:30 PM, Elm IPresentation Title: Role of IRF1 in Lupus: DefiningDownstream TargetsResearch Mentor: Kathleen SullivanResearch Institution: University of PennsylvaniaHome Institution: Princeton UniversityCo-Authors: Kathleen E. Sullivan, Kelly Maurer and LiHua Shi, University of PennsylvaniaBB

Cultivating Excellence and Empowering Great Minds | 39Arianna Espinoza............................. 12:30 PM, Elm IPresentation Title: Using Fluorescence Anisotropy toUnderstand How MARCKS-ED Peptide Binds toMicrovesiclesResearch Mentor: Hang (Hubert) YinResearch Institution: University of Colorado BoulderHome Institution: New Mexico Institute of Mining &TechnologyCo-Authors: Hang Hubert Yin and Leslie A. Morton,University of Colorado at BoulderBBUgomma Eze.....................................5:00 PM, Glen IIPresentation Title: Requirement of FUS in mES-Derived Motor Neuron Survival; Implications forALSResearch Mentor: Lei LuResearch Institution: Columbia UniversityHome Institution: Drew UniversityCo-Authors: Neil Shneider, Lei Lu and Sarah Ebstein,Columbia UniversityABBianca Flores....................................... 2:45 PM, Elm IPresentation Title: The Effects of Mycobacterium vaccaeon Serotonergic Systems, Immune Activation, andBehavior in the Forced Swim TestResearch Mentor: Christopher LowryResearch Institution: University of Colorado BoulderHome Institution: University of RochesterCo-Authors: Christopher Lowry and Alfredo Zúñiga,University of Colorado at BoulderBBJoshua Frenster............................... 4:00 PM, Glen IIIPresentation Title: Fluorescent Reporter System forDirecting Hematopoietic Lineage SpecificationResearch Mentor: Matthias StadtfeldResearch Institution: New York UniversitySackler InstituteHome Institution: Jacobs University BremenCo-Authors: Matthias Stadtfeld, New York University -BioMedical SciencesBBMiguel Frias.................................. 3:15 PM, WestoverPresentation Title: Seismic Soil Structure Interactionand Lateral Earth Pressures Near Buried WaterReservoir Structures in Southern CaliforniaResearch Mentor: Shideh DashtiResearch Institution: University of Colorado BoulderHome Institution: University of Wisconsin MadisonCo-Authors: Shideh Dashti and Min Zhang, Universityof Colorado at BoulderENKafi Friday...........................................5:30 PM, AlderPresentation Title: Understanding the Mechanisms ofCeftriaxone-Dependent Regulation of GlutamateTransport in the BrainResearch Mentor: Michael RobinsonResearch Institution: University of PennsylvaniaHome Institution: Brooklyn College CUNYCo-Authors: Micheal Robinson, Mausam Ghosh andMeredith Lane, University of PennsylvaniaBBCynthia Garcia.............................2:45 PM, WatersidePresentation Title: Reclaiming Space and PreservingCultural History in the Mission District of SanFranciscoResearch Mentor: Zephyr FrankResearch Institution: Stanford UniversityHome Institution: UC BerkeleyCo-Authors: Marcial Gonzalez, University of California,Berkeley; Frank Zephyr, Stanford University Schoolof Humanities & SciencesHUCecile Gaston................................11:45 AM, Glen IIIPresentation Title: Novel Role of the NeuronalGuidance Cue, Netrin-1 in Abdominal AorticAneurysm FormationResearch Mentor: Kathryn MooreResearch Institution: New York University SacklerInstituteHome Institution: Paris 7 UniversityCo-Authors: Kathryn Moore and Bhama Ramkhelawon,New York University - BioMedical SciencesBBSherry Gee....................................... 3:45 PM, Glen IIIPresentation Title: Role of ANO-1 in Endothelial CellProliferation and MigrationResearch Mentor: Gaurav ChoudharyResearch Institution: Brown UniversityHome Institution: University of Michigan-Ann ArborCo-Authors: Gaurav Choudhary, Alexander Vang andAyed Allawzi, Brown UniversityBBJemima Georges............................ 2:45 PM, BelltownPresentation Title: An Examination of the ImpactsPrehistoric Cahokians Had on Their NaturalEnvironmentResearch Mentor: John KellyResearch Institution: Washington University in St. LouisHome Institution: Brooklyn College CUNYCo-Authors: John E. Kelly, Washington Universityin St. LouisSS

40 | Student Oral Presentations by NAMEJoseph Geraghty.......................... 3:45 PM,GlenbrookPresentation Title: Synthesis of Enantiopure NantenineAnalogs as Serotonin 5-HT2A ReceptorAntagonistsResearch Mentor: Wayne HardingResearch Institution: Hunter CollegeHome Institution: SUNY College at GeneseoCo-Authors: Wayne Harding and Nirav Kapadia,Hunter CollegePSFelipe Giuste........................................ 5:45 PM, Elm IPresentation Title: Elucidating the Role of NeuromedinU Receptor in ErythropoiesisResearch Mentor: Martin CarrollResearch Institution: University of PennsylvaniaHome Institution: Washington University in St. LouisCo-Authors: Martin Carroll and Susan Shetzline,University of PennsylvaniaBBDamla Gonullu................................... 4:45 PM, Elm IPresentation Title: The Association Between PeripheralBlood Leukocyte Telomere Length and FemaleReproductive AgingResearch Mentor: Damla GonulluResearch Institution: New York UniversitySackler InstituteHome Institution: New York UniversityCo-Authors: Keri Kalmbach and David Keefe, NewYork University - BioMedical SciencesABGuadalupe Gonzalez.................... 3:45 PM, BelltownPresentation Title: The Role of Gender and Stage ofAcquisition in the Language Processing of L2LearnersResearch Mentor: Cindy BrantmeierResearch Institution: Washington University in St. LouisHome Institution: Bethel UniversityCo-Authors: Cindy Brantmeier, Washington Universityin St. LouisSSMatthew Gonzalez............................ 5:00 PM, Glen IPresentation Title: The Role of UCP1 and IAPP in theProgression of DiabetesResearch Mentor: Andisheh AbediniResearch Institution: New York UniversitySackler InstituteHome Institution: Arizona State UniversityCo-Authors: Ann Marie Schmidt, Andisheh Abediniand Carmen Hurtado del Pozo, New YorkUniversity - BioMedical SciencesABJose Grullon.......................................5:00 PM, Elm IIPresentation Title: Functional Analysis and Localizationof NIS, MCT1, and MCT4 ProteinsResearch Mentor: Jose GrullonResearch Institution: Yale UniversityHome Institution: Rutgers UniversityCo-Authors: Andrea Reyna and Nancy Carrasco, YaleUniversityBBDaniel Guzman.................................. 3:30 PM, Glen IPresentation Title: Analysis of the IgE Response inNippostrongylus Brasiliensis-Infected MiceResearch Mentor: Juan LafailleResearch Institution: New York University SacklerInstituteHome Institution: Rutgers UniversityCo-Authors: Juan Lafaille, New York University -BioMedical SciencesBBElsa Hardy..........................................5:00 PM, Cove IPresentation Title: Cultures of Power: Harlem Children’sZone and Poverty Intervention EffortsResearch Mentor: Kimberly DaCostaResearch Institution: New York UniversityHome Institution: Wesleyan UniversityCo-Authors: Kimberly DaCosta, New York University -Arts & Sciences; Sarah Mahurin, and Daniel Long,Wesleyan UniversitySSMark Harris..................................5:45 PM, WatersidePresentation Title: Juvenile Socialization andCourtroom Interactions: A Qualitative Analysis ofClient OutcomesResearch Mentor: Carla SheddResearch Institution: Columbia UniversityCo-Authors: Home Institution: Grambling StateUniversityCarla Shedd, Columbia UniversitySSJessica Hartling................................5:15 PM, Aspen IPresentation Title: Iron Responsive Element (IRE)-mRNA Conformation Changes Induced byManganese Ion (Mn2+)Research Mentor: Dixie GossResearch Institution: Hunter CollegeHome Institution: Viterbo UniversityCo-Authors: Dixie Goss and Jia Ma, Hunter CollegeBB

Cultivating Excellence and Empowering Great Minds | 41Michael Hawkins....................... 4:00 PM, GlenbrookPresentation Title: Using Ultraviolet Light to Inactivatethe Bacteriophage MS2Research Mentor: Karl LindenResearch Institution: University of Colorado BoulderHome Institution: Georgia State UniversityCo-Authors: Karl Linden and Sara Beck, University ofColorado at BoulderENJillian Haynes..........................3:15 PM, Springdale IIPresentation Title: Candidate Physiological Markers ofPerceived StressResearch Mentor: Mariann WeierichResearch Institution: Hunter CollegeHome Institution: SUNY at AlbanyCo-Authors: Mariann Weierich, Hunter CollegeSSJustin Henderson.......................... 5:00 PM, BelltownPresentation Title: Could Your DNA Soon Be in aFederal or State Database?Research Mentor: Jennifer HochschildResearch Institution: Harvard UniversityHome Institution: Eastern Kentucky UniversityCo-Authors: Jennifer Hochschild and Maya Sen,Harvard University, Dept. of GovernmentPENicholas Hernandez.......................... 5:45 PM, Glen IPresentation Title: Effects of Post-TranslationModifications on Rate of BACE1 InternalizationResearch Mentor: Gopal ThinakaranResearch Institution: University of ChicagoHome Institution: University of South FloridaCo-Authors: Celia Fernandez and Gopal Thinakaran,University of ChicagoBBNatalia Herrera................................3:45 PM, Aspen IPresentation Title: Generating an Antibody AgainstRetinoic Acid Receptor-Related Orphan ReceptorAlpha (Rora) to Define its Transcriptional TargetsResearch Mentor: Jason HallResearch Institution: New York University SacklerInstituteHome Institution: UC Santa CruzCo-Authors: Jason Hall and Dan R. Littman, New YorkUniversity - BioMedical SciencesABLauren Highsmith........................3:00 PM, WatersidePresentation Title: The Divide: Modernism and Afro-ModernismResearch Mentor: Charles KronengoldResearch Institution: Stanford UniversityHome Institution: Hampton UniversityCo-Authors: Charles Kronengold, Stanford UniversitySchool of Humanities & SciencesHUNikeeyia Howell............................... 3:30 PM, Cove IIPresentation Title: Demystifying the Strangeness: AnIntertextual Analysis of Mark Twain’s No.44, TheMysterious StrangerResearch Mentor: Kenneth WarrenResearch Institution: University of ChicagoHome Institution: City College of New YorkCo-Authors: Kenneth Warren, University of ChicagoHUDorcas Huang........................... 3:00 PM, Long RidgePresentation Title: Modeling Cellular Response toNanopatterned Bulk Metallic GlassesResearch Mentor: Jenna BalestriniResearch Institution: Yale UniversityHome Institution: Columbia UniversityCo-Authors: Jenna Balestrini, Jagannath Padmanabhanand Themis Kyriakides, Yale UniversityENDavid Hutchinson..............................3:00 PM, Cove IPresentation Title: All I Do Know Is That I Like BeingLiked: Conceptualizing Same-Sex Desire inRichard Bruce Nugent’s “Gentleman Jigger”Research Mentor: William MaxwellResearch Institution: Washington University in St. LouisHome Institution: Truman State UniversityCo-Authors: William Maxwell, Washington Universityin St. LouisHUJere` Hutson.......................................4:45 PM, Elm IIPresentation Title: Purification and Characterization ofTAT-Cre for Ex Vivo Gene DeletionResearch Mentor: Michael AtchisonResearch Institution: University of PennsylvaniaHome Institution: Delaware State UniversityCo-Authors: Michael Atchison, Parul Mehra and VibhaJha, University of PennsylvaniaBB

42 | Student Oral Presentations by NAMELena Ibrahim............................. 4:00 PM, High RidgePresentation Title: Effects of Rigidity of Bent-CoreLiquid Crystal Spacer GroupsResearch Mentor: David WalbaResearch Institution: University of Colorado BoulderHome Institution: University of West FloridaCo-Authors: David Walba and Mark Moran, Universityof Colorado at BoulderPSSteven Jefferson................................ 5:00 PM, Cove IIPresentation Title: China in the World: TheRepresentation of Ethnic Minorities in the MediaResearch Mentor: Emily HannumResearch Institution: University of PennsylvaniaHome Institution: Boston CollegeCo-Authors: Emily Hannum and Hua-Yu SebastianCherng, University of PennsylvaniaSSDebria Joe..........................................5:45 PM, Glen IIPresentation Title: BACE1 Localization and Traffickingin NeuronsResearch Mentor: Gopal ThinakaranResearch Institution: University of ChicagoHome Institution: Xavier University of LouisianaCo-Authors: Gopal Thinakaran, Margaret Lefkow andCelia Fernandez, University of ChicagoBBCatrina Johnson............................. 4:45 PM, Aspen IIPresentation Title: Contribution of the E74-Like Factor3 to the Toll-Like Receptor-Driven CatabolicResponses in Articular Chondrocytes: PotentialRole in Cartilage Destruction in OsteoarthritisResearch Mentor: Mary GoldringResearch Institution: Weill Cornell Medical CollegeHome Institution: University of Maryland, BaltimoreCountyCo-Authors: Mary Goldring and Miguel Otero, TheHospital for Special SurgeryABAlexandra Jones............................ 4:00 PM, BelltownPresentation Title: Examining the Mind of a Student:How Unconscious Biases and Heuristics InfluenceAcademic Decision-MakingResearch Mentor: Elizabeth PaluckResearch Institution: Princeton UniversityHome Institution: Rutgers UniversityCo-Authors: Elizabeth Paluck, Princeton UniversitySSMaxwell Kesselly........................... 3:30 PM, WestoverPresentation Title: Utilization of Solar Energy inResidential Homes to Achieve Complete Net-ZeroEnergy Solar HomesResearch Mentor: Sonya SmithResearch Institution: Howard UniversityHome Institution: Alabama A&M UniversityCo-Authors: Sonya Smith, Howard UniversityENMelissa Kreider......................... 3:30 PM, High RidgePresentation Title: Synthesis of a Dense, High AspectRatio Zinc Oxide Nanowire Forest Using the PS-PMMA Block CopolymerResearch Mentor: Chinedum OsujiResearch Institution: Yale UniversityHome Institution: Massachusetts Institute ofTechnologyCo-Authors: Chinedum Osuji, Candice Pelligra andDiana Hu, Yale UniversityPSCarolina Larrain............................. 3:15 PM, Glen IIIPresentation Title: Characterization of OntogeneticColumns in Reeler MiceResearch Mentor: Shuijin HeResearch Institution: Weill Cornell Medical CollegeHome Institution: University of Wisconsin MadisonCo-Authors: Shuijin He, Weill Cornell/Rockefeller/Sloan-Kettering Tri-InstitutionalABMarilyn Le......................................12:30 PM, Aspen IPresentation Title: The Effects of Reverse TranscriptaseInhibitors on LINE-1 Retrotransposon Expressionin Human FibroblastsResearch Mentor: John SedivyResearch Institution: Brown UniversityHome Institution: University of Rhode IslandCo-Authors: John Sedivy and Marco De Cecco, BrownUniversityABIrene Lee.........................................12:15 PM, Aspen IPresentation Title: Use of Immune Complex Vaccineas a Novel Immunogen to Generate Broad HIV-1Neutralizing AntibodiesResearch Mentor: Catarina HioeResearch Institution: New York UniversitySackler InstituteHome Institution: Rice UniversityCo-Authors: Catarina Hioe and Michael Tuen, NewYork University - BioMedical SciencesBB

Cultivating Excellence and Empowering Great Minds | 43Rachel Lee..................................... 12:00 PM, Glen IIIPresentation Title: Ultrasonic Actuation Reduces BrainInflammatory Response to Neural MicroelectrodeInsertionResearch Mentor: Catharine ClarkResearch Institution: Cornell UniversityHome Institution: Cornell UniversityCo-Authors: Catharine Clark, Chris Schaffer andNozomi Nishimura, Cornell UniversityABRosa Leon.........................................5:30 PM, Aspen IPresentation Title: Buprenorphine’s PotentialAntidepressant-like Effects on a Chronic MildStress ModelResearch Mentor: Irwin LuckiResearch Institution: University of PennsylvaniaHome Institution: Syracuse UniversityCo-Authors: Irwin Lucki and Edgardo Falcon-Morales,University of PennsylvaniaBBMelissa Leung......................................3:00 PM, AlderPresentation Title: Efficacy of the novel JAK2 inhibitorG6, in Myeloproliferative NeoplasmsResearch Mentor: Priya KoppikarResearch Institution: Weill Cornell Medical CollegeHome Institution: Wesleyan UniversityCo-Authors: Priya Koppikar, Neha Bhagwat and Ross L.Levine, Weill Cornell/Rockefeller/Sloan-KetteringTri-InstitutionalBBShannon Litke.....................................3:30 PM, AlderPresentation Title: Neurotensin Attenuates theMethamphetamine-Induced Increase inPhosphorylation of DARPP-32, Dopamine andcyclic AMP-Regulated Phosphoprotein, Via theNitric Oxide/cyclic GMP Signaling Pathway inStriatal Neurons of MiceResearch Mentor: Jesus AnguloResearch Institution: Hunter CollegeHome Institution: New York UniversityCo-Authors: Jesus Angulo and Qingkun Liu, HunterCollegeBBAurora Llamas........................5:45 PM, Springdale IIPresentation Title: Re-thinking Cultural Values: APhilosophical Approach To Socialized InequalityResearch Mentor: Rene ArcillaResearch Institution: New York UniversityHome Institution: Cornell UniversityCo-Authors: Rene Arcilla, New York University -Arts & SciencesPESydney Lomnes.................................. 3:15 PM, Glen IPresentation Title: Host and Parasite Communities:How Interactions Between Chaetogaster limnaeiand Echinostoma sp. Affect Snail HostsResearch Mentor: Pieter JohnsonResearch Institution: University of Colorado BoulderHome Institution: University of Wisconsin La CrosseCo-Authors: Pieter Johnson, University of Colorado atBoulderABCarolina Lopez............................... 5:30 PM, Aspen IIPresentation Title: Regulation of the SYT-SSX2 FusionProtein by t(X;18) in Synovial SarcomaResearch Mentor: Yuanyuan XieResearch Institution: Weill Cornell Medical CollegeHome Institution: Florida International UniversityCo-Authors: Ping Chi, Yuanyuan Xie and Dong Gao,Weill Cornell/Rockefeller/Sloan-Kettering Tri-InstitutionalABDavys Lopez................................... 3:00 PM, Aspen IIPresentation Title: Localization of the PolarityRegulator PAC-1 by Components of the Cadherin-Catenin ComplexResearch Mentor: Jeremy NanceResearch Institution: New York University SacklerInstituteHome Institution: University of FloridaCo-Authors: Jeremy Nance and Diana Klompstra, NewYork University - BioMedical SciencesBBNoe Lopez...........................................5:15 PM, Cove IPresentation Title: Living In Between Nations:Discussing Mixtec Transnationalism in the UnitedStates and MexicoResearch Mentor: Evelyn Hu-DehartResearch Institution: Brown UniversityHome Institution: UC Santa BarbaraCo-Authors: Evelyn Hu-Dehart, Brown UniversitySSLeaAnn Love.....................................12:30 PM, AlderPresentation Title: African American Women andTriple Negative Breast Cancer: Examining theStigmas of Self Touching that Prevent Its EarlyDetectionResearch Mentor: Karen Jackson-WeaverResearch Institution: Princeton UniversityHome Institution: Xavier University of LouisianaCo-Authors: Robert Knowles and Lydia Rono,Princeton UniversityAB

44 | Student Oral Presentations by NAMEClaudia Lovell....................................3:45 PM, Elm IIPresentation Title: The Role of BET Proteins inEmbryonic Stem Cell Fate DecisionsResearch Mentor: Eva HernandoResearch Institution: New York UniversitySackler InstituteHome Institution: UC BerkeleyCo-Authors: Eva Hernando and Raffaella Di Micco,New York University - BioMedical SciencesBBAshley Lowery............................... 5:15 PM, BelltownPresentation Title: Surveillance of Youth TobaccoInvolvement Using Google TrendsResearch Mentor: Patricia CavazosResearch Institution: Washington University in St. LouisHome Institution: Jackson State UniversityCo-Authors: Patricia Cavazos-Rehg, Melissa Krauss andLaura Bierut, Washington University in St. LouisSSPeter Lowrie.............................. 3:15 PM, High RidgePresentation Title: X-Ray Vision: Using X-RayInterference Patterns to Track the Growth ofSilicon Oxide LayersResearch Mentor: Fred WalkerResearch Institution: Yale UniversityHome Institution: Furman UniversityCo-Authors: Fred Walker, Yale UniversityPSJeffrey Luery..................................11:30 AM, Glen IIIPresentation Title: Diurnal Changes of NeuronExcitability Within the Suprachiasmatic NucleusUsing Voltage-Sensitive Dye ImagingResearch Mentor: Greg CarlsonResearch Institution: University of PennsylvaniaHome Institution: University of PennsylvaniaCo-Authors: Jason Gerstner, Rachel White and GregCarlson, University of PennsylvaniaABClaudio Macias.................................. 2:45 PM, Glen IPresentation Title: Self-assembled SupramolecularNanobelts for Antibiotic DeliveryResearch Mentor: Honggang CuiResearch Institution: Johns Hopkins UniversityHome Institution: University of Texas at San AntonioCo-Authors: Honggang Cui and Yi-an Lin, JohnsHopkins UniversityABKatryna Mahoney...................5:00 PM, Springdale IIPresentation Title: Black Activists in ‘White Africa’:Exploring sub-Saharan Migrant-Activism inMoroccoResearch Mentor: Keisha-Khan PerryResearch Institution: Brown UniversityHome Institution: Spelman CollegeCo-Authors: Keisha-Khan Perry, Brown UniversitySSAhmed Malik......................................4:45 PM, AlderPresentation Title: Role of Huntington’s Disease Proteinin TranslationResearch Mentor: Naoko TaneseResearch Institution: New York UniversitySackler InstituteHome Institution: Indiana University Purdue UniversityCo-Authors: Naoko Tanese, New York University -BioMedical SciencesABShenee’ Martin.................................4:45 PM, Aspen IPresentation Title: The Study of TDP-1 and FUST-1 in C. elegans to Understand Their Role inAmyotrophic Lateral SclerosisResearch Mentor: Christopher LinkResearch Institution: University of Colorado BoulderHome Institution: University of the Virgin IslandsCo-Authors: Christopher Link and Ilana Pena-Gonzalez, University of Colorado at BoulderBBBrian Matilla................................. 3:00 PM, WestoverPresentation Title: Convection Initiation along theRocky Mountain Front RangeResearch Mentor: Katja FriedrichResearch Institution: University of Colorado BoulderHome Institution: Florida International UniversityCo-Authors: Katja Friedrich, University of Colorado atBoulderESMatthew McCauley......................4:00 PM, WatersidePresentation Title: Talking About God: A UnivocalApproachResearch Mentor: Delia FaraResearch Institution: Princeton UniversityHome Institution: Johns Hopkins UniversityCo-Authors: Delia G. Fara, Princeton UniversityPE

Cultivating Excellence and Empowering Great Minds | 45Danielle McColgan............................3:45 PM, Cove IPresentation Title: Historicizing Health Promotion:Anti-Drug Prevention in New York City From1978-1989Research Mentor: Samuel RobertsResearch Institution: Columbia UniversityHome Institution: Smith CollegeCo-Authors: Samuel K. Roberts, Columbia UniversityHUShayna McCormack................3:45 PM, Springdale IIPresentation Title: Bipolar Disorder and MedicinalNonadherenceResearch Mentor: Karen WeaverResearch Institution: Princeton UniversityHome Institution: Howard UniversityCo-Authors: Kenneth Norman, Princeton UniversitySSLuis Millán-Barea.............................11:30 AM, Elm IPresentation Title: Francisella Infectivity PotentiatorProtein B FipB, and FipA are Important ProtectorsAgainst Incorrect Disulfide Bond FormationCaused by Copper Stress in Francisella novicidaResearch Mentor: Barbara MannResearch Institution: University of Virginia School ofMedicineHome Institution: UPR-MayaguezCo-Authors: Barbara Mann, University of Virginia -BioMedical SciencesABCarrie Moore.................................... 2:45 PM, Cove IIPresentation Title: Fitting into the Story: WesternRomance and Blackness in Toni Morrison’s “TarBaby”Research Mentor: Rebecca WanzoResearch Institution: Washington University in St. LouisHome Institution: University of Southern CaliforniaCo-Authors: Rebecca Wanzo, Washington University inSt. LouisHUBryan Morales.................................12:00 PM, Glen IIPresentation Title: Assessing the Effects of SleepHomeostasis in Activity-Dependent Plasticity: TheSpatiotemporal Expression of Plasticity-RelatedProteins Within a Sleep Deprivation Study Usingthe Model Organism Mus musculusResearch Mentor: Marcos FrankResearch Institution: University of PennsylvaniaHome Institution: UPR-Rio PiedrasCo-Authors: Marcos Frank, University of Chicago; AdamWatson and Nikolai Zapertov, University of PennsylvaniaBBIsabel Morgan................................ 11:30 AM, Glen IIPresentation Title: Socioeconomic Status and ChildCognitive Outcomes at Age 7; Maternal Cortisol asa Possible MediatorResearch Mentor: Stephen BukaResearch Institution: Brown UniversityHome Institution: Mount Holyoke CollegeCo-Authors: Stephen Buka, Rachel Scagos andSamantha Rosenthal, Brown UniversityABAlexis Morris............................. 3:00 PM, High RidgePresentation Title: Description of the Behaviors andElectron Correlation in LaNiO3 and NdNiO3Through First Principles TheoryResearch Mentor: Sohrab Ismail-BeigiResearch Institution: Yale UniversityHome Institution: Truman State UniversityCo-Authors: Sohrab Ismail-Beigi and AndreiMalashevich, Yale UniversityPSAndrew Morton................................5:30 PM, Glen IIPresentation Title: Targeting HSR1 Affects the HeatShock Response in Human Brain Cancer CellsResearch Mentor: Evgeny NudlerResearch Institution: New York UniversitySackler InstituteHome Institution: Michigan State UniversityCo-Authors: Evgeny Nudler and Anissa Igoudjil, NewYork University - BioMedical SciencesBBAriel Mosley..................................... 5:45 PM, Cove IIPresentation Title: Why Can’t I be Sexy, Smart,and Beautiful Enough?: Examining Women’sInternalization of StigmaResearch Mentor: John DovidioResearch Institution: Yale UniversityHome Institution: CSU SacramentoCo-Authors: Jack Dovidio, Yale UniversitySSDana Muñiz........................................4:45 PM, Cove IPresentation Title: The Culture of Work: The Economyof the Sugar Mills and Company Towns at theCaribbean Basin in the 20th CenturyResearch Mentor: Jeremy AdelmanResearch Institution: Princeton UniversityHome Institution: UPR-Rio PiedrasCo-Authors: Jeremy Adelman, Princeton UniversitySS

46 | Student Oral Presentations by NAMERobert Myers.................................... 12:15 PM, Glen IPresentation Title: Neoplastic Transformation of NeuralPrecursor Cells to Model Glioblastoma Multiforme(GBM)Research Mentor: Viviane TabarResearch Institution: Weill Cornell Medical CollegeHome Institution: College of New JerseyCo-Authors: Viviane Tabar and Kosuke Funato,Memorial Sloan-Kettering Cancer CenterABAaron Neal........................................5:15 PM, Glen IIPresentation Title: mRNA Expression of Clock GenesPer1 and Bmal in the Hippocampus and theAmygdalaResearch Mentor: Robert SpencerResearch Institution: University of Colorado BoulderHome Institution: North Carolina A&T State UniversityCo-Authors: Robert Spencer and Lauren Chun,University of Colorado at BoulderBBHailey Neubauer..........................5:15 PM, WatersidePresentation Title: The Influence of the War on Drugson Felons’ Voting Rights Legislation and VoterTurnout in the SouthResearch Mentor: Claudine GayResearch Institution: Harvard UniversityHome Institution: University of OklahomaCo-Authors: Claudine Gay, Harvard University, Dept.of GovernmentPEMary Ng......................................... 2:45 PM, WestoverPresentation Title: Characterizing Precipitation in EastAfricaResearch Mentor: Katja FriedrichResearch Institution: University of Colorado BoulderHome Institution: Barnard CollegeCo-Authors: Katja Friedrich, University of Colorado atBoulderESDaniel Nissani............................... 3:00 PM, BelltownPresentation Title: Characterizing Forms ofMathematical DiscourseResearch Mentor: Richard LehrerResearch Institution: Vanderbilt UniversityHome Institution: Northwestern UniversityCo-Authors: Richard Lehrer and Amy Holmes,Vanderbilt UniversitySSKasiemobi Nwaedozie........................5:45 PM, AlderPresentation Title: Methamphetamine, Inflammationand the Ubiquitin/Proteasome Pathway: Impact onNeurodegenerationResearch Mentor: Maria PereiraResearch Institution: Hunter CollegeHome Institution: Clark UniversityCo-Authors: Teneka Louis and Maria Figueiredo-Pereira, Hunter CollegeBBOnyemaechi Nwanaji-Enwerem........ 3:30 PM, Elm IPresentation Title: The Biological Significance ofSoluble Co-Inhibitory Receptors, B-/T-LymphocyteAttenuator (BTLA), and its Ligand, Hepatitis VirusEntry Protein (HVEM), in the Development ofSepsis in MiceResearch Mentor: Alfred AyalaResearch Institution: Brown UniversityHome Institution: University of North Carolina Chapel HillCo-Authors: Alfred Ayala and Yaping Chen, BrownUniversityBBDiana Nwokoye..............................12:15 PM, Glen IIPresentation Title: Spatial and Temporal ExpressionPatterns of MBD2: Protein Implicated in AutisticlikePhenotypesResearch Mentor: Zhaolan ZhouResearch Institution: University of PennsylvaniaHome Institution: University of FloridaCo-Authors: Zhaolan Zhou and Kathleen Wood,University of PennsylvaniaBBN’Kosi Oates............................ 5:00 PM, Springdale IPresentation Title: Geographic Neighborhood Povertyand Political ParticipationResearch Mentor: Dorian WarrenResearch Institution: Columbia UniversityHome Institution: University of DelawareCo-Authors: Dorian T. Warren, Robert Y. Shapiro andNarayani LaSala Blanco, Columbia UniversityPEMichael Okoreeh................................. 4:00 PM, Elm IPresentation Title: Novel Regulators of Early B CellSurvival and ProliferationResearch Mentor: Keith HamelResearch Institution: University of ChicagoHome Institution: UC RiversideCo-Authors: Keith Hamel and Marcus Clark, Universityof ChicagoBB

Cultivating Excellence and Empowering Great Minds | 47Michelle Okoreeh............................. 11:15 AM, AlderPresentation Title: MTAP Inactivation in CancerResearch Mentor: Olufunmilayo OlopadeResearch Institution: University of ChicagoHome Institution: UC RiversideCo-Authors: Olufunmilayo Olopade and JimFackenthal, University of Chicago; Robert Chilcote,University of California, IrvineBBUchenna Okoro.................................11:15 AM, Elm IPresentation Title: Characterization and Screeningof Monoclonal Antibodies Targeting AbnormalProtein ConformationsResearch Mentor: Thomas WisniewskiResearch Institution: New York University SacklerInstituteHome Institution: University of Maryland, BaltimoreCountyCo-Authors: Thomas Wisniewski, New York University- BioMedical SciencesABBosoye Olateru-Olagbegi.................3:15 PM, Glen IIPresentation Title: The Use of Sodium Nitrite in theReversal of Vascular DysfunctionResearch Mentor: Douglas SealsResearch Institution: University of Colorado BoulderHome Institution: Michigan State UniversityCo-Authors: Douglas Seals, Allison DeVan and JessicaSantos, University of Colorado at BoulderABBabajide Oluwadare........................ 11:30 AM, Elm IIPresentation Title: Determining the Contribution ofFibroblast Connexin Expression to the ConductionProperties of Injured Cardiac TissueResearch Mentor: Gregory MorleyResearch Institution: New York University SacklerInstituteHome Institution: University of GeorgiaCo-Authors: Gregory Morley and Vanessa Mahoney,New York University - BioMedical SciencesBBHassan Omar............................. 3:15 PM, Long RidgePresentation Title: Development of Bulk MetallicGlasses and Experimental Calibration of BlowMolding ProceduresResearch Mentor: Jan SchroersResearch Institution: Yale UniversityHome Institution: University of Maryland, Baltimore CountyCo-Authors: Jan Schroers, Yanhui Liu and Sung WooSohn, Yale UniversityENLaura Ortiz....................................... 3:15 PM, Cove IIPresentation Title: Witchcraft and Gender inShakespeare’s Tragedies and HistoriesResearch Mentor: Rebeca BushnellResearch Institution: University of Pennsylvania Arts &SciencesHome Institution: UPR-Rio PiedrasCo-Authors: Rebecca Bushnell, University ofPennsylvaniaHUAngel Ortiz Rodriguez................. 11:15 AM, Aspen IPresentation Title: Interferon-gamma MediatedDegradation of HemeOoxygenase-1 (HO-1) ViaInduction of the Immunoproteasome in HumanPrimary Macrophages: Implications for HIVAssociated Neurocognitive DisorderResearch Mentor: Dennis KolsonResearch Institution: University of PennsylvaniaHome Institution: UPR-Rio PiedrasCo-Authors: Suren Ambegaokar, Alexander Gill andDennis Kolson, University of PennsylvaniaABAdewola Osunsade........................ 2:45 PM, Aspen IIPresentation Title: Assessing the Functionality ofProtein Kinase C Isozymes Using Wildtype andConstitutively Active Forms of PKC-alpha andPKC-epsilonResearch Mentor: Shuibing ChenResearch Institution: Weill Cornell Medical CollegeHome Institution: University of the District ofColumbiaCo-Authors: Sadaf Amin, Weill Cornell GraduateSchool of Medical Sciences; Shuibing Chen,Weill Cornell/Rockefeller/Sloan-Kettering Tri-InstitutionalBBAlfonso Pacheco....................... 5:45 PM, Springdale IPresentation Title: Political Opinion and Congress:A Study on the Failure of ComprehensiveImmigration ReformResearch Mentor: Robert ShapiroResearch Institution: Columbia UniversityHome Institution: Saint Mary’s UniversityCo-Authors: Robert Shapiro and Narayani LasalaBlanco, Columbia UniversityPE

48 | Student Oral Presentations by NAMECoralie Pardo..........................4:00 PM, Springdale IIPresentation Title: Sex Differences in CREBExpression After Administration of Cocaine,Methamphetamine, and CannabinoidsResearch Mentor: Vanya Quinones-JenabResearch Institution: Hunter CollegeHome Institution: Amherst CollegeCo-Authors: Vanya Quinones-Jenab and CourtneyDaly, Hunter CollegeSSStellJo Passes................................. 4:45 PM, WestoverPresentation Title: Radon ProjectResearch Mentor: Neva TallBearResearch Institution: Montana State University-BozemanHome Institution: Little Big Horn CollegeCo-Authors: Neva Tall Bear, Little Big Horn CollegeESMadeline Pelz................................... 12:30 PM, Glen IPresentation Title: Imaging and Characterization ofHippocampal Circuits Implicated in TemporalLobe EpilepsyResearch Mentor: Douglas CoulterResearch Institution: University of PennsylvaniaHome Institution: Skidmore CollegeCo-Authors: Douglas Coulter, Shanti Frausto and MaryEllen Kelly, University of PennsylvaniaABFei Peng............................................... 5:00 PM, Elm IPresentation Title: The Role of Aldosterone inEndothelial Cell MigrationResearch Mentor: Iris JaffeResearch Institution: Tufts University BioMedicalSciencesHome Institution: Smith CollegeCo-Authors: Iris Jaffe and Kathleen Barrett, TuftsUniversity School of Graduate Biomedical SciencesABRafael Perez.............................3:30 PM, Springdale IIPresentation Title: The Effects of Social Stress onHDAC6-Related ProteinsResearch Mentor: Olivier BertonResearch Institution: University of PennsylvaniaHome Institution: York College of PennsylvaniaCo-Authors: Rafael Perez, York College of Pennsylvania;Jeanine Jochems and Olivier Berton, University ofPennsylvaniaSSYaritza Perez.................................3:30 PM, WatersidePresentation Title: Learned Helplessness or Tradition:An Examination of the Transgenerational Useand Perspective of Corporal Punishment andAuthoritarianism in African American andHispanic FamiliesResearch Mentor: Karen Jackson-WeaverResearch Institution: Princeton UniversityHome Institution: University of RochesterCo-Authors: Joel Cooper, Princeton UniversitySSGordon Pherribo.............................3:00 PM, Aspen IPresentation Title: Optimizing shRNA to Target SpecificRNA-Binding Protein TranscriptsResearch Mentor: Stephen LiebhaberResearch Institution: University of PennsylvaniaHome Institution: Carnegie Mellon UniversityCo-Authors: Xinjun Ji and Stephen Liebhaber,University of PennsylvaniaBBNicholas Pizzi................................. 4:00 PM, Aspen IIPresentation Title: Analysis of Hey1 Expression inLamprey Pharyngeal ArchesResearch Mentor: Daniel MedeirosResearch Institution: University of Colorado BoulderHome Institution: University of New Hampshire(Durham)Co-Authors: Daniel Medeiros and Maria Cattell,University of Colorado at BoulderBBDarien Pollock......................... 2:45 PM, Springdale IPresentation Title: 21st Century American StreetPhilosophy and the Philosophy of MassIncarcerationResearch Mentor: Michael WeisbergResearch Institution: University of PennsylvaniaHome Institution: Morehouse CollegeCo-Authors: Michael Weisberg and AlexanderGuerrero, University of PennsylvaniaHUDaniel Powell.................................. 2:45 PM, Glen IIIPresentation Title: Elucidating Cellular and MolecularMechanisms of Estrogen Dependent TAF4BUpregulationResearch Mentor: Richard FriemanResearch Institution: Brown UniversityHome Institution: University of UtahCo-Authors: Jennifer Wardell and Richard Freiman,Brown UniversityBB

Cultivating Excellence and Empowering Great Minds | 49Carlos Puentes.............................. 5:30 PM, BelltownPresentation Title: Does Cognitive Vulnerability toSleep Loss Relate to Mood Response?Research Mentor: David DingesResearch Institution: University of PennsylvaniaHome Institution: University of Central FloridaCo-Authors: David Dinges, University of PennsylvaniaSSNatalia Quijano-Cardé.....................12:15 PM, AlderPresentation Title: MR-Visible Lipids as a Biomarker ofCell Stress in Prostate Cancer Cells Treated WithAnticancer DrugsResearch Mentor: Edward J. DelikatnyResearch Institution: University of PennsylvaniaHome Institution: UPR-MayaguezCo-Authors: Michael Chiorazzo, Anatoliy Popov andEdward Delikatny, University of PennsylvaniaABMichael Rabadi............................. 3:15 PM, BelltownPresentation Title: Exploring the Temporal Limitsof Visual Processing of Familiar and UnfamiliarObjects at the Subordinate-Category LevelResearch Mentor: David SheinbergResearch Institution: Brown UniversityHome Institution: New York UniversityCo-Authors: David L. Sheinberg and Samuel L.Johnson, Brown UniversitySSLiorimar Ramos Medina....................3:15 PM, AlderPresentation Title: Role of Hyperacetylation of HistoneH4K12 in Modulating Executive CognitiveFunctioning in Mice Exposed to Early Life StressResearch Mentor: Claudia SchmaussResearch Institution: Columbia UniversityHome Institution: UPR-Rio PiedrasCo-Authors: Claudia Schmauss, Columbia UniversityBBStephon Richardson.....................5:00 PM, WatersidePresentation Title: The Black New Left: African-American Radical Groups of the Late 1950s to theEarly ‘60sResearch Mentor: Keisha-Kahn PerryResearch Institution: Brown UniversityHome Institution: Clark UniversityCo-Authors: Keisha-Khan Y. Perry, Brown UniversityHUKaren Rico...................................... 3:45 PM, Aspen IIPresentation Title: Relationship Between Acyl-CoAThioesterase 7 and Saturated Fatty Acid-InducedJNK ActivationResearch Mentor: Michael WolfgangResearch Institution: Johns Hopkins UniversityHome Institution: University of ArizonaCo-Authors: Karen Rico, Caitlyn Bowman and MichaelWolfgang, Johns Hopkins UniversityBBMayra Rios.........................................3:00 PM, Elm IIPresentation Title: Expression Level of TransientReceptor Potential Vanilloid-4 (TRPV4) in MiceDuring Lung DevelopmentResearch Mentor: Juan Esteban SanchezResearch Institution: Brown UniversityHome Institution: Canada CollegeCo-Authors: Juan Esteban Sanchez and Yulian Wang,Brown UniversityABAdrian Rivera...................................3:30 PM, Aspen IPresentation Title: siRNA Library Screen of ZMYND11Interacting PartnersResearch Mentor: Roger GreenbergResearch Institution: University of PennsylvaniaHome Institution: UPR-Rio PiedrasCo-Authors: Laura Butler, University of Pennsylvania;Katri Pylkas, University of Oulu, Finland; RogerGreenberg, University of PennsylvaniaBBStephanie Rivera Morales................... 3:00 PM, Elm IPresentation Title: Plasmodium falciparum StrainSpecific Malaria Infection Symptoms andImmunityResearch Mentor: Oralee BranchResearch Institution: New York UniversitySackler InstituteHome Institution: UPR-Rio PiedrasCo-Authors: Oralee Branch, New York University -BioMedical SciencesBBViviana Rivera-Burgos............ 4:45 PM, Springdale IPresentation Title: Did Hurricane Sandy Dent the Vote?Evidence From a Large-Scale Study in New YorkCityResearch Mentor: Robert ShapiroResearch Institution: Columbia UniversityHome Institution: UPR-MayaguezCo-Authors: Robert Shapiro and Narayani LaSalaBlanco, Columbia UniversityPE

50 | Student Oral Presentations by NAMEVeronica Rivera-Negron.........4:45 PM, Springdale IIPresentation Title: (De)Composing the Self: EmbodiedImagery, Theatrical Space and Gender in thePerformance of Teresa HernándezResearch Mentor: Marcial Godoy-AnativiaResearch Institution: New York UniversityHome Institution: UPR-Rio PiedrasCo-Authors: Marcial Godoy-Anativia, HemisphericInstitute of Performance and PoliticsHUJulian Roby..........................................5:00 PM, AlderPresentation Title: Immature Neuron Proliferation inCorrelation to Cognition in Aging Vervet MonkeysResearch Mentor: Mark BurkeResearch Institution: Howard UniversityHome Institution: Wiley CollegeCo-Authors: Mark Burke, Howard UniversityABEmily Rogers............................ 3:30 PM, Springdale IPresentation Title: “Invisible Wounds” or InvisiblePolitics? Neoliberalism, Post-Traumatic StressDisorder, and Imagined US Vulnerability in the“War on Terror”Research Mentor: Sharon MarcusResearch Institution: Columbia UniversityHome Institution: Sarah Lawrence CollegeCo-Authors: Sharon Marcus, Columbia UniversityHUMiata Rogers................................4:45 PM, WatersidePresentation Title: The Effect of Academic Resources onCollege Retention RatesResearch Mentor: Karen Jackson-WeaverResearch Institution: Princeton UniversityHome Institution: Oberlin CollegeCo-Authors: Karen Jackson-Weaver, PrincetonUniversitySSMelisa Rojas............................2:45 PM, Springdale IIPresentation Title: Examining ReciprocalCommunication in Youth with Autism SpectrumDisorders Following a Peer-Mediated TheatreInterventionResearch Mentor: Blythe CorbettResearch Institution: Vanderbilt UniversityHome Institution: Pomona CollegeCo-Authors: Blythe Corbett and David Simon,Vanderbilt UniversitySSFranklin Roman-Rodriguez...... 3:30 PM, GlenbrookPresentation Title: Bacterial Cultures From Tadpoles ofthe Bullfrog Lithobates catesbeianus (PreviouslyRana catesbeiana)Research Mentor: Valerie McKenzieResearch Institution: University of Colorado BoulderHome Institution: UPR-MayaguezCo-Authors: Doug Woodhams and Valerie McKenzie,University of Colorado at BoulderESJoshua Rosario Sepulveda................11:45 AM, Elm IPresentation Title: Structure Analysis of Human RedCell Spectrin Using Homobifunctional Crosslinkersand High Resolution Mass SpectrometryResearch Mentor: David SpeicherResearch Institution: University of PennsylvaniaHome Institution: UPR-CayeyCo-Authors: David Speicher, Sandra Harper and SiraSriswasdi, University of PennsylvaniaBBMarlen Rosas............................ 5:30 PM, Springdale IPresentation Title: Protest in Perspective: Prospects ofContinuity in Popular Mobilizations in BrazilResearch Mentor: Jeremy AdelmanResearch Institution: Princeton UniversityHome Institution: Columbia UniversityCo-Authors: Jeremy Adelman, Princeton UniversityHUOrnella Rutagarama...................... 5:45 PM, Glen IIIPresentation Title: Detection and Analysis of GenomicMutations Linked to APOBEC-Mediated CytidineDeaminationResearch Mentor: Susan RossResearch Institution: University of PennsylvaniaHome Institution: Rochester Institute of TechnologyCo-Authors: Ornella Rutagarama, Spyridon Stavrouand Susan S. Ross, University of PennsylvaniaABRochelle Sadeghi............................. 3:30 PM, Glen IIIPresentation Title: Spontaneous Changes inImmortalized Mammalian Cell Lines Result in CellCompetitionResearch Mentor: Ben StangerResearch Institution: University of PennsylvaniaHome Institution: University of Central FloridaCo-Authors: Alfredo Penzo-Méndez and Ben Z.Stanger, University of PennsylvaniaBB

Cultivating Excellence and Empowering Great Minds | 51Timothy Salazar......................... 3:15 PM, GlenbrookPresentation Title: Analyzing Biocontrol Capability;Mecinus janthiniformis and Linaria dalmatica: ABlessed Communion? (ABCs of Weevils andToadflax)Research Mentor: Timothy SeastedtResearch Institution: University of Colorado BoulderHome Institution: University of ChicagoCo-Authors: Timothy Seastedt, University of Coloradoat BoulderESAlicia Sanchez..................................11:45 AM, Glen IPresentation Title: Arginine Vasopressin Neuronsin Suprachiasmatic Nucleus of Transgenic MiceDeficient in FGF8 and FGFR1Research Mentor: Pei-San TsaiResearch Institution: University of Colorado BoulderHome Institution: Saint Mary’s UniversityCo-Authors: Scott Kavanaugh, University of Coloradoat BoulderBBGabriel Augusto Sanchez........ 3:15 PM, Springdale IPresentation Title: Poverty and Race in the UnitedStatesResearch Mentor: Matthew SnippResearch Institution: Stanford UniversityHome Institution: UCLACo-Authors: Matthew Snipp, Stanford UniversitySchool of Humanities & SciencesSSKathryn Sanchez.................................3:45 PM, AlderPresentation Title: Assessing Hippocampal Metabolismof MPS VII Mice by High Resolution RespirometryResearch Mentor: John WolfeResearch Institution: University of PennsylvaniaHome Institution: New Mexico State UniversityCo-Authors: Michael Parente, Erzsebet Polyak and JohnWolfe, University of PennsylvaniaBBCarlos Santos-Perez..................... 12:30 PM, Aspen IIPresentation Title: DAX1 and WT1: Novel Regulatrosof the LHß TranscriptionResearch Mentor: Margaret ShupnikResearch Institution: University of Virginia Schoolof MedicineHome Institution: UPR-CayeyCo-Authors: Margaret Shupnik, Josefa Andradeand Debalina Bagchi, University of Virginia -BioMedical SciencesBBSarah Schrader...................................4:00 PM, Elm IIPresentation Title: Modeling IDH1 Mutations in NeuralCell Types Derived from Human Embryonic StemCellsResearch Mentor: Dimitris PlacantonakisResearch Institution: New York University SacklerInstituteHome Institution: Western Kentucky UniversityCo-Authors: Aram S. Modrek, Thomas A. Neubert andDimitris G. Placantonakis, New York University -BioMedical SciencesBBAmber Shaffer.....................................4:45 PM, AlderPresentation Title: Does Depression Lead to IncidentDiabetes in African Americans?: The Jackson HeartStudyResearch Mentor: Wen-ChihHank WUResearch Institution: Brown UniversityHome Institution: Tougaloo CollegeCo-Authors: Tracey Traveria, Annie Gjelsvik and WenchihWu, Brown UniversityABZakariyah Sharif-Sidi.................. 12:15 PM, Aspen IIPresentation Title: Bioinformatic Analysis of theTranscription Factors Involved in Cochlear SynapseFormationResearch Mentor: Jianxin BaoResearch Institution: Washington University in St. LouisHome Institution: University of ChicagoCo-Authors: Jianxin Bao and Ruqiang Liang,Washington University in St. LouisBBTyler Sharp....................................... 4:00 PM, Cove IIPresentation Title: Love Prejudice: An UnderestimatedSocial ProblemResearch Mentor: Nicole SheltonResearch Institution: Princeton UniversityHome Institution: University of DelawareCo-Authors: Nicole Shelton, Princeton UniversitySSAndrea Shergalis...............................3:00 PM, Glen IIPresentation Title: Stabilities of Rhenium ComplexesFormed by N2S2 and N3S LigandsResearch Mentor: Lynn FrancesconiResearch Institution: Hunter CollegeHome Institution: University of AkronCo-Authors: Lynn Francesconi and Samuel Groveman,Hunter CollegeAB

52 | Student Oral Presentations by NAMEJavier Sierra-Pagán......................... 11:45 AM, Elm IIPresentation Title: Characterization of the Role ofHdac3 and Hopx in Cardiac Cell Differentiation InVitroResearch Mentor: Jonathan EpsteinResearch Institution: University of PennsylvaniaHome Institution: UPR-Rio PiedrasCo-Authors: Kurt A. Engleka and Jonathan A. Epstein,University of PennsylvaniaBBLaTonya Simon.................................2:45 PM, Glen IIPresentation Title: Synthesis and Characterization ofPhotodegradable Oxime Derived MicroparticlesResearch Mentor: LaTonya SimonResearch Institution: University of Colorado BoulderHome Institution: University of Maryland,Baltimore CountyCo-Authors: Kristi Anseth and Michael Fleming,University of Colorado at BoulderABAndrei Smid..................................... 11:45 AM, AlderPresentation Title: Skp2 E3-ligase Inhibitors as Probesfor Cell Cycle Analysis in CancerResearch Mentor: Leslie GoldResearch Institution: New York University SacklerInstituteHome Institution: Jacobs University BremenCo-Authors: Leslie Gold and Savvas Pavlides, New YorkUniversity - BioMedical SciencesBBMichael Snyder...................................5:45 PM, Elm IIPresentation Title: Inducible, Reversible Depletion ofEndogenous Proteins in Mammalian CellsResearch Mentor: Andrew HollandResearch Institution: Johns Hopkins UniversityHome Institution: Boston UniversityCo-Authors: Andrew Holland, Johns HopkinsUniversityBBFolasade Sofela.................................11:15 AM, Glen IPresentation Title: Effects of Hypoxia on gamma-Secretase Activity in Neuronal CellsResearch Mentor: Yueming LiResearch Institution: Weill Cornell Medical CollegeHome Institution: Harvard UniversityCo-Authors: Yueming Li and Danica Chiu, WeillCornell/Rockefeller/Sloan-Kettering Tri-InstitutionalBBEmilio Soto.................................... 12:15 PM, Glen IIIPresentation Title: The Role of Sensory Cortex in CueinducedRelapse to Drug AddictionResearch Mentor: Robert FroemkeResearch Institution: New York UniversitySackler InstituteHome Institution: UPR-Rio PiedrasCo-Authors: Robert Froemke and Kishore Kuchibhotla,New York University - BioMedical SciencesBBZoe Spafford................................... 11:45 AM, Glen IIPresentation Title: The Spacial Organization of SkilledBehavior Within an Identified Neural CircuitResearch Mentor: Micheal LongResearch Institution: New York University SacklerInstituteHome Institution: University of Maryland, BaltimoreCountyCo-Authors: Michael Long, New York University -BioMedical SciencesABRyan Spector......................................2:45 PM, Elm IIPresentation Title: The Role of CDC25A in NeuronalApoptosisResearch Mentor: Lloyd GreeneResearch Institution: Columbia UniversityHome Institution: Rochester Institute of TechnologyCo-Authors: Lloyd Greene and Stav Kemeny, ColumbiaUniversityBBVaughn Spurrier................................ 4:00 PM, Glen IPresentation Title: NMR Studies of the Q5A, G6SUnmyristylated Feline Immunodeficiency VirusMatrix ProteinResearch Mentor: Michael SummersResearch Institution: University of Maryland, BaltimoreCountyHome Institution: Temple UniversityCo-Authors: Michael Summers and Lola Brown,University of Maryland, Baltimore CountyBB

Cultivating Excellence and Empowering Great Minds | 53Phillip Stephens.................................3:30 PM, Elm IIPresentation Title: Understanding the Genetic PathwaysControlling Foraging Behavior in C. Elegans UsingDouble Mutant AnalysisResearch Mentor: Cori BargmannResearch Institution: Weill Cornell Medical CollegeHome Institution: Morehouse CollegeCo-Authors: Steven Flavell and Cori Bargmann,Weill Cornell/Rockefeller/Sloan-Kettering Tri-InstitutionalBBAnna Stephenson...................... 2:45 PM, High RidgePresentation Title: Manipulating Atoms to CreateArtificial MaterialsResearch Mentor: Hari ManoharanResearch Institution: Stanford UniversityHome Institution: University of Notre DameCo-Authors: Hari Manoharan, Stanford UniversitySchool of Humanities & Sciences; Kenjiro Gomes,University of Notre DamePSShanira Suazo.................................. 5:30 PM, Glen IIIPresentation Title: Development of BioorthogonalProfiling of DNA Methylation (BPDM)Technology to Study the Mechanisms of DNA-Methyltransferases in the EpigenomeResearch Mentor: Minkui LuoResearch Institution: Weill Cornell Medical CollegeHome Institution: Clarkson UniversityCo-Authors: Minkui Luo and Kabirul Islam, MemorialSloan Kettering Cancer CenterBBNakul Talathi...................................... 5:15 PM, Glen IPresentation Title: NRF2 Expression in Diabetic WoundHealing TissueResearch Mentor: Daniel CeradiniResearch Institution: New York University SacklerInstituteHome Institution: University of GeorgiaCo-Authors: Daniel Ceradini, New York University -BioMedical SciencesABJoshua Taliaferro................................. 5:15 PM, Elm IPresentation Title: Utilizing Microfluidics to StudyPlatelet Activity and Thrombus Formation In VitroResearch Mentor: Lawrence BrassResearch Institution: University of PennsylvaniaHome Institution: Princeton UniversityCo-Authors: Lawrence Brass, John Welsh and SangMin, University of PennsylvaniaABMacKenzie Taylor.......................... 5:15 PM, Aspen IIPresentation Title: Novel Bisphosphonates andOsteoblast Differentiation and MineralizationResearch Mentor: Thorsten KirschResearch Institution: New York University SacklerInstituteHome Institution: Michigan State UniversityCo-Authors: Thorsten Kirsch, New York University -BioMedical SciencesABEphrath Tesfaye............................. 12:30 PM, Glen IIIPresentation Title: Changes in the Synaptic Plasticityof the Hypothalamic Paraventricular NucleusFollowing Hypertension in the AOF MenopausalMouse ModelResearch Mentor: Teresa MilnerResearch Institution: Weill Cornell Graduate SchoolHome Institution: Cornell UniversityCo-Authors: Teresa Milner and Jose Lopes, WeillCornell Graduate School of Medical SciencesBBPhillip Thomas.................................3:15 PM, Aspen IPresentation Title: An Unbiased Screen IdentifiesNew Pf1 Interactors With Biological Significancein Chromatin Modification and TranscriptionalControlResearch Mentor: Gregory DavidResearch Institution: New York UniversitySackler InstituteHome Institution: North Carolina A&T State UniversityCo-Authors: Richard Graveline, Saie Yoin Choi andGrergory David, New York University - BioMedicalSciencesBB

54 | Student Oral Presentations by NAMESelamawi Tilahun........................... 3:00 PM, Glen IIIPresentation Title: Analysis of Sperm Telomere Lengthin Men With Clinical Infertility and Its ExtensiveVariation Within SpecimensResearch Mentor: David KeefeResearch Institution: New York UniversitySackler InstituteHome Institution: James Madison UniversityCo-Authors: Danielle Antunes, Keri Kalmbach andDavid Keefe, New York University - BioMedicalSciencesBBGeorge Torres............................ 2:45 PM, Long RidgePresentation Title: Deconstructing Graphs and TheirEigenspectraResearch Mentor: Benson FarbResearch Institution: University of ChicagoHome Institution: Harvard UniversityCo-Authors: Benson Farb, University of Chicago; AbelMisrak, California Institute of TechnologyPSJayilssa Torres............................ 3:45 PM, High RidgePresentation Title: Co and Zr oxides/ Si (001) EpitaxialGrowth and Surface Analysis: Ultra High VacuumSystem ValidationResearch Mentor: Eric AltmanResearch Institution: Yale UniversityHome Institution: UPR-CayeyCo-Authors: Georg Simon and Eric Altman, YaleUniversityPSRaquel Tripp......................................3:15 PM, Elm IIPresentation Title: Separation of Maternal and FetalComponents of Products of Conception (POC)Using Laser Capture Microdissection andEvaluation of Direct PCR for Paternity Testing inSexual Assault CasesResearch Mentor: Grace Axler-DiperteResearch Institution: New York University SacklerInstituteHome Institution: College of William & MaryCo-Authors: Zoran Budimlija and Grace Axler-DiPerte,New York City Office of Chief Medical ExaminerABKevin Trujillo................................ 4:00 PM, WestoverPresentation Title: Developing Photovoltaic Cells UsingSemiconducting Polymers – Novel Methods ofHarvesting Solar EnergyResearch Mentor: Luping YuResearch Institution: University of ChicagoHome Institution: Loyola University of ChicagoCo-Authors: Luping Yu and Luyao Lu, University ofChicagoPSAndrew Tuck......................................3:30 PM, Cove IPresentation Title: Identifying Motivations forMedication Adherence in HIV-PositiveMethamphetamine-Using Men Who Have SexWith MenResearch Mentor: Jeffrey ParsonsResearch Institution: Hunter CollegeHome Institution: University of Michigan-Ann ArborCo-Authors: Jeffrey Parsons, Tyrel Starks and LeonaHess, Hunter CollegeSSKyle Tucker.......................................12:15 PM, Elm IIPresentation Title: Cell Cycle Effects of Delta Np63alpha and SAMD9L on Lung Squamous CellCarcinomaResearch Mentor: Joaquin EspinosaResearch Institution: University of Colorado BoulderHome Institution: Lafayette CollegeCo-Authors: Joaquin Espinosa and Corrie LynnGallant-Behm, University of Colorado at BoulderBBOsaze Udeagbala...............................3:45 PM, Glen IIPresentation Title: Searching for Drug Leads: A LiveCytotoxicity Assay Against Giardia lambliaResearch Mentor: Ana RodriguezResearch Institution: New York University SacklerInstituteHome Institution: Cooper UnionCo-Authors: Ana Rodriguez and Jessey Erath, NewYork University - BioMedical SciencesAB

Cultivating Excellence and Empowering Great Minds | 55Camila Uechi................................... 11:15 AM, Elm IIPresentation Title: Investigating the Mechanismsof Atrial Fibrillation Through the Use ofComputational Human Atrial ModelsResearch Mentor: David ChristiniResearch Institution: Weill Cornell Medical CollegeHome Institution: University of Maryland, College ParkCo-Authors: David Christini and Trine Krogh-Madsen,Weill Cornell/Rockefeller/Sloan-Kettering Tri-InstitutionalABTayler Ulmer.................................... 5:15 PM, Cove IIPresentation Title: African Immigration to America andthe Tri-Concious IdentityResearch Mentor: Matthew GuterlResearch Institution: Brown UniversityHome Institution: Spelman CollegeSSStephen Vicchio............................ 3:45 PM, WestoverPresentation Title: A Combinatorial Study of theDealloying of Au/Ag/Pd Metal Alloys ForImproved Fuel Cell CatalystsResearch Mentor: Andre TaylorResearch Institution: Yale UniversityHome Institution: University of Maryland, BaltimoreCountyCo-Authors: Jinyang Li, Ryan Sekol and Andre Taylor,Yale UniversityENJoseph Villanueva.......................... 5:00 PM, Aspen IIPresentation Title: Joint Repair: Engineering TissueScaffolds Using Polyethylene Glycol HydrogelsResearch Mentor: Joseph VillanuevaResearch Institution: University of Colorado BoulderHome Institution: University of New MexicoCo-Authors: Stephanie J. Bryant, Justine J. Roberts andMark D. Swartzlander, University of Colorado atBoulderABBrian Walsh..................................5:30 PM, WatersidePresentation Title: The Association Between JuvenileArrest, Health Insurance, and Health CareUtilizationResearch Mentor: Christopher WildemanResearch Institution: Yale UniversityHome Institution: Chaminade University of HonoluluCo-Authors: Christopher Wildeman and Emily Wang,Yale UniversitySSKelsey Wanhainen...........................11:30 AM, Glen IPresentation Title: Structural and Biophysical Studies ofTREM2 in Neurological DiseasesResearch Mentor: Tom BrettResearch Institution: Washington University in St. LouisHome Institution: Colgate UniversityCo-Authors: Tom Brett, Washington University in St.LouisBBSagirah Wheeler...........................3:45 PM, WatersidePresentation Title: Words of Encouragement: Listeningto the Past in Order to Prepare for the FutureResearch Mentor: Amy HillierResearch Institution: University of PennsylvaniaArts & SciencesHome Institution: Morgan State UniversityCo-Authors: Amy Hillier, University of Pennsylvania;Stephanie Boddie, University of PittsburghSSPrincess Williams.................... 5:15 PM, Springdale IPresentation Title: Are More Women Needed in theCongressional Black Caucus?Research Mentor: Matthew PlattResearch Institution: Harvard UniversityHome Institution: Jackson State UniversityCo-Authors: Matthew Platt, Harvard University, Dept.of GovernmentPESade Williams...............................3:15 PM, WatersidePresentation Title: Am I Who I Say I Am or WhatThey Say I Am?: Identity Construction in JuvenileCourtroom ProceedingsResearch Mentor: Carla SheddResearch Institution: Columbia UniversityHome Institution: Middlebury CollegeCo-Authors: Carla Shedd, Columbia UniversitySSGillian Wood...........................5:30 PM, Springdale IIPresentation Title: The Dangers of ExpectantEvaluation: The Problem of Judgment inWashington Square and The Portrait of a LadyResearch Mentor: Ross PosnockResearch Institution: Columbia UniversityHome Institution: Williams CollegeCo-Authors: Ross Posnock, Columbia UniversityHU

56 | Student Oral Presentations by NAMEKathryn Wu..................................... 4:45 PM, Glen IIIPresentation Title: Hypermethylation of CpG SitesUpstream of Hexanucleotide Repeat Expansions inthe C9ORF72 Gene of ALS and FTD PatientsResearch Mentor: Edward LeeResearch Institution: University of PennsylvaniaHome Institution: Swarthmore CollegeCo-Authors: Edward Lee and Elaine Liu, University ofPennsylvaniaABPauline Xu......................................... 12:00 PM, Elm IPresentation Title: Quantitative PhosphoproteomicAnalysis Using High-Resolution Tandem MassSpectrometryResearch Mentor: Thomas NeubertResearch Institution: New York University SacklerInstituteHome Institution: University of Maryland,Baltimore CountyCo-Authors: Thomas Neubert, Paule Hoedt and StevenBlais, New York University - BioMedical SciencesBBSaiah Yates........................................12:30 PM, Elm IIPresentation Title: Phosphorylation of Threonine 45 ofHistone H3 and the Effects of Alanine and AsparticAcid MutationsResearch Mentor: Danny ReinbergResearch Institution: New York University SacklerInstituteHome Institution: University of Maryland,Baltimore CountyCo-Authors: Danny Reinberg and Eric Campos, NewYork University - BioMedical SciencesBBAmy Zhang....................................... 12:00 PM, Glen IPresentation Title: A Quirky Inhibitory Circuit in theCerebral CortexResearch Mentor: Barry ConnorsResearch Institution: Brown UniversityHome Institution: Carnegie Mellon UniversityCo-Authors: Arthur Sugden, Barry Connors andSaundra Patrick, Brown UniversityBB

Cultivating Excellence and Empowering Great Minds | 57Poster Presentations by NumberBB = Basic BiosciencesAB = Applied BiosciencesEN = EngineeringPE = Policy & EthicsPS = Physical ScienceES = Earth ScienceSS = Social ScienceHU = Humanities1 Jesus Acevedo AB Effect of the Microtubule Targeting Drug Eribulin, on Microtubule Dynamics inBreast Cancer Cell Lines2 Tiwaloluwa Ajibewa AB Correlation Between Clinical and Field Test for Balance in Human Subjects3 Zachery Austin AB Characterization of Novel Factors that Activate the Type III Interferon Promoter4 Alexander Ballard AB A Study of KLF1 in Erythropoietin Treated TF1 Cells as a Model of Anemiaof Inflammation5 Jermaine Blakley AB The Prevention of Pancreatic Cancer by the Inhibition of Phosphatidylinositol-3-Kinase (PI-3K): The Induction of Cellular Suicide in the Endocrine Gland ofthe Pancreas for the Development of a Highly Selective Cancer Treatment6 Jazmin Branch AB Closing The Gap: Stress as a Contributor to Racial/Ethnic Disparitiesin Infant Mortality7 Karina Castro AB Transgenerational Behavioral and Morphological Deficits Due to Alcohol and/or Tobacco Nitrosamine Exposures8 Artesse Conley AB Developmental Biology: Absence Seizures9 Roberto De La Rosa AB Sensorimotor Rhythms in the Motor Cortex of a Rhesus Macaque Performing aMotor Task Through a Brain-Machine Interface10 Breann De Santiago AB Rotten Eggs’ H2S Acting on Human Airway Smooth Muscle Mechanics11 Samantha Dizon AB The Impact of Adherence on Health Related Quality of Life in Patientswith Cystic Fibrosis12 Leena Doolabh AB Imaging Tumor Endothelial Cells with Lectin Nanoparticles13 Marcus Florez AB Epigenetic Influences on T Cell Differentiation and Function14 Ruthly Francois AB Understand the Tumorigenesis of Breast Cancer15 Samuel Garcia AB Targeted Sequencing of Novel Genes Associated with Airway Reactivity from aGenome Wide Association Study Performed on Lung Health Study Data16 Robert Gutierrez AB Nanopiece: A Stabilizing and Protecting Vehicle for Molecular Beacon Delivery17 Ridwan Hassen AB The Role of Phospholipase A2 in Neuronal Development18 Danielle Hindes AB Evaluating the Role of the Lipofuscin Bisretinoid A2E in Age Related MacularDegeneration and the Characterization of the Candidate DrugBeta-Cyclodextrin19 Danielle Hyatt AB The Role of Laminar Shear Stress on Endothelial Cells20 Danyelle Johnson AB Identifying C-Kit Cardiac Stem Cells in Post-Myocardial Infarcted Heart21 Joshua Jones AB Development of a KSHV Bacterial Artificial Chromosome Clone to EvaluateLANA’s Role in Episome Maintenance22 Oluwabusayo Lana AB Traumatic Brain Injury: Quantifying Atrophy of the Hippocampus andthe Cortex23 Kayla Lapier AB The Expression of Aquaporin 3b During Nervous System Development inEmbryos of Xenopus laevis24 Aranza Portugal Leon AB The Effects of a Nutrition Education Program on Nutrition Knowledge,Attitudes, and Behaviors Among Elementary School Children in New York City25 Danielle Miyagishima AB Effects of Camptothecin on Survivability of Dorsal Root Ganglion26 Ilkania Paulino Cenit AB Evaluation of IRGM Gene Expression and Reference Genes in Epstein-BarrVirus-Transformed Lymphoblastoid Cell Lines27 Pedro Perez AB Identification of Novel Survival of Motor Neuron Protein Stabilizers

58 | Poster Presentations by NUMBER28 Eshaan Rao AB Smoothened Inhibitor, LDE225, Induces Apoptosis in Medulloblastoma CellsThrough Activation of the Intrinsic Apoptotic Pathway29 Andres Rosario AB Breast Cancer Specimen Imaging to Detect Residual Cancer During Surgery30 Marcus Vandall AB Purification of Escherichia coli Cascade31 Kadar Vannoy AB An Analysis to Determine Association of Deimination With Aging32 Sahim Wallace AB Development of a Cell Based Assay for Characterizing Clostridium novyiInduced Inflammation in Mice33 Raymond White AB Multilocus Variable Number Tandem Repeat Analysis (MLVA) of ExtendedSpectrum Beta-Lactamase (ESBL)-producing Strains of Klebsiella Pneumoniae34 Ifeolu Akinnola BB Gene Therapy: Retinitis Pigmentosa35 Korleki Akiti BB GABAergic Neurons in the Ventral Tegmental Area Modulate RewardExpectation During Associative Learning36 Yonathan Ararso BB Melanoma-derived Factors TGFß1 and VEGF-A Suppress Anti-TumorImmunity by Interfering with Dendritic Cell Maturation and Activation37 Maria Banuelos BB Discerning the Role of Self-Identity Proteins in Isolates of the PathogenProteus mirabilis38 Erick Bayala BB Use of the Gal4/UAS System to Study the Functional Evolution of Novel Genesin Drosophila Species39 Kirollos Bechay BB Characterization and Elucidation of DNA Compaction in theDeveloping Embryo40 Vivian Chioma BB The Prevalence of Dopamine D2 Receptors in Striatal Cholinergic Interneurons41 Achala Chittor BB Cth1 is a Potential Regulator of Nodal Signaling in Zebrafish42 Kathryn Coe BB Measuring the Effects of Desmosterol on the Activity of the Hepatitis CVirus Replicase43 Laura Craciun BB The Classification of Interneurons in the Thalamic Reticular Nucleus44 Marylyn Creer BB Studying Protein Interactions Among Aquilegia MADS-BoxTranscription Factors45 Kayla Davis BB Characterizing the Role of SNX9 in Autophagosome Maturation46 Josephine Gonzales BB Validating Genetic Tools for Suppressing Major Oxidative DNADamage-Repairing Proteins47 Nicole Hernandez BB Regulation of Mitochondrial Release From Microtubules During Cell Division48 Elvina Hogan BB Galectin-3 Production for Cancer Studies49 Linda Honaker BB It’s Getting Hot in Here: Structural and Functional Studies on Thermo-SensitiveIon Channels50 Tonee’ Jones BB Characterizing the Function of Mycobacterium Tuberculosis Efflux Pumps in aMycobacterium Smegmatis Overexpression System51 Jennifer Kamara BB Interrogation of Lipid-Protein Interactions Involved in Cellular Uptake of LipidNanoparticle-Formulated siRNA52 Wilhemina Koomson BB The Role of Microtubule Regulation During Synaptic Development53 Mark Lampert BB Cystic Fibrosis Cell Proliferation Rates54 Sarah Manmiller BB Determining the Significance of Trim28 for Twist1-induced EpithelialmesenchymalTransition55 Sara Marin BB Gene Mutations Associated With Familial Acute Myeloid Leukemia56 Eileen Martinez BB Inter-Bacterial Interactions With Pseudomonas Aeruginosa and the Role ofoprF in Host Phagocyte Association57 Peter Mercado-Reyes BB Study on the Long-term Effects of Antipsychotics:The Impact of Sustained D2Neuron Activity on Motor Learning and Motor Performance

Cultivating Excellence and Empowering Great Minds | 5958 Javier Morales-Gonzalez BB Is mTOR Steady State PI3K Dependent?59 Saige Pompura BB Characterizing the Caenorhabditis elegans Systemic RNAi Protein SID-260 Monica Quinones-Frias BB Investigation of the Mechanism of Gamma-Secretase C-terminal Trimmingof Amyloid Beta61 Vani Ravichandran BB Overexpress Yourself: It’s Good For The Heart!62 Valeria Reyes Ruiz BB Investigating the Role of AHNAK and Sfpq Host Cell Receptors for ListeriaMonocytogenes Invasion63 Gaddiel Rodriguez BB A High Throughput Assay for SAMHD1 Activity64 Lloydine Runsabove BB Characterization of Nitrogen Fixing Cyanobacteria for Organic Bio-fertilizer65 Tanisha Saini BB Testing the Contribution of Chromosome Anchoring to Efficient DNATransport During Sporulation in Bacillus Subtilis66 Elisa Sanchez BB Regulation of ERRA by the Molecular Motor Protein KIF1767 Mary Soliman BB Development of a Comprehensive Approach to Maldi Imaging68 Raiha Tahir BB Investigation of Protein-Protein Interactions Within the Yeast HistoneAcetyltransferase Complex NuA369 Meaghan Valliere BB Purification of the Native Orphan Response Regulator, HP 1043, FromHelicobacter pylori70 Lindsey Wirsing BB Gene Expression Analysis of the Human IL1RN Gene Using Real-Time PCR71 Theodore Zaki BB Optimization of RNA Extraction and Purification Protocols from SmallCell Samples72 Melissa Carr-Reynolds BB Potential Mechanisms Underlying Stress Effects on Neurogenesis73 Jeffrey Brown ES Variations of Phosphate Concentration on CyanobacterialBiofertilizer Production74 Sasha Rivers ES Soil Ecology of the American Prairie Reserve75 Darius Stanton ES Pelagic Microbial Community Structure Along an Estuarine Gradientin Narragansett Bay76 Jacob Alvarez EN Determining the Cause of Performance Decline of a PEM Fuel Cell77 Cynthia Barajas EN Real-Time Hardware Identification of Single Ion Channel Gating78 DeMarcus Crews PS Development of an H-bond Donor Catalyst for Beta-Selective Glycosylation of2-Deoxycarbohydrates79 Jean Guillaume PS Blending Finite Element with Penalty Immersed Boundary to InvestigateHemodynamics in the Aorta80 Tiffany King PS Analysis of Proton Transport in [Fe-Fe] Hydrogenase Through an ActivatedSecondary Water Channel81 William Marrero-Ortiz PS Synthesis of a Stereoselective and Functionalized All-Hydrocarbon StapledPeptide Olefin82 Josh Taylor PS Providing Safe and Reliable Interfacing from Vehicle-to-Vehicle Using W.A.V.E.83 Tre Wells PS Data Envelopment Analysis and Its Application to Public School Systems84 Lisbeth Acosta SS Influence of Home Visiting Program on Young Mothers’ Parental Stress andCorporal Punishment85 Tangeria Adams SS The Effects of Physical Exercise Duration on Social and Attentional Impairmentsin a Rat Model of ADHD86 Samantha Angell SS What’s in a Word? Associations Between Teacher Word Choice andObserved Effectiveness87 Chi-Hang Au SS Marijuana Legalization: Effects on Youth Aggressive Behavior

60 | Poster Presentations by NUMBER88 Nia Blackwolf SS Native American Need for Alcohol Treatment; Abuse Squared89 Caitlin Brown SS Exploring Discrepancies in Teacher and Student Perceptions of EmotionalSupport in the Classroom90 Johanel Caceres SS Does Mother’s and Father’s Time in the U.S. Influence Second-GenerationChildren’s Vocabulary in English and Spanish91 Mariela Castro SS ¡Mijo, You Can Co It!: Exploring the Relationship Between MaternalExpectations and Effortful Control Among Second Generation Preschoolers92 Cheryl Coleman SS Testing PAAS Intervention Effects on Rural African American Youths’Academic Aspiration93 Jose Cuchilla SS Social Support and Health Behavior: Exploring Associations to Diabetes amongthe Hispanic Community94 Jennifer Garraway SS Stimulant Effects on Emotion in Healthy Volunteers95 Charity Crowell SS Stressed Out in the Classroom? Predictors of Stress and Links toTeacher Quality96 Aasha Jackson SS This Is Us: Teaching High School Students to Conduct Research inTheir Communities97 Jessica Manfredi SS This Is Us: Teaching High School Students to Conduct Research in TheirCommunities98 Micah Melia SS Do State Standardized Graduation Requirements Improve Minority StudentOutcomes?: The Case of the Michigan Merit Curriculum99 Victoria Quinones SS Understanding the Pathway to Suicide: The Role of Planning for Suicide100 Caio Santos Rodrigues SS Individual differences in intentionality judgments for victims differing in socialstatus101 Alexis Staver SS The Relation Between Child Maltreatment and Socioemotional Development ofChildren in the First Two Years of Their Life102 Krystal Thomas SS Unpacking the Black Box of Coaching Conferences: The Link Between Teacherand Classroom Characteristics and Coaches’ Approach to Feedback103 Jeremiah Williams SS Position Dependence of Human Visual Object Recognition104 Aspen Yoo SS Investigating Orientation Invariance in Visual Object Recognition105 Maria Martinez SS Position Dependency in Object Recognition

Cultivating Excellence and Empowering Great Minds | 61Poster Presentations by NameJesus Acevedo, 1.................................... 8:45-9:45 AMPresentation Title: Effect of the Microtubule TargetingDrug Eribulin, on Microtubule Dynamics in BreastCancer Cell LinesResearch Mentor: Alexandre MatovResearch Institution: Weill Cornell Graduate SchoolHome Institution: UPR-Rio PiedrasCo-Authors: Alexandre Matov, Weill Cornell GraduateSchool of Medical SciencesLisbeth Acosta, 84............................... 9:45-10:45 AMPresentation Title: Influence of Home Visiting Programon Young Mothers’ Parental Stress and CorporalPunishmentResearch Mentor: Jana ChaudhuriResearch Institution: Tufts UniversityHome Institution: UMass AmherstCo-Authors: Ann Easterbrooks and Jana Chaudhuri,Tufts UniversityTangeria Adams, 85.............................. 8:45-9:45 AMPresentation Title: The Effects of Physical ExerciseDuration on Social and Attentional Impairmentsin a Rat Model of ADHDResearch Mentor: David BucciResearch Institution: Dartmouth CollegeHome Institution: Brooklyn College CUNYCo-Authors: Andrea Robinson and David Bucci,Dartmouth CollegeTiwaloluwa Ajibewa, 2........................ 9:45-10:45 AMPresentation Title: Correlation Between Clinical andField Test for Balance in Human SubjectsResearch Mentor: Joseph SignorileResearch Institution: University of MiamiHome Institution: University of Minnesota MorrisCo-Authors: Joseph Signorile and Karin Dowen,University of MiamiIfeolu Akinnola, 34............................. 9:45-10:45 AMPresentation Title: Gene Therapy: Retinitis PigmentosaResearch Mentor: Constance CepkoResearch Institution: Harvard University, Divisionof Medical SciencesHome Institution: University of Maryland,Baltimore CountyCo-Authors: EVedangi Sample and Constance Cepko,Harvard Medical School, Dept. of GeneticsKorleki Akiti, 35.................................... 8:45-9:45 AMPresentation Title: GABAergic Neurons in the VentralTegmental Area Modulate Reward ExpectationDuring Associative LearningResearch Mentor: Nao UchidaResearch Institution: Harvard UniversityHome Institution: Princeton UniversityCo-Authors: Neir Eshel, Harvard Medical School,Neuroscience Program; Nao Uchida, HarvardUniversity, Dept. of Molecular and Cellular BiologyJacob Alvarez, 76................................. 9:45-10:45 AMPresentation Title: Determining the Cause ofPerformance Decline of a PEM Fuel CellResearch Mentor: Christopher EdwardsResearch Institution: Stanford University EngineeringHome Institution: University of Maryland,Baltimore CountyCo-Authors: Christopher Edwards and Carol Regalbuto,Stanford University School of EngineeringSamantha Angell, 86........................... 9:45-10:45 AMPresentation Title: What’s in a Word? AssociationsBetween Teacher Word Choice and ObservedEffectivenessResearch Mentor: Jennifer LoCasale-CrouchResearch Institution: University of Virginia Schoolof EducationHome Institution: Ripon CollegeCo-Authors: Amy Roberts and Jennifer LoCasale-Crouch,University of Virginia - Education SciencesYonathan Ararso, 36........................... 9:45-10:45 AMPresentation Title: Melanoma-derived Factors TGFß1and VEGF-A Suppress Anti-Tumor Immunity byInterfering with Dendritic Cell Maturation andActivationResearch Mentor: Jie JiangResearch Institution: Weill Cornell Graduate SchoolHome Institution: Hampden-Sydney CollegeCo-Authors: Kristian Hargadon, Hampden-SydneyCollegeChi-Hang Au, 87................................... 8:45-9:45 AMPresentation Title: Marijuana Legalization: Effects onYouth Aggressive BehaviorResearch Mentor: Daniel PlayerResearch Institution: University of Virginia Schoolof EducationHome Institution: Liberty UniversityCo-Authors: Daniel Player and Disha Venkatesan,University of Virginia - Education Sciences

62 | Poster Presentations by NAMEZachery Austin, 3.................................. 8:45-9:45 AMPresentation Title: Characterization of Novel Factorsthat Activate the Type III Interferon PromoterResearch Mentor: Emmanuel ThomasResearch Institution: University of MiamiHome Institution: Morehouse CollegeCo-Authors: Emmanuel Thomas, University of MiamiAlexander Ballard, 4........................... 9:45-10:45 AMPresentation Title: A Study of KLF1 in ErythropoietinTreated TF1 Cells as a Model of Anemia ofInflammationResearch Mentor: Cindy RoyResearch Institution: Johns Hopkins UniversityHome Institution: University of Maryland,Baltimore CountyCo-Authors: Jackie M. Langdon, Brian J. McCranor andDr. Cindy N. Roy, Johns Hopkins UniversityMaria Banuelos, 37............................... 8:45-9:45 AMPresentation Title: Discerning the Role of Self-IdentityProteins in Isolates of the Pathogen Proteus mirabilisResearch Mentor: Karine GibbsResearch Institution: Harvard UniversityHome Institution: University of RedlandsCo-Authors: Lia Cardarelli, Martha Zepeda and KarineGibbs, Harvard University, Dept. of Molecular andCellular BiologyCynthia Barajas, 77............................... 8:45-9:45 AMPresentation Title: Real-Time Hardware Identification ofSingle Ion Channel GatingResearch Mentor: Jacob RosensteinResearch Institution: Brown UniversityHome Institution: California State Polytechnic UniversityCo-Authors: Jacob Rosenstein, Brown UniversityErick Bayala, 38................................... 9:45-10:45 AMPresentation Title: Use of the Gal4/UAS System to Studythe Functional Evolution of Novel Genesin Drosophila SpeciesResearch Mentor: Cassandra ExtavourResearch Institution: Harvard UniversityHome Institution: UPR-HumacaoCo-Authors: Cassandra Extavour and Tripti Gupta,Harvard University, Dept. of Organismic andEvolutionary BiologyKirollos Bechay, 39............................... 8:45-9:45 AMPresentation Title: Characterization and Elucidationof DNA Compaction in the Developing EmbryoResearch Mentor: Susan MangoResearch Institution: Harvard UniversityHome Institution: UC IrvineCo-Authors: Susan Mango and Huei Mei Chen, HarvardUniversity, Dept. of Molecular and Cellular BiologyNia Blackwolf, 88................................ 9:45-10:45 AMPresentation Title: Native American Need for AlcoholTreatment; Abuse SquaredResearch Mentor: George HaynesResearch Institution: Montana State University - BozemanHome Institution: Montana State University - BozemanCo-Authors: George Haynes, Montana State UniversityJermaine Blakley, 5............................... 8:45-9:45 AMPresentation Title: The Prevention of PancreaticCancer by the Inhibition of Phosphatidylinositol-3-Kinase (PI-3K): The Induction of CellularSuicide in the Endocrine Gland of the Pancreasfor the Development of a Highly Selective CancerTreatmentResearch Mentor: Karen Jackson-WeaverResearch Institution: Princeton UniversityHome Institution: Morehouse CollegeCo-Authors: Celeste Nelson, Princeton UniversityJazmin Branch, 6................................. 9:45-10:45 AMPresentation Title: Closing The Gap: Stress as aContributor to Racial/Ethnic Disparities inInfant MortalityResearch Mentor: Micere KeelsResearch Institution: University of ChicagoHome Institution: Washington University in St. LouisCo-Authors: Micere Keels, University of ChicagoCaitlin Brown, 89.................................. 8:45-9:45 AMPresentation Title: Exploring Discrepancies in Teacherand Student Perceptions of Emotional Support inthe ClassroomResearch Mentor: Jason DownerResearch Institution: University of Virginia Schoolof EducationHome Institution: Southern Oregon UniversityCo-Authors: Sadie Hasbrouck and Jason Downer,University of Virginia - Education Sciences

Cultivating Excellence and Empowering Great Minds | 63Jeffrey Brown, 73................................... 8:45-9:45 AMPresentation Title: Variations of PhosphateConcentration on Cyanobacterial BiofertilizerProductionResearch Mentor: Rich MacurResearch Institution: Montana State University -BozemanHome Institution: Montana State University -BozemanCo-Authors: Rich Macur, Lloydine Runsabove and LisaWeeks, Montana State UniversityJohanel Caceres, 90............................. 9:45-10:45 AMPresentation Title: Does Mother’s and Father’s Time inthe U.S. Influence Second-Generation Children’sVocabulary in English and SpanishResearch Mentor: Natalia PalaciosResearch Institution: University of Virginia Schoolof EducationHome Institution: Skidmore CollegeCo-Authors: Ashley Simpson, Natalia Palacios andAmanda Kibler, University of Virginia - EducationSciencesMelissa Carr-Reynolds, 72................. 9:45-10:45 AMPresentation Title: Potential Mechanisms UnderlyingStress Effects on NeurogenesisResearch Mentor: Kevin BathResearch Institution: Brown UniversityHome Institution: Spelman CollegeCo-Authors: Kevin Bath, Brown UniversityKarina Castro, 7.................................... 8:45-9:45 AMPresentation Title: Transgenerational Behavioral andMorphological Deficits Due to Alcohol and/orTobacco Nitrosamine ExposuresResearch Mentor: Suzanne de la MonteResearch Institution: Brown UniversityHome Institution: Saint John’s UniversityCo-Authors: Suzanne de la Monte and Teresa Ramirez,Brown University; Tomas Andreani, Pitzer CollegeMariela Castro, 91................................. 8:45-9:45 AMPresentation Title: ¡Mijo, You Can Co It!: Exploringthe Relationship Between Maternal Expectationsand Effortful Control Among Second GenerationPreschoolersResearch Mentor: Natalia PalaciosResearch Institution: University of Virginia Schoolof EducationHome Institution: University of Nevada, RenoCo-Authors: Ashley Simpson, Natalia Palacios andAmanda Kibler, University of Virginia - EducationSciencesVivian Chioma, 40.............................. 9:45-10:45 AMPresentation Title: The Prevalence of Dopamine D2Receptors in Striatal Cholinergic InterneuronsResearch Mentor: Daniel McGeheeResearch Institution: University of ChicagoHome Institution: University of Maryland,Baltimore CountyCo-Authors: Daniel McGehee and Austin Lim,University of ChicagoAchala Chittor, 41................................. 8:45-9:45 AMPresentation Title: Cth1 is a Potential Regulator ofNodal Signaling in ZebrafishResearch Mentor: Alexander SchierResearch Institution: Harvard UniversityHome Institution: Williams CollegeCo-Authors: Alexander Schier and James Gagnon,Harvard University, Dept. of Molecular andCellular BiologyKathryn Coe, 42.................................. 9:45-10:45 AMPresentation Title: Measuring the Effects ofDesmosterol on the Activity of the Hepatitis CVirus ReplicaseResearch Mentor: Priscilla YangResearch Institution: Harvard University, Divisionof Medical SciencesHome Institution: Colby CollegeCo-Authors: alerie Villareal and Priscilla Yang,Harvard Medical School, Dept. of Microbiologyand ImmunobiologyCheryl Coleman, 92............................ 9:45-10:45 AMPresentation Title: Testing PAAS InterventionEffects on Rural African American Youths’Academic AspirationResearch Mentor: Velma MurryResearch Institution: Vanderbilt UniversityHome Institution: Claflin UniversityCo-Authors: Velma Murry and Na Liu,Vanderbilt UniversityArtesse Conley, 8................................. 9:45-10:45 AMPresentation Title: Developmental Biology:Absence SeizuresResearch Mentor: Karen Jackson-WeaverResearch Institution: Princeton UniversityHome Institution: Morehouse CollegeCo-Authors: Rodney Priestley, Princeton University

64 | Poster Presentations by NAMELaura Craciun, 43................................. 8:45-9:45 AMPresentation Title: The Classification of Interneuronsin the Thalamic Reticular NucleusResearch Mentor: Barry ConnorsResearch Institution: Brown UniversityHome Institution: New York UniversityCo-Authors: Barry Connors, Brown UniversityMarylyn Creer, 44............................... 9:45-10:45 AMPresentation Title: Studying Protein InteractionsAmong Aquilegia MADS-Box TranscriptionFactorsResearch Mentor: Elena KramerResearch Institution: Harvard UniversityHome Institution: Alabama A&M UniversityCo-Authors: Elena Kramer and Lynn Holappa,Harvard University, Dept. of Organismic andEvolutionary BiologyDeMarcus Crews, 78........................... 9:45-10:45 AMPresentation Title: Development of an H-bond DonorCatalyst for Beta-Selective Glycosylation of2-DeoxycarbohydratesResearch Mentor: Eric JacobsenResearch Institution: Harvard UniversityHome Institution: Morehouse CollegeCo-Authors: Eric Jacobsen, Kaid Harper and DanLehnherr, Harvard University, Dept. of ChemistryCharity Crowell, 95............................... 8:45-9:45 AMPresentation Title: EStressed Out in the Classroom?Predictors of Stress and Links to Teacher QualityResearch Mentor: Jennifer LoCasale-CrouchResearch Institution: University of Virginia Schoolof EducationHome Institution: University of Alabama-TuscaloosaCo-Authors: Amy Roberts and Jennifer LoCasale-Crouch, University of Virginia - Education SciencesJose Cuchilla, 93.................................... 8:45-9:45 AMPresentation Title: Social Support and Health Behavior:Exploring Associations to Diabetes among theHispanic CommunityResearch Mentor: Micere KeelsResearch Institution: University of ChicagoHome Institution: California State PolytechnicUniversity, PomonaCo-Authors: Micere Keels, University of ChicagoKayla Davis, 45...................................... 8:45-9:45 AMPresentation Title: Characterizing the Role of SNX9in Autophagosome MaturationResearch Mentor: Wade HarperResearch Institution: Harvard University, Divisionof Medical SciencesHome Institution: Oklahoma State UniversityCo-Authors: Laura Pontano-Vaites and Wade Harper,Harvard Medical School, Dept. of Cell BiologyRoberto De La Rosa, 9.......................... 8:45-9:45 AMPresentation Title: Sensorimotor Rhythms in the MotorCortex of a Rhesus Macaque Performing a MotorTask Through a Brain-Machine InterfaceResearch Mentor: Nicholas HatsopoulosResearch Institution: University of ChicagoHome Institution: Brown UniversityCo-Authors: Nicholas Hatsopoulos, KarthikeyanBalasubramanian and Mukta Vaidya, Universityof ChicagoBreann De Santiago, 10...................... 9:45-10:45 AMPresentation Title: Rotten Eggs’ H2S Acting on HumanAirway Smooth Muscle MechanicsResearch Mentor: Steven AnResearch Institution: Johns Hopkins UniversityHome Institution: Whittier CollegeCo-Authors: Steven An and Robert Fitzerald, JohnsHopkins UniversitySamantha Dizon, 11.............................. 8:45-9:45 AMPresentation Title: The Impact of Adherence on HealthRelated Quality of Life in Patients with CysticFibrosisResearch Mentor: Michelle EakinResearch Institution: Johns Hopkins UniversityHome Institution: Loyola UniversityCo-Authors: Michelle Eakin and Kristin Riekert, JohnsHopkins UniversityLeena Doolabh, 12.............................. 9:45-10:45 AMPresentation Title: Imaging Tumor Endothelial Cellswith Lectin NanoparticlesResearch Mentor: Arvind PathakResearch Institution: Johns Hopkins UniversityHome Institution: University of DelawareCo-Authors: Karen Hong, Yoshinori Kato and ArvindPathak, Johns Hopkins University

Cultivating Excellence and Empowering Great Minds | 65Marcus Florez, 13................................. 8:45-9:45 AMPresentation Title: Epigenetic Influences on T CellDifferentiation and FunctionResearch Mentor: Franco D’AlessioResearch Institution: Johns Hopkins UniversityHome Institution: University of KansasCo-Authors: Benjamin Singer and Franco D’Alessio,Johns Hopkins UniversityRuthly Francois, 14............................. 9:45-10:45 AMPresentation Title: Understand the Tumorigenesis ofBreast CancerResearch Institution: Novartis Institutes for BioMedicalResearchCo-Authors: Victor Lin, Ning Guo and Yi Yang, NovatisInstitutes for BioMedical ResearchSamuel Garcia,15.................................. 8:45-9:45 AMPresentation Title: Targeted Sequencing of Novel GenesAssociated with Airway Reactivity from a GenomeWide Association Study Performed on Lung HealthStudy DataResearch Mentor: Kathleen BarnesResearch Institution: Johns Hopkins UniversityHome Institution: University of Texas at El PasoCo-Authors: Nicholas Rafaels, Rasika Mathias andKathleen Barnes, Johns Hopkins UniversityJennifer Garraway, 94......................... 9:45-10:45 AMPresentation Title: Stimulant Effects on Emotion inHealthy VolunteersResearch Mentor: Tara WhiteResearch Institution: Brown UniversityHome Institution: Hunter CollegeCo-Authors: Mikalei Gordon and Tara White, BrownUniversityJosephine Gonzales, 46....................... 9:45-10:45 AMPresentation Title: Validating Genetic Tools forSuppressing Major Oxidative DNA Damage-Repairing ProteinsResearch Mentor: Priyamvada RaiResearch Institution: University of MiamiHome Institution: CSU San MarcosCo-Authors: Priyamvada Rai, Anisleidys Munoz andBrooke Zarouri, University of MiamiJean Guillaume, 79................................ 8:45-9:45 AMPresentation Title: Blending Finite Element with PenaltyImmersed Boundary to Investigate Hemodynamicsin the AortaResearch Mentor: Johnny GuzmanResearch Institution: Brown UniversityHome Institution: Brooklyn College CUNYCo-Authors: Johnny Guzman, Samy Wu and AnthonyPellegrino, Brown UniversityRobert Gutierrez, 16........................... 9:45-10:45 AMPresentation Title: Nanopiece: A Stabilizing andProtecting Vehicle for Molecular Beacon DeliveryResearch Mentor: Qian ChenResearch Institution: Brown UniversityHome Institution: Santa Barbara City CollegeCo-Authors: Yupeng Chen and Qian Chen, BrownUniversityRidwan Hassen, 17................................ 8:45-9:45 AMPresentation Title: The Role of Phospholipase A2 inNeuronal DevelopmentResearch Mentor: Bryan LuikartResearch Institution: Dartmouth CollegeHome Institution: Emory UniversityCo-Authors: Bryan Luikart and Katie Fricano,Dartmouth CollegeNicole Hernandez, 47........................... 8:45-9:45 AMPresentation Title: Regulation of Mitochondrial ReleaseFrom Microtubules During Cell DivisionResearch Mentor: Tom SchwarzResearch Institution: Harvard University, Division ofMedical SciencesHome Institution: UC IrvineCo-Authors: Thomas Schwarz, Harvard MedicalSchool, Children’s Hospital; Jarom Chung, HarvardMedical School, Biological and Biomedical SciencesProgramDanielle Hindes, 18............................ 9:45-10:45 AMPresentation Title: Evaluating the Role of theLipofuscin Bisretinoid A2E in Age Related MacularDegeneration and the Characterization of theCandidate Drug Beta-CyclodextrinResearch Mentor: Marcelo NociariResearch Institution: Weill Cornell Graduate SchoolHome Institution: SUNY College at FredoniaCo-Authors: Marcelo Nociari, Weill Cornell GraduateSchool of Medical Sciences

66 | Poster Presentations by NAMEElvina Hogan, 48................................. 9:45-10:45 AMPresentation Title: Galectin-3 Production forCancer StudiesResearch Mentor: Mary CloningerResearch Institution: Montana State University -BozemanHome Institution: Little Big Horn CollegeCo-Authors: Mary Cloninger and Anna Michel,Montana State UniversityLinda Honaker, 49................................ 8:45-9:45 AMPresentation Title: It’s Getting Hot in Here: Structuraland Functional Studies on Thermo-SensitiveIon ChannelsResearch Mentor: Rachelle GaudetResearch Institution: Harvard UniversityHome Institution: San Diego State UniversityCo-Authors: Ute Hellmich, Harvard University, Dept. ofMolecular and Cellular Biology; Luciann Cuenca,Harvard Medical School, Biological and BiomedicalSciences Program; Rachelle Gaudet, HarvardUniversity, Dept. of Molecular and Cellular BiologyDanielle Hyatt, 19................................. 8:45-9:45 AMPresentation Title: The Role of Laminar Shear Stresson Endothelial CellsResearch Mentor: Sina RabbanyResearch Institution: Weill Cornell Graduate SchoolHome Institution: Gonzaga UniversityCo-Authors: Sina Y. Rabbany, Weill Cornell GraduateSchool of Medical SciencesAasha Jackson, 96............................... 9:45-10:45 AMPresentation Title: This Is Us: Teaching High SchoolStudents to Conduct Research in Their CommunitiesResearch Mentor: Kimberley WilsonResearch Institution: Tufts UniversityHome Institution: Brown UniversityCo-Authors: Jessica Manfredi and Kimberley Wilson,Tufts UniversityDanyelle Johnson, 20.......................... 9:45-10:45 AMPresentation Title: Identifying C-Kit Cardiac Stem Cellsin Post-Myocardial Infarcted HeartResearch Mentor: Kim KellyResearch Institution: University of Virginia Schoolof MedicineHome Institution: University of Maryland,Baltimore CountyCo-Authors: Siva Sai Krishna Dasa, University ofVirginia - BioMedical SciencesJoshua Jones, 21.................................... 8:45-9:45 AMPresentation Title: Development of a KSHV BacterialArtificial Chromosome Clone to Evaluate LANA’sRole in Episome MaintenanceResearch Mentor: Kenneth KayeResearch Institution: Harvard University, Divisionof Medical SciencesHome Institution: University of MaineCo-Authors: Franceline Juillard, Brigham and Women’sHospital; Kenneth Kaye, Harvard Medical School,Brigham and Women’s HospitalTonee’ Jones, 50................................... 9:45-10:45 AMPresentation Title: Characterizing the Function ofMycobacterium Tuberculosis Efflux Pumps in aMycobacterium Smegmatis Overexpression SystemResearch Mentor: Alissa MyrickResearch Institution: Harvard University, Divisionof Medical SciencesHome Institution: Morehouse CollegeCo-Authors: Alissa Myrick and Brian Schuster, HarvardSchool of Public Health; Eric Rubin, HarvardSchool of Public Health, Dept. of Immunologyand Infectious DiseaseJennifer Kamara, 51.............................. 8:45-9:45 AMPresentation Title: Interrogation of Lipid-ProteinInteractions Involved in Cellular Uptake of LipidNanoparticle-Formulated siRNAResearch Institution: Novartis Institutes forBioMedical ResearchCo-Authors: Andrea Pomerantz, Novatis Institutesfor BioMedical ResearchTiffany King, 80.................................. 9:45-10:45 AMPresentation Title: Analysis of Proton Transport in[Fe-Fe] Hydrogenase Through an ActivatedSecondary Water ChannelResearch Mentor: Aaron DinnerResearch Institution: University of ChicagoHome Institution: University of North CarolinaChapel HillCo-Authors: Martin McCullagh, Aaron Dinner andGreg Voth, University of ChicagoWilhemina Koomson, 52.................... 9:45-10:45 AMPresentation Title: The Role of Microtubule RegulationDuring Synaptic DevelopmentResearch Mentor: Jennifer LongResearch Institution: Harvard University, Divisionof Medical SciencesHome Institution: Princeton UniversityCo-Authors: Jennifer B. Long and David Van Vactor,Harvard Medical School, Dept. of Cell Biology

Cultivating Excellence and Empowering Great Minds | 67Mark Lampert, 53................................. 8:45-9:45 AMPresentation Title: Cystic Fibrosis CellProliferation RatesResearch Mentor: Stefan WorgallResearch Institution: Weill Cornell Graduate SchoolHome Institution: Ohio State UniversityCo-Authors: Stefan Worgall, Weill Cornell GraduateSchool of Medical SciencesOluwabusayo Lana, 22........................ 9:45-10:45 AMPresentation Title: Traumatic Brain Injury: QuantifyingAtrophy of the Hippocampus and the CortexResearch Mentor: Coleen AtkinsResearch Institution: University of MiamiHome Institution: University of Maryland,Baltimore CountyCo-Authors: Coleen Atkins and David Adaikkalasamy,University of MiamiKayla Lapier, 23..................................... 8:45-9:45 AMPresentation Title: The Expression of Aquaporin 3bDuring Nervous System Development in Embryosof Xenopus laevisResearch Mentor: Christa MerzdorfResearch Institution: Montana State University -BozemanHome Institution: Montana State University -BozemanCo-Authors: Christa Merzdorf, Montana State UniversityJessica Manfredi, 97.............................. 8:45-9:45 AMPresentation Title: This Is Us: Teaching High SchoolStudents to Conduct Research in Their CommunitiesResearch Mentor: Kimberley WilsonResearch Institution: Tufts UniversityHome Institution: University of WashingtonCo-Authors: Aasha Jackson and Kimberly Wilson,Tufts UniversitySarah Manmiller, 54........................... 9:45-10:45 AMPresentation Title: Determining the Significanceof Trim28 for Twist1-induced EpithelialmesenchymalTransitionResearch Mentor: Phuoc TranResearch Institution: Johns Hopkins UniversityHome Institution: York College of PennsylvaniaCo-Authors: Phuoc Tran, Sivarajan Chettiar andAnvesh Annadanam, Johns Hopkins UniversitySara Marin, 55....................................... 8:45-9:45 AMPresentation Title: Gene Mutations Associated WithFamilial Acute Myeloid LeukemiaResearch Mentor: Lucy GodleyResearch Institution: University of ChicagoHome Institution: University of MiamiCo-Authors: Lucy Godley, University of ChicagoWilliam Marrero-Ortiz, 81................... 8:45-9:45 AMPresentation Title: Synthesis of a Stereoselectiveand Functionalized All-Hydrocarbon StapledPeptide OlefinResearch Mentor: Loren WalenskyResearch Institution: Harvard University, Division ofMedical SciencesHome Institution: UPR-Rio PiedrasCo-Authors: Loren D. Walensky, Harvard MedicalSchool, Dana Farber Cancer Institute; Gregory H.Bird, Dana Farber Cancer InstituteEileen Martinez, 56............................. 9:45-10:45 AMPresentation Title: Inter-Bacterial Interactions WithPseudomonas Aeruginosa and the Role of oprFin Host Phagocyte AssociationResearch Mentor: Brent BerwinResearch Institution: Dartmouth CollegeHome Institution: Texas A&M International UniversityCo-Authors: Brent Berwin and Rustin Lovewell,Dartmouth CollegeMaria Martinez, 105............................. 8:45-9:45 AMPresentation Title: Position Dependency inObject RecognitionResearch Mentor: George AlvarezResearch Institution: Harvard UniversityHome Institution: Barry UniversityCo-Authors: George Alvarez, Harvard University, Dept.of PsychologyMicah Melia, 98................................... 9:45-10:45 AMPresentation Title: Do State Standardized GraduationRequirements Improve Minority StudentOutcomes?: The Case of the Michigan MeritCurriculumResearch Mentor: Daniel PlayerResearch Institution: University of Virginia Schoolof EducationHome Institution: University of KansasCo-Authors: Melinda Adnot, Daniel Player and,University of Virginia - Education SciencePeter Mercado-Reyes, 57...................... 8:45-9:45 AMPresentation Title: Study on the Long-term Effectsof Antipsychotics:The Impact of Sustained D2Neuron Activity on Motor Learning and MotorPerformanceResearch Mentor: Chris MooreResearch Institution: Brown UniversityHome Institution: Purdue UniversityCo-Authors: Nathan Vierling-Claassen, Kevin Bath andChristopher Moore, Brown University

68 | Poster Presentations by NAMEDanielle Miyagishima, 25..................... 8:45-9:45 AMPresentation Title: Effects of Camptothecin onSurvivability of Dorsal Root GanglionResearch Mentor: Yung-Chih ChengResearch Institution: Harvard University, Divisionof Medical SciencesHome Institution: New Mexico State UniversityCo-Authors: Yung-Chih Cheng and Clifford Woolf,Harvard Medical School, Children’s HospitalJavier Morales-Gonzalez, 58.............. 9:45-10:45 AMPresentation Title: Is mTOR Steady State PI3KDependent?Research Mentor: Cesario BianchiResearch Institution: Brown UniversityHome Institution: UPR-Rio PiedrasCo-Authors: Cesario Bianchi, Brown UniversityIlkania Paulino Cenit, 26.................... 9:45-10:45 AMPresentation Title: Evaluation of IRGM GeneExpression and Reference Genes in Epstein-BarrVirus-Transformed Lymphoblastoid Cell LinesResearch Mentor: Steven BrantResearch Institution: Johns Hopkins UniversityHome Institution: Brown UniversityCo-Authors: Steven Brant, Yuqiong Wu and Lisa Datta,Johns Hopkins UniversityPedro Perez, 27...................................... 8:45-9:45 AMPresentation Title: Identification of Novel Survival ofMotor Neuron Protein StabilizersResearch Institution: Novartis Institutes forBioMedical ResearchCo-Authors: Youngah Shin, Marc Hild and RajeevSivasankaran, Novatis Institutes for BioMedicalResearchSaige Pompura, 59................................ 8:45-9:45 AMPresentation Title: Characterizing the Caenorhabditiselegans Systemic RNAi Protein SID-2Research Mentor: Craig HunterResearch Institution: Harvard UniversityHome Institution: UC RiversideCo-Authors: Lisa Yao, Phil Shiu and Craig Hunter,Harvard University, Dept. of Molecular andCellular BiologyAranza Portugal Leon, 24................... 9:45-10:45 AMPresentation Title: The Effects of a Nutrition EducationProgram on Nutrition Knowledge, Attitudes, andBehaviors Among Elementary School Children inNew York CityResearch Mentor: Kristin MmariResearch Institution: Johns Hopkins UniversityHome Institution: Brooklyn College CUNYCo-Authors: Kristin Mmari and Beth Marshall, JohnsHopkins UniversityVictoria Quinones, 99........................... 8:45-9:45 AMPresentation Title: Understanding the Pathway toSuicide: The Role of Planning for SuicideResearch Mentor: Matthew NockResearch Institution: Harvard UniversityHome Institution: Hunter CollegeCo-Authors: Matthew K. Nock and Alexander J.Millner, Harvard University, Dept. of PsychologyMonica Quinones-Frias, 60................ 9:45-10:45 AMPresentation Title: Investigation of the Mechanismof Gamma-Secretase C-terminal Trimming ofAmyloid BetaResearch Mentor: Michael WolfeResearch Institution: Harvard University, Divisionof Medical SciencesHome Institution: UPR-Rio PiedrasCo-Authors: Marty Fernandez, Harvard MedicalSchool, Biological and Biomedical SciencesProgram; Michael Wolfe, Harvard Medical School,Brigham and Women’s HospitalEshaan Rao, 28.................................... 9:45-10:45 AMPresentation Title: Smoothened Inhibitor, LDE225,Induces Apoptosis in MedulloblastomaCells Through Activation of the IntrinsicApoptotic PathwayResearch Mentor: Kat PakResearch Institution: Harvard University, Divisionof Medical SciencesHome Institution: University of Minnesota-Twin CitiesCo-Authors: Kat Pak, Harvard Medical School,Biological and Biomedical Sciences Program;Rosalind Segal, Harvard Medical School, DanaFarber Cancer Institute

Cultivating Excellence and Empowering Great Minds | 69Vani Ravichandran, 61......................... 8:45-9:45 AMPresentation Title: Overexpress Yourself: It’s Good ForThe Heart!Research Mentor: Ruhul AbidResearch Institution: Brown UniversityHome Institution: University of Maryland,Baltimore CountyCo-Authors: Ruhul Abid and Ehtesham Shafique,Brown UniversityValeria Reyes Ruiz, 62......................... 9:45-10:45 AMPresentation Title: Investigating the Role of AHNAKand Sfpq Host Cell Receptors for ListeriaMonocytogenes InvasionResearch Mentor: Darren HigginsResearch Institution: Harvard University, Divisionof Medical SciencesHome Institution: UPR-HumacaoCo-Authors: Elizabeth M. Halvorsen and Darren E.Higgins, Harvard Medical School, Dept. ofMicrobiology and ImmunobiologySasha Rivers, 74................................... 9:45-10:45 AMPresentation Title: Soil Ecology of the American PrairieReserveResearch Mentor: Stephanie EwingResearch Institution: Montana State University -BozemanHome Institution: Salish Kootenai CollegeCo-Authors: Stephanie Ewing, Montana StateUniversityGaddiel Rodriguez, 63.......................... 8:45-9:45 AMPresentation Title: A High Throughput Assayfor SAMHD1 ActivityResearch Mentor: James StiversResearch Institution: Johns Hopkins UniversityHome Institution: Hunter CollegeCo-Authors: James T. Stivers, Johns Hopkins UniversityAndres Rosario, 29................................ 8:45-9:45 AMPresentation Title: Breast Cancer Specimen Imagingto Detect Residual Cancer During SurgeryResearch Mentor: Brian PogueResearch Institution: Dartmouth CollegeHome Institution: UPR-BayamonCo-Authors: Brian Pogue, VenkataramananKrishnaswamy and David McClatchy III,Dartmouth CollegeLloydine Runsabove, 64...................... 9:45-10:45 AMPresentation Title: Characterization of Nitrogen FixingCyanobacteria for Organic Bio-fertilizerResearch Mentor: Rich MacurResearch Institution: Montana State University -BozemanHome Institution: Chief Dull Knife CollegeCo-Authors: Rich Macur, Jeffrey Brown and Lisa Weeks,Montana State UniversityTanisha Saini, 65................................... 8:45-9:45 AMPresentation Title: Testing the Contribution ofChromosome Anchoring to Efficient DNATransport During Sporulation in Bacillus SubtilisResearch Mentor: Brianna BurtonResearch Institution: Harvard UniversityHome Institution: San Francisco State UniversityCo-Authors: Marina Besprozvannaya and BrianaBurton, Harvard University, Dept. of Molecularand Cellular BiologyElisa Sanchez, 66................................. 9:45-10:45 AMPresentation Title: Regulation of ERRA by theMolecular Motor Protein KIF17Research Mentor: Geri KreitzerResearch Institution: Weill Cornell Graduate SchoolHome Institution: New Mexico State UniversityCo-Authors: Geri Kreitzer and Pramodh Seneviratne,Weill Cornell Graduate School of Medical SciencesCaio Santos Rodrigues, 100............... 9:45-10:45 AMPresentation Title: TIndividual differences inintentionality judgments for victims differing insocial statusResearch Mentor: Jasmin CloutierResearch Institution: University of ChicagoHome Institution: Dickinson CollegeCo-Authors: Jasmin Cloutier and Carlos Cardenas-Iniguez, University of ChicagoMary Soliman, 67.................................. 8:45-9:45 AMPresentation Title: Development of a ComprehensiveApproach to Maldi ImagingResearch Mentor: David GrahamResearch Institution: Johns Hopkins UniversityHome Institution: UC IrvineCo-Authors: David Graham and David Colquhoun,Johns Hopkins University

70 | Poster Presentations by NAMEDarius Stanton, 75................................ 8:45-9:45 AMPresentation Title: Pelagic Microbial CommunityStructure Along an Estuarine Gradient inNarragansett BayResearch Mentor: Jeremy RichResearch Institution: Brown UniversityHome Institution: Claflin UniversityCo-Authors: Catherine M. Luria, Jeremy Rich andHeather Leslie, Brown UniversityAlexis Staver, 101.................................. 8:45-9:45 AMPresentation Title: The Relation Between ChildMaltreatment and Socioemotional Development ofChildren in the First Two Years of Their LifeResearch Mentor: Ann EasterbrooksResearch Institution: Tufts UniversityHome Institution:San Jose State UniversityCo-Authors: Ann Easterbrooks and Rachel Katz,Tufts UniversityRaiha Tahir, 68.................................... 9:45-10:45 AMPresentation Title: Investigation of Protein-ProteinInteractions Within the Yeast HistoneAcetyltransferase Complex NuA3Research Mentor: Sean TavernaResearch Institution: Johns Hopkins UniversityHome Institution: Virginia Commonwealth UniversityCo-Authors: Tonya Gilbert and Sean Taverna, JohnsHopkins UniversityJosh Taylor, 82..................................... 9:45-10:45 AMPresentation Title: Providing Safe and ReliableInterfacing from Vehicle-to-Vehicle Using W.A.V.E.Research Mentor: Quin YangResearch Institution: Montana State University -BozemanHome Institution: Montana State University -BozemanCo-Authors: Quin Yang, Tuan Le and Megan Combs,Montana State UniversityKrystal Thomas, 102........................... 9:45-10:45 AMPresentation Title: Unpacking the Black Box ofCoaching Conferences: The Link Between Teacherand Classroom Characteristics and Coaches’Approach to FeedbackResearch Mentor: Jason DownerResearch Institution: University of Virginia Schoolof EducationHome Institution: Virginia State UniversityCo-Authors: Sadie Hasbrouck and Jason Downer,University of Virginia - Education SciencesMeaghan Valliere, 69............................ 8:45-9:45 AMPresentation Title: Purification of the Native OrphanResponse Regulator, HP 1043, From HelicobacterpyloriResearch Mentor: Paul HoffmanResearch Institution: University of Virginia Schoolof MedicineHome Institution: UMass AmherstCo-Authors: Igor Olekhnovich and Paul Hoffman,University of Virginia - BioMedical SciencesMarcus Vandall, 30............................. 9:45-10:45 AMPresentation Title: Purification of Escherichiacoli CascadeResearch Mentor: Blake WiedenheftResearch Institution: Montana State University -BozemanHome Institution: Fort Belknap CollegeCo-Authors: Blake Wiedenheft and Sarah Golden,Montana State UniversityKadar Vannoy, 31.................................. 8:45-9:45 AMPresentation Title: An Analysis to DetermineAssociation of Deimination With AgingResearch Mentor: Sanjoy BhattacharyaResearch Institution: University of MiamiHome Institution: Morehouse CollegeCo-Authors: Sanjoy Bhattacharya, University of Miami;Sharon Peng, Gulliver Prep; Elisa Cristino, MASTHomestead CampusSahim Wallace , 32.............................. 9:45-10:45 AMPresentation Title: Development of a Cell Based Assayfor Characterizing Clostridium novyi InducedInflammation in MiceResearch Mentor: Kenneth KinzlerResearch Institution: Johns Hopkins UniversityHome Institution: Morehouse CollegeCo-Authors: Shibin Zhou, Zhaobo Li and Antonio Kim,Johns Hopkins UniversityTre Wells, 83.......................................... 8:45-9:45 AMPresentation Title: Data Envelopment Analysis and ItsApplication to Public School SystemsResearch Mentor: William MasseyResearch Institution: Princeton UniversityHome Institution: Morehouse CollegeCo-Authors: William Massey, Princeton University

Cultivating Excellence and Empowering Great Minds | 71Raymond White, 33.............................. 8:45-9:45 AMPresentation Title: Multilocus Variable Number TandemRepeat Analysis (MLVA) of Extended SpectrumBeta-Lactamase (ESBL)-producing Strains ofKlebsiella PneumoniaeResearch Mentor: Seth WalkResearch Institution: Montana State University -BozemanHome Institution: Montana State University -BozemanCo-Authors: Seth Walk and Susan Broadaway, MontanaState UniversityJeremiah Williams, 103........................ 8:45-9:45 AMPresentation Title: Position Dependence of HumanVisual Object RecognitionResearch Mentor: George AlvarezResearch Institution: Harvard UniversityHome Institution: University of Colorado at DenverCo-Authors: George Alvarez, Harvard University,Dept. of PsychologyLindsey Wirsing, 70............................ 9:45-10:45 AMPresentation Title: Gene Expression Analysis of theHuman IL1RN Gene Using Real-Time PCRResearch Mentor: Liyong WangResearch Institution: University of MiamiHome Institution: University of New HavenCo-Authors: Liyong Wang and Stephanie Page,University of MiamiAspen Yoo, 104.................................... 9:45-10:45 AMPresentation Title: Investigating Orientation Invariancein Visual Object RecognitionResearch Mentor: George AlvarezResearch Institution: Harvard UniversityHome Institution: CSU FullertonCo-Authors: George Alvarez, Harvard University, Dept.of PsychologyTheodore Zaki, 71................................. 8:45-9:45 AMPresentation Title: Optimization of RNA Extraction andPurification Protocols from Small Cell SamplesResearch Mentor: Sandeep DattaResearch Institution: Harvard University, Divisionof Medical SciencesHome Institution: UC IrvineCo-Authors: Taralyn Tan, Harvard Medical School,Program in Neuroscience; Sandeep Robert Datta,Harvard Medical School, Dept. of Neurobiology

72 | The Leadership Alliance National Symposium 2013New Doctoral ScholarsThe Leadership Alliance congratulates the following doctoral scholars who have recently completed their PhDs or MD-PhDs.These doctoral scholars bring the total number of Leadership Alliance doctoral scholars to 276.Ugochi Acholonu, PhDBS, 2003, Stanford University;PhD, 2013, Stanford UniversityGladys Arzola-Colon, PhDBS, 1999, UPR-Rio Piedras;PhD, 2009, Palo Alto UniversityAmalia Avila Figueroa, PhDBS, 2007, UPR-Rio Piedras;PhD, 2012, Brown UniversityJacqueline Baca, PhDBS, 2001, University of Arizona;PhD, 2012, University of Wisconsin MadisonDanielle Brown, PhDBS, 2001, Cornell University;PhD, 2011, UC DavisLaNissa Brown-Baker, PhDBS, 2000, Alabama State University;PhD, 2006, Meharry Medical CollegeLa Marr Bruce, PhDBA, 2003, Columbia University;PhD, 2013, Yale UniversityElvin Thomaseo Burton, PhDBS, 2003, Jackson State University;PhD, 2011, Purdue UniversityDavid Charlot, PhDBS, 2004, Delaware State University;PhD, 2010, UC San DiegoMiguel Chavez, PhDBA, 2002, UC Berkeley;PhD, 2012, UCLAOrly Clerge, PhDBA, 2005, Wheaton College;PhD, 2013, Brown UniversityZenobia Cofer, PhDBS, 2001, Cornell University;PhD, 2012, Thomas Jefferson UniversityThomas Gallegos, PhDBS, 2002, New Mexico State University;PhD, 2010, UC San DiegoArmando Garcia, PhDBA, 2006, Brown University;PhD, 2012, Cornell UniversityDavid Garcia, PhDBS, 2004, UC Santa Cruz;PhD, 2012, Massachusetts Instituteof TechnologyTracey Graham, PhDBA, 2000, Columbia University;PhD, 2013, University of ChicagoJesús Hernández, PhDBA, 2003, Brown University;PhD, 2012, University of Southern CaliforniaJavier Hidalgo, PhDBA, 2005, Reed College;PhD, 2011, Princeton UniversityNoelle Hutchins, PhDBS, 2004, University of North CarolinaChapel Hill;PhD, 2013, Brown UniversityMaria Jimenez, PhDBA, 2003, UC Santa Cruz;PhD, 2012, University of Illinoisat Urbana-ChampaignMaria Johnson, PhDBA, 2003, Hampton University;PhD, 2010, University of Michigan-Ann ArborGuarionex Jordan-Salivia, PhDBS, 2000, UPR-Rio Piedras;PhD, 2012, University of IowaRebecca Loya, PhDBA, 2002, Stanford University;PhD, 2012, Brandeis UniversityPriscilla Maldonado Fussell, PhDBS, 2004, Cornell University;PhD, 2011, New York UniversityConsuelo Martinez Reyes, PhDBA, 2003, UPR-Rio Piedras;PhD, 2009, University of PennsylvaniaSam McNeal, PhDBS, 2006, Georgia State University;PhD, 2012, Brown UniversityGeronda Montalvo, PhDBS, 2006, Clark Atlanta University;PhD, 2012, University of PennsylvaniaErica Morales, PhDBS, 2003, UMass Amherst;PhD, 2012, UCLAStephen Nunez, PhDAB, 2002, Princeton University;PhD, 2011, Stanford UniversityKhary Polk, PhDBA, 2000, Oberlin College;PhD, 2011, New York UniversityYisa Rumala, PhDBS, 2006, York College CUNY;PhD, 2012, University of Michigan-Ann ArborRaymon Shirk, PhDBS, 2004, Howard University;PhD, 2011, Tuskegee UniversityKendra Simpson, PhDBS, 2006, North Carolina State University;PhD, 2012, University of VirginiaArmãndo Tolliver, PhDBS, 2008, Dillard University;PhD, 2013, Jones International UniversityAlexandra Valdés-Wochinger, PhDBS, 2003, UPR-Humacao;PhD, 2011, SUNY Stony BrookNatalia Valencia, PhDBA, 2004, UPR-Mayaguez;PhD, 2011, UC BerkeleyTameka Michelle Walker, PhDBS, 2004, Alabama State University;PhD, 2011, University of Alabama-HuntsvilleMarcia Walker, PhDBS, 2006, Northwestern University;PhD, 2012, University of ChicagoMetoka Welch, PhDBA, 2004, University of North CarolinaChapel Hill;PhD, 2010, University of North CarolinaGreensboroLing Wong, PhDBS, 2006, Brown University;PhD, 2013, University of California, DavisMD-PhDMuyiwa Awoniyi, MD-PhDBS, 2003, Beloit College;MD-PhD, 2012, University of WashingtonOdmara Barreto-Chang, MD-PhDBS, 2001, UPR-Mayaguez;MD-PhD, 2010, Stanford UniversityJustin Brooks, MD-PhDBS, 2004, University of Maryland,Baltimore County;MD-PhD, 2012, Washington Universityin St. Louis

Cultivating Excellence and Empowering Great Minds | 73Kester Haye, MD-PhDBS, 2002, Brooklyn College CUNY;MD-PhD, 2012, Mt. Sinai Schoolof MedicineKisha Piggott, MD-PhDBS, 2003, Spelman College;MD-PhD, 2011, Emory UniversityTiffany Potter Link, MD-PhDBS, 2004, CSU Long Beach;MD-PhD, 2012, Johns Hopkins UniversityCalvin Williams, MD-PhDBS, 2002, University of Maryland,Baltimore County;MD-PhD, 2011, University of Maryland,Baltimore County

74 | The Leadership Alliance National Symposium 2013Doctoral Scholar ParticipantsAmalia Avila FigueroaPostdoctoral Research AssociateMolecular, Cellular andDevelopmental BiologyYale Universityamalia.figueroa@yale.eduTravis BoyceAssistant ProfessorAfricana Studies and Social ScienceUniversity of Northern Coloradotravis.boyce@unco.eduLa Marr Jurelle BruceAfrican American Studiesand American StudiesYale UniversityLamarr.bruce@yale.eduCandace CarrollPostdoctoral Research AssociateBiochemistrySt. Jude Children’s Research Hospitalcandace.e.carroll@gmail.comFernando Cruz-GuillotyAssistant ScientistOphthalmology, ImmunologyUniversity of Miamifcruzguilloty@gmail.comArnaldo DiazBiomedical Graduate StudiesCoordinator of Recruitmentand Special ProgramsUniversity of Pennsylvaniadiaza@mail.med.upenn.eduBernadette GailliardAssistant ProfessorCommunicationRutgers Universityb.gailliard@rutgers.eduAlyssa GarciaAssistant ProfessorWomen’s StudiesPennsylvania State Universityadg10@psu.eduFrederick GregoryProgram Manager, Neurophysiology& Cognitive NeuroLife Sciences DivisionU.S. Army Research Officefgregoryphd@gmail.comJesús HernándezVisiting Assistant ProfessorLatina/o StudiesWilliams Collegejesusjameshernandez@gmail.comPatricia Irizarry BarretoAssociate Director/Program CoordinatorUndergraduate and Academic AffairsRutgers Universityirizarry_patty@hotmail.comNikia LaurieAssistant ProfessorPediatricsNorthwestern Universityn-laurie@northwestern.eduSam McNealPostdoctoral fellowSurgeryUniversity of Pennsylvaniasam.mcneal@uphs.upenn.eduChristina Medina-RamirezProfessional Development Coordinator(MBRS-RISE)Cell BiologyHunter Collegecmedina@genectr.hunter.cuny.eduChinonye NnakweDirector of Graduate Diversity RecruitmentOffice of the ProvostUniversity of Chicagoccnnakwe@uchicago.eduNyamekye Obeng-AdjeiPostdoctoral fellowNIAIDNational Institutes of Healthobielord@gmail.comRobert PattersonAssistant ProfessorEnglish and African American StudiesGeorgetown Universitydrrjpatterson@gmail.comDamani PiggottFellowInfectious Disease/EpidemiologyJohns Hopkins Universitydpiggott@jhsph.eduKisha PiggottPGY2 Ophthalmology ResidentOphthalmologyWashington University in St. Louiskisha.piggott@gmail.comChenere RamseyAssistant ProfessorBiological SciencesHampton Universitychenerep.ramsey@hamptonu.eduEdgardo Sanabria-ValentínField Applications ScientistR&DSample6 Technologies, Inc.edgardo.sanabria@gmail.comJason SelloAssociate ProfessorChemistryBrown Universityjason_sello@brown.eduKendra SimpsonPostdoctoral Research AssociatePathologyUniversity of Virginiakds6p@virginia.eduJeanelle SpencerPostdoctoral FellowExperimental Transplantation andImmunologyNational Cancer Institutespencerjm@mail.nih.govSophia SuarezAssistant ProfessorPhysicsBrooklyn College CUNYsnsuarez@brooklyn.cuny.eduEric VillegasResearch MicrobiologistOffice of Research and DevelopmentEnvironmental Protection Agencyvillegas.eric@epa.govScharri WalkerProfessorChemistryNorth Central Texas Collegescharri.walker@gmail.comLing WongPostdoctoral FellowWar-related Illness andInjury Study Center (WRIISC)Washington DC Veterans Administrationling.m.wong@gmail.com

Cultivating Excellence and Empowering Great Minds | 75Faculty, Administrators, and Other ParticipantsCarlos AlonsoDeanGraduate School of Arts and SciencesColumbia Universitycalonso@columbia.eduCheryl AppreyDirectorGraduate Student Diversity ProgramsUniversity of Virginiacbe3x@virginia.eduEarnestine BakerAssistant to the Vice President,Institutional Advancement (Retired)Academic ServicesUniversity of Maryland, Baltimore Countyerbaker@umbc.eduTyrone BarksdaleAssistant to the Provost-SpecialProjects AnalystProvost OfficeHoward Universitytbarksdale@howard.eduErika BarrDirector of Community CollegeProgram-Special ProjectsOffice of Intramural of Training& EducationNational Institutes of Healthbarrel@mail.nih.govGeneva BaxterAssociate Academic DeanAcademic AffairsSpelman Collegegbaxter@spelman.eduJabbar BennettAssociate DeanGraduate School/Division of Biologyand MedicineBrown Universityjabbar_bennett@brown.eduAnastacia BerzatScientific Program ManagerOffice of Education, Diversity & InclusionNovartis Institutes for BioMedical Researchanastacia.berzat@novartis.comJean BoyerAssociate Research ProfessorPathology and Laboratory MedicineUniversity of Pennsylvaniaboyerj@upenn.eduJoseph BrownGraduate Diversity Recruitment OfficerSchool of Humanities and SciencesStanford Universityjlbrown@stanford.eduDon BrunsonAssistant DeanGraduate SchoolVanderbilt Universitydon.c.brunson@vanderbilt.eduBrooke BruthersDiversity Programs CoordinatorEducation OfficeAmerican Physiological Societybbruthers@the-aps.orgEric BucklesAssociate ProfessorBiologyDillard Universityebuckles@dillard.eduLiza Cariaga-LoAssociate Provost for AcademicDevelopment and DiversityOffice of the ProvostBrown Universityliza_cariaga-lo@brown.eduAna CarneiroAssistant ProfessorPharmacologyVanderbilt Universityana.carneiro@vanderbilt.eduChris CashDirector of Student Assistance ServicesOutreachInstitute for Broadening Particpationccash@ibparticipation.orgRoger ChalkleySenior Associate DeanBiomedical Research Education & TrainingVanderbilt Universityroger.g.chalkley@vanderbilt.eduMatthew CochranAssistant ProfessorNatural Science and MathematicsChaminade University of Honolulumatthew.cochran@chaminade.eduDeborah CollinsAssociate DirectorThe Leadership AllianceBrown Universityd_collins@brown.eduJulian CollinsAIRO Program DirectorCollege of EngineeringMontana State University -Bozemanjulian.collins@coe.montana.eduDavid Cooke IIIProfessor and ChairBiologyMorehouse Collegedcooke@morehouse.eduMary CroweAssociate Provost of Experiential EducationProvost’s OfficeFlorida Southern Collegemcrowe@flsouthern.eduYvette Dalton-McCoyAssoc. Director GraduateDiversity ProgramsOffice of the ProvostTufts Universityyvette.dalton-mccoy@tufts.eduJanet DavidsonAssociate ProfessorCriminology & Criminal JusticeChaminade University of Honolulujdavidso@chaminade.eduLloyd DouglasAssociate DirectorOffice of Contracts and GrantsUniversity of North Carolina Greensboroledougl2@uncg.eduGabrielle DoValeProject AssistantThe Leadership AllianceBrown Universitygabz2098@gmail.comJohn DoValeChairDoVale FoundationBrown UniversityMaria_DoVale@brown.eduMaria DoValeExecutive Assistant/Project CoordinatorThe Leadership AllianceBrown UniversityMaria_DoVale@brown.eduIliana EscobarProject AssitantThe Leadership AllianceBrown UniversityIliana_Escobar@brown.edu

76 | Faculty, Administrators, and Other ParticipantsKarina EvoraProject AssistantThe Leadership AllianceBrown Universitykarina_evora@brown.eduMary FarwellDirector of Undergraduate ResearchBiologyEast Carolina Universityfarwellm@ecu.eduSharon FengExecutive DirectorInstitute for Molecular EngineeringUniversity of Chicagosfeng@uchicago.eduRenato FeresProfessor of MathematicsMathematicsWashington University in St. Louisferes@wustl.eduRoger FischerBRIDGES Math TeacherCOEMontana State University -Bozemanrfischer@math.montana.eduSaul FisherExecutive Director for Grantsand Academic InitiativesOffice of the ProvostMercy Collegesfisher@mercy.eduTiffani FonsecaFellowship Programs CoordinatorEducation DepartmentAmerican Society For Microbiologyfellowships@asmusa.orgFrancoise FreyreAssistant DeanWeill Cornell Graduate SchoolWeill Cornell Graduate Schoolffreyre@med.cornell.eduSarah GeathersPost-Doctoral FellowThe Graduate SchoolPrinceton Universityisabel.geathers@gmail.comMedeva GheeExecutive DirectorThe Leadership AllianceBrown Universitymedeva_ghee@brown.eduLeislie Godo-SoloAssociate DirectorInstitute for Recruitment of Teacherslgodosolo@andover.eduChristine GonzalezAssociate Program ManagerRCMI ProgramHunter Collegecgonzalez@genectr.hunter.cuny.eduRuth GotianAdministrative DirectorMD-PhD ProgramWeill Cornell Medical Collegergotian@med.cornell.eduMichelle GrundyAssistant Director, Graduate Programsin Biomedical SciencesBiomedical Research Education & TrainingVanderbilt Universitymichelle.grundy@vanderbilt.eduSonya GwakDirector, Graduate AdmissionsOffice of Academic ProgramsUniversity of Pennsylvaniasgwak@seas.upenn.eduLouise HainlineProfessorPsychologyBrooklyn College CUNYLouiseH@brooklyn.cuny.eduJohn HallChairChemistryMorehouse Collegejhall@morehouse.eduLinda HarrisAssociate Director of Academic ProgramsOffice of Academic ProgramsSt. Jude Children’s Research Hospitallinda.harris@stjude.orgSara HernandezDirectorDiversity Programs in EngineeringCornell Universitysh267@cornell.eduAlejandro HuezoCoordinatorRISE ProgramBrooklyn College CUNYahuezo@brooklyn.cuny.eduKaren Jackson-WeaverAssociate DeanThe Graduate SchoolPrinceton Universitykjweaver@princeton.eduAron JaffeInvestigator IIIDevelopmental and Molecular PathwaysNovartis Institutes for BioMedical Researcharon.jaffe@novartis.comBethany JankaSummer CoordinatorCurry School of EducationUniversity of Virginiabnj2je@virginia.eduBarbara KahnCoordinator for Graduate andUndergraduate ProgramsThe Leadership AllianceBrown Universitybarbara_kahn@brown.eduMicere KeelsAssistant ProfessorComparative Human DevelopmentUniversity of Chicagomicere@uchicago.eduRebecca KeiserAssociate Deputy Administratorfor Strategy and PolicyAdministrator SuiteNASArebecca.spyke@nasa.govFlorence KempnerCoordinatorPsychologyBrooklyn College CUNYfkempner@brooklyn.cuny.eduEdward KimTechnology ConsultantThe Leadership AllianceBrown Universityedwardkim73@gmail.comLaina KingDirectorDiversity in Life Science ProgramsKeystone Symposia on Molecularand Cellular Biologylainak@keystonesymposia.orgArlene KohlerAdministrative DirectorMedical Scientist Training ProgramNew York Universityarlene.kohler@nyumc.org

Cultivating Excellence and Empowering Great Minds | 77Elise La RoseDirector of Summer ResearchOpportunitiesOffice of the ProvostUniversity of Chicagoemlarose@uchicago.eduBrian LawrenceAssistant ProfessorChemistryMorehouse Collegeblawrenc@morehouse.eduPatricia Lee-RobinsonAssociate ProvostOffice of Health Professions Advisingand Undergraduate ResearchChaminade University of Honoluluplrobins@chaminade.eduLaura LiscumProfessorIntegrative Physiology and PathobiologyTufts Universitylaura.liscum@tufts.eduJon MassieMedical StudentMedicineNew York Universityjonathan.massie@med.nyu.eduJermaine McCalpinAssistant ProfessorDept. of GovernmentUniversity of the West Indiesjmccalpin@gmail.comAnitra McCarthyDirector of RecruitmentGraduate SchoolCornell Universityamd78@cornell.eduWilliam McDadeDeputy Provost for Researchand Minority IssuesOffice of the ProvostUniversity of Chicagowmcdade@bsd.uchicago.eduCaryl McFarlaneSenior Program OfficerHigher EducationWoodrow Wilson National Fellowshipmcfarlane@woodrow.orgEduardo MoralezAdjunct History InstructorLiberal ArtsSouthern Methodist Universityemdoceo@gmail.comPushpa MurthyProgram DirectorDivision of Graduate EducationNational Science Foundationpmurthy@gmail.comMichelle NearonAssistant Dean in the Graduate School andDirector of the Office for Diversity andEqual OpportunityYale UniversityStephen NelsonSenior Scholar, Leadership AllianceEducational LeadershipBrown Universitystephen_j_nelson@brown.eduBarbara NesmithActing Assistant DirectorGSAS Office of DiversityColumbia Universitybsn2107@columbia.eduMichael NusbaumProfessor of Neuroscience; Assoc. Deanof Graduate EducationDept. of NeuroscienceUniversity of Pennsylvanianusbaum@mail.med.upenn.eduChristine O’BrienProgram AdministratorFord FellowshipsNational Academiescobrien@nas.eduJoel OppenheimSenior Associate DeanDean’s OfficeNew York University Sackler Institutejoel.oppenheim@nyumc.orgStephanie ParsonsMinority Recruitment and StudentProgramming OfficerGraduate School of Arts & SciencesHarvard Universitysparsons@fas.harvard.eduAllison PaynterAssociate ProfessorEnglishChaminade University of Honoluluapaynter@chaminade.eduChristopher PeeteGroup Home SupervisorCommunity Based Residential ProgramsYouth Villageschristopher.peete@youthvillages.orgLeslie PondHead, Postdoctoral andFellowship ProgramsOffice of Education, Diversity & InclusionNovartis Institutes for BioMedical Researchleslie.pond@novartis.comChloe PostonPost-Doctoral ScientistTailored TherapeuticsEli Lilly and Companychloe_poston@brown.eduNicole RestrickAssociate DirectorFellowships OfficeSocial Science Research Councilrestrick@ssrc.orgDelira RobbinsPostdoctoral Research AssociateChemical Biology and TherapeuticsSt. Jude Children’s Research Hospitaldelira.robbins@stjude.orgJohn RoseDean, Diversity and ComplianceOffice of the PresidentHunter Collegejohn.rose@hunter.cuny.eduRobert RoswellDirector of Recruitment and RetentionOffice of Diversity AffairsNew York Universityrobert.roswell@nyumc.orgNandita SabnisProgram CoordinatorOffice of Diversity AffairsNew York Universitynandita.sabnis@nyumc.orgKeyAnna SchmiedlCoordinator for Diversity ProgramsDivision of Medical SciencesHarvard Universitykschmiedl@fas.harvard.eduAllen SchwartzConsultantBrooklyn College CUNYfloral1@verizon.netNancy SchwartzProfessor and Associate DeanBiological SciencesUniversity of Chicagon-schwartz@uchicago.edu

78 | Faculty, Administrators, and Other ParticipantsPamela Scott-JohnsonInterim DeanCollege of Liberal ArtsMorgan State Universitypamela.scottjohnson@morgan.eduJane SeibelAssistant Dean of RecruitingGraduate StudiesDartmouth Collegejane.b.seibel@dartmouth.eduRochelle SmithDirector, Diversity, Summer Programsand CommunityDivision of Biology andBiomedical SciencesWashington University in St. Louisrsmith@wustl.eduAndrea SolomonSenior Associate DeanGraduate School of Arts and SciencesColumbia Universityas660@columbia.eduTobin SosnickProfessor, ChairBiochemistry and Molecular BiologyUniversity of Chicagotrsosnic@uchicago.eduLaurel SouthardDirector of Undergraduate ResearchOffice of the ProvostCornell Universityles3@cornell.eduCynthia SpenceAssociate Professor/Director, UNCF/MellonSociologySpelman Collegecspence@spelman.eduPatrice SpitalnikAssociate ProfessorPathology and Cell BiologyColumbia Universitypfs2101@columbia.eduTerrell StrayhornAssociate Professor & DirectorEducational StudiesOhio State Universitystrayhorn.3@osu.eduDina StroudResearch Assistant ProfessorPhysicsVanderbilt Universitydina.m.stroud@vanderbilt.eduBrian SullivanExecutive DirectorMD-PhD Training ProgramWashington University in St. Louisbriansullivan@wustl.eduNeva Tall BearScience FacultyScienceLittle Big Horn Collegetallbearn@lbhc.eduNaoko TaneseAssociate ProfessorMicrobiologyNew York Universitytanesn01@med.nyu.eduSheila ThomasFaculty, Division of Medical Sciencesand Asst. Dean of DiversityMedicine and Graduate School of Artsand SciencesHarvard Universitysthomas@fas.harvard.eduRahmelle ThompsonProgram DirectorDivision of Math and ScienceMorehouse Collegerthompso@morehouse.eduMicha TomkiewiczProfessorPhysicsBrooklyn College CUNYmichatom@brooklyn.cuny.eduPhillip TrellaAssistant Vice PresidentGraduate StudiesUniversity of Virginiatrella@virginia.eduAmanda TufekcierProject Assistant and SURP CoordinatorSackler InstituteNew York Universityamanda.tufekcier@nyumc.orgAileen WalterVice PresidentScholarships and University RelationsNational Action Council for Minoritiesin Engineeringawalter@nacme.orgChristopher WildemanAssistant ProfessorSociologyYale Universitychristopher.wildeman@yale.eduCatherine WillManager, Student Recruitment & ProgramsOffice of Graduate Student AffairsJohns Hopkins Universitycwill@jhmi.eduDamon WilliamsDirector of Graduate PlacementAcademic AffairsXavier University of Louisianadlwilli5@xula.eduJohn WilsonDirector, Minority Health & HealthDisparities Research CenterOffice of Academic AffairsDillard Universityjwilson@dillard.edu

Cultivating Excellence and Empowering Great Minds | 79Graduate Student ParticipantsSharrol BachasJohns Hopkins Universitysbachas1@jhmi.eduHeather L. BennettBrown Universityheather_l_bennett@brown.eduTashalee BrownWeill Cornell Medical Collegetrb2005@med.cornell.eduMichael BurelNew York Universitymichael.burel@nyumc.orgMercedes BurnsUniversity of Maryland, College Parkmmburns@umd.eduAngel ByrdBrown Universityangel_byrd@brown.eduDaisy CamachoUCLAdaisycamacho@gmail.comJessica CheryBrown UniversityJessica_Chery@brown.eduKathia CorderoLoma Linda Universitykathia5973@att.netBrittny DavisUniversity of Maryland,Baltimore Countybrittny@umbc.eduJewell DebnamMichigan State Universitydebnamje@msu.eduJenn DemersDartmouth Collegejennifer-lynn.h.demers.th@dartmouth.eduAndrew DrysdaleWeill Cornell Medical Collegeatd2003@med.cornell.eduMonique FosterNew York Universitymonique.foster@nyumc.orgDennis Gardner Jr.University of Colorado Boulderdennis.gardner@colorado.eduSophia GayleYale Universitysophia.gayle@yale.eduPrincess GilbertUCLAps.gilbert@ucla.eduCiara GimbletUniversity of Pennsylvaniacgimblet@mail.med.upenn.eduCraig HollowayYale Universitycraig.holloway@yale.eduSimon HowardTufts Universitysimon.howard@tufts.eduCory HunterPrinceton Universitycwhunter@princeton.eduNarayani LasalaColumbia Universityml2362@columbia.eduKevin LeclercColumbia Universitykl2414@columbia.eduDiana LizarazoBrown Universitydiana_lizarazo@brown.eduJoan MarcanoUniversity of Colorado Boulderjoan.marcano@colorado.eduTomas MeijomeUniversity of Pennsylvaniatmeijome@gmail.comFelicia MoralezUniversity of Notre Damefmoralez@nd.eduSarah OhleUniversity of Colorado Bouldersarah.ohle@colorado.eduLarry PerryUniversity of Virginialarrysperry@gmail.comTeresa RamirezBrown Universityteresa_ramirez@brown.eduRhea RichardsonStanford Universityrrichar2@stanford.eduSantas RosarioUniversity of Miamisantasrosario@gmail.comMaria SactaWeill Cornell Medical Collegemas2095@med.cornell.eduAshley SchlossYale Universityashley.schloss@yale.eduJose SolisUniversity of Colorado Boulderjose.solis@colorado.eduAmaury SosaNew York Universityals520@nyu.eduJenniffer StetlerUniversity of Missouri-Columbiajennifferstetler@gmail.comDarien SuttonNew York Universitydms582@med.nyu.eduJose Marc TechnerNorthwestern Universityjm.techner@fsm.northwestern.eduCiara Torres VargasColumbia Universitycat2119@columbia.eduColleen TrippBrown Universitycolleen_tripp@brown.eduIboro UmanaUniversity of Chicagoiumana@uchicago.eduKendra VannVanderbilt Universitykendra.vann@vanderbilt.eduCarlos VeraUniversity of Pennsylvaniaveracarlosd1228@gmail.comDevon WadeColumbia Universitydtw2114@columbia.eduZakiya WhatleyDuke Universityznw2@duke.edu

80 | The Leadership Alliance National Symposium 2013Ruthly FrancoisNovartis Institutes forBioMedical ResearchNovartis Institutes forBioMedical Researchruthly.francois@novartis.comNovartis Institutesfor BioMedical Research StudentsJennifer KamaraNovartis Institutes forBioMedical ResearchNovartis Institutes forBioMedical Researchjennifer.kamara@novartis.comPedro PerezNovartis Institutes forBioMedical ResearchNovartis Institutes forBioMedical Researchpedro.perez@novartis.comUndergraduate ParticipantsJesus AcevedoWeill Cornell Graduate SchoolUPR-Rio Piedrasjacevedo002@gmail.comLisbeth AcostaTufts UniversityUMass Amherstlisbethacosta61@gmail.comTangeria AdamsDartmouth CollegeBrooklyn College CUNYtangeriaadams@gmail.comGifty AddaeWeill Cornell Medical CollegeUMass Bostongifty.addae001@umb.eduLaura Agosto-RosaUniversity of PennsylvaniaUPR-Rio Piedraslauramagosto_01@hotmail.comHayford AgyemangHoward UniversityGordon State Collegeha170054@gordonstate.eduTiwaloluwa AjibewaUniversity of MiamiUniversity of Minnesota Morrisajibe006@morris.umn.eduIfeolu AkinnolaHarvard University,Division of Medical SciencesUniversity of Maryland, Baltimore Countyife3@umbc.eduKorleki AkitiHarvard UniversityPrinceton Universitycakiti@princeton.eduAida AlazarCornell UniversityBrown Universityaida_alazar@brown.eduTasnia AliColumbia UniversityRochester Institute of Technologytasnia.ali23@gmail.comJasmine AllenUniversity of Colorado BoulderUniversity of South Floridajasmineallen@mail.usf.eduJacob AlvarezStanford University EngineeringUniversity of Maryland, Baltimore Countyalv3@umbc.eduKaleish AmbrisBrooklyn College CUNYBrooklyn College CUNYambriskaleish@hotmail.comSamantha AngellUniversity of Virginia School of EducationRipon Collegeangells@ripon.eduAndrew AnguianoWashington University in St. LouisSan Jose State Universityandrew.anguiano@sjsu.eduJaime AponteNew York University Sackler InstituteUPR-Mayaguezjaime.aponte@upr.eduYonathan ArarsoWeill Cornell Medical CollegeHampden-Sydney Collegetarekegney@gmail.comEmily ArtalejoUniversity of PennsylvaniaSaint Mary’s Universityeartalejo@mail.stmarytx.eduChi-Hang AuUniversity of Virginia School of EducationLiberty Universitychihang_au@hotmail.comZachery AustinUniversity of MiamiMorehouse Collegeaustinzachery@gmail.comAlexander BallardJohns Hopkins UniversityUniversity of Maryland, Baltimore Countya87@umbc.eduMaria BanuelosHarvard UniversityUniversity of Redlandsmaria_banuelos@redlands.eduCynthia BarajasBrown UniversityCalifornia State Polytechnic Universitycebarajas@gmail.comRaymond BarryNew York University Sackler InstituteUniversity of North Carolina Chapel Hillraymond.barry@nyumc.orgRajshekhar BasakBrown UniversityCity College of New Yorkrajbasak.93@gmail.comKristen BascombeNew York University Sackler InstituteUniversity of Georgiakmb1392@uga.edu

Cultivating Excellence and Empowering Great Minds | 81Erick BayalaHarvard UniversityUPR-Humacaoerick.bayala@upr.eduKirollos BechayHarvard UniversityUC Irvinekiro.bechay@gmail.comWilliam BeischelHunter CollegeLoyola University of Chicagowbeischel@gmail.comRebecca BetancesYale UniversityUPR-Mayaguezrebecca.betances@upr.eduKristian BlackUniversity of Colorado BoulderLouisiana State University-Baton Rougekblac25@tigers.lsu.eduNia BlackwolfMontana State University -BozemanMontana State University -Bozemannia_bw@yahoo.comJermaine BlakleyPrinceton UniversityMorehouse Collegejermaineblakleymh@gmail.comTimothy BorjasNew York University Sackler InstituteUniversity of Pennsylvaniatborjas@sas.upenn.eduNicole BowmanUniversity of PennsylvaniaBryn Mawr Collegenbowman@brynmawr.eduJazmin BranchUniversity of ChicagoWashington University in St. Louisjbranch@wustl.eduKaitland BrannonNew York University Sackler InstituteXavier University of Louisianakaitland.brannon@nyumc.orgLindsey BrierUniversity of PennsylvaniaUniversity of Houstonlindsey.brier68@gmail.comErran Briggs IIUniversity of Maryland, Baltimore CountyKalamazoo Collegemr.edbriggs@gmail.comCaitlin BrownUniversity of Virginia School of EducationSouthern Oregon Universitycaitlin.brwn@gmail.comDonald BrownStanford UniversityMississippi State Universitydmb361@msstate.eduJeffrey BrownMontana State University -BozemanMontana State University -Bozemanbrown_one24@yahoo.comPrincess BrownHoward UniversityClaflin Universityprbrown@claflin.eduTimothy BrownJohns Hopkins UniversityUniversity of Texas at El Pasotpbrown@miners.utep.eduAlexander BruchYale UniversityElon Universityabruch2@elon.eduCan BuldunNew York University Sackler InstituteJacobs University Bremencan.buldun@nyumc.orgJohanel CaceresUniversity of Virginia School of EducationSkidmore Collegejcaceres@skidmore.eduCristhian CadenaUniversity of PennsylvaniaSam Houston State Universitycxc033@shsu.eduHenry Capps IIIColumbia UniversityUniversity of South Carolinacappsh@email.sc.eduMarco CarpenterUniversity of Colorado BoulderClark Universitymcarpenter@clarku.eduMelissa Carr-ReynoldsBrown UniversitySpelman Collegemcarrrey@scmail.spelman.eduCorie Jade CarterMontana State University -BozemanUniversity of Great Fallsbroken6891@gmail.comJavier CastilloNew York University Sackler InstituteParis 7 Universityji.castillo@hotmail.comMario CastilloUniversity of ChicagoCSU Dominguez Hillsmcastillo109@toromail.csudh.eduStephanie CastilloUniversity of Colorado BoulderUniversity of Central Floridascastillo9@knights.ucf.eduCristina Castro-RiveraNew York University Sackler InstituteUPR-Mayaguezcristina.castro1@upr.eduKarina CastroBrown UniversitySaint John’s Universitykarinacastro125@gmail.comMariela CastroUniversity of Virginia School of EducationUniversity of Nevada, Renomarielac@unr.eduPaul CatoUniversity of ChicagoSwarthmore Collegepaul.cato1991@gmail.comSandy ChanCornell UniversityCornell Universitysc2234@cornell.eduKervin CharlesTufts University BioMedical SciencesUniversity of Floridakech8perfection1@gmail.comBao Ying ChenBrown UniversityGrinnell Collegebaoyingchen385@gmail.com

82 | Undergraduate ParticipantsVivian ChiomaUniversity of ChicagoUniversity of Maryland, Baltimore Countychioma3@umbc.eduAchala ChittorHarvard UniversityWilliams Collegeachala.chittor@williams.eduIsatis CintronUniversity of Colorado BoulderUPR-Rio Piedrasisatis.cintron@gmail.comAnnecaroline ClarkColumbia UniversitySmith Collegeac3653@columbia.eduMorgan ClarkPrinceton UniversitySpelman Collegemclark15@scmail.spelman.eduTaelor ClayStanford UniversityMorgan State Universitytacla8@morgan.eduPrincess CobbsYale UniversityChaminade University of Honoluluprincess.cobbs@student.chaminade.eduKathryn CoeHarvard University, Division ofMedical SciencesColby Collegekacoe56@gmail.comOluwadara CokerColumbia UniversityRochester Institute of Technologyooc9075@rit.eduJoshua ColeUniversity of PennsylvaniaBoston Universityjoshcole@bu.eduCheryl ColemanVanderbilt UniversityClaflin Universitychcoleman@claflin.eduEvan ColesPrinceton UniversityPrinceton Universitycoles@princeton.eduStanley CollinsColumbia UniversityMorehouse Collegestanleyj.collins@gmail.comAvani ComerYale UniversityRutgers Universityavacomer@eden.rutgers.eduArtesse ConleyPrinceton UniversityMorehouse Collegeartessec@gmail.comNykhala CostonUniversity of ChicagoMcKendree Universitynbcoston@mckendree.eduLaura CraciunBrown UniversityNew York Universitylc1939@nyu.eduMarylyn CreerHarvard UniversityAlabama A&M Universitymheightcreer@yahoo.comDeMarcus CrewsHarvard UniversityMorehouse Collegedcrews2@tigermail.morehouse.eduAja Crim-LoganYale UniversityHunter Collegeacrimlogan@gmail.comCharity CrowellUniversity of Virginia School of EducationUniversity of Alabama-Tuscaloosacicrowell1@crimson.ua.eduJose CuchillaUniversity of ChicagoCalifornia State Polytechnic University,Pomonajcuchilla.csupomona@gmail.comDina DajaniJohns Hopkins UniversityUniversity of Miamid.dajani@umiami.eduJames DamianoNew York University Sackler InstituteHarvard Universityjdamiano@college.harvard.eduKayla DavisHarvard University, Division ofMedical SciencesOklahoma State UniversityKayla.j.davis@okstate.eduRebecca de FratesWeill Cornell Medical CollegeUniversity of Washingtonrebecca.defrates@gmail.comKevin De JesusWeill Cornell Medical CollegeUPR-Humacaokevin.dejesus1@upr.eduRoberto De La RosaUniversity of ChicagoBrown Universityroberto_delarosa@brown.eduDayana De La TorreColumbia UniversityWilliams Collegedayanadlt@gmail.comBreann De SantiagoJohns Hopkins UniversityWhittier Collegedesantiagobreann@gmail.comFartun DirieBrown UniversityUniversity of St. Thomasfartun.dirie@gmail.comSamantha DizonJohns Hopkins UniversityLoyola Universitysedizon@loyola.eduJana DodsonYale UniversityGeorgetown Universityjanadodson1@gmail.comLeena DoolabhJohns Hopkins UniversityUniversity of Delawareldoolabh@udel.eduAisha DortaPrinceton UniversityBrooklyn College CUNYaishadorta@gmail.comSean DoughertyNew York University Sackler InstituteVirginia Polytechnic Instituteand State Universityseand991@vt.edu

Cultivating Excellence and Empowering Great Minds | 83Imaani EasthausenWeill Cornell Medical CollegeBard Collegeie0859@bard.eduElshaddai EphremUniversity of PennsylvaniaPrinceton Universityeephrem@princeton.eduArianna EspinozaUniversity of Colorado BoulderNew Mexico Institute of Mining &Technologyaespinoz@nmt.eduUgomma EzeColumbia UniversityDrew Universityueze1@drew.eduRosio FernandezBrooklyn College CUNYBrooklyn College CUNYrosio.fernandez@live.comBianca FloresUniversity of Colorado BoulderUniversity of Rochesterbflores@u.rochester.eduMarcus FlorezJohns Hopkins UniversityUniversity of Kansasm567f031@ku.eduJoshua FrensterNew York University Sackler InstituteJacobs University Bremenj.frenster@jacobs-university.deMiguel FriasUniversity of Colorado BoulderUniversity of Wisconsin Madisonfrias2@wisc.eduKafi FridayUniversity of PennsylvaniaBrooklyn College CUNYkafifriday@yahoo.comCynthia GarciaStanford UniversityUC Berkeleycynthia.j.garcia@gmail.comSamuel GarciaJohns Hopkins UniversityUniversity of Texas at El Pasosigarcia6@miners.utep.eduJennifer GarrawayBrown UniversityHunter Collegejgarrawa@hunter.cuny.eduCecile GastonNew York University Sackler InstituteParis 7 Universitycecile.gaston@nyumc.orgSherry GeeBrown UniversityUniversity of Michigan-Ann Arborscwgee@umich.eduJemima GeorgesWashington University in St. LouisBrooklyn College CUNYjemimageorges@yahoo.comJoseph GeraghtyHunter CollegeSUNY College at Geneseojrg21@geneseo.eduFelipe GiusteUniversity of PennsylvaniaWashington University in St. Louisfgiuste@wustl.eduDamla GonulluNew York University Sackler InstituteNew York Universitydamlagonullu@nyu.eduJosephine GonzalesUniversity of MiamiCSU San Marcosgonza276@cougars.csusm.eduGuadalupe GonzalezWashington University in St. LouisBethel Universitylupitaglez26@gmail.comMatthew GonzalezNew York University Sackler InstituteArizona State Universitymcgonzo33@gmail.comCamille GregoryBrooklyn College CUNYBrooklyn College CUNYgcamille_994@yahoo.comJose GrullonYale UniversityRutgers Universityjose.gru@hotmail.comJean GuillaumeBrown UniversityBrooklyn College CUNYguillaumejean_arnould@hotmail.comRobert GutierrezBrown UniversitySanta Barbara City Collegerguti_9st@yahoo.comDaniel GuzmanNew York University Sackler InstituteRutgers Universityguzmand16@gmail.comElsa HardyNew York UniversityWesleyan Universityehardy@wesleyan.eduMark HarrisColumbia UniversityGrambling State Universitymarkharris1952@gmail.comJessica HartlingHunter CollegeViterbo Universityjjeanhartling@gmail.comRidwan HassenDartmouth CollegeEmory Universityridwanhassen@gmail.comMichael HawkinsUniversity of Colorado BoulderGeorgia State Universitymichaelhawkins65@outlook.comJillian HaynesHunter CollegeSUNY at Albanyhaynes9100@gmail.comJustin HendersonHarvard UniversityEastern Kentucky Universityjustin_henderson29@eku.eduNicholas HernandezUniversity of ChicagoUniversity of South Floridanicholash@mail.usf.eduNicole HernandezHarvard University, Division ofMedical SciencesUC Irvinenicolesh@uci.edu

84 | Undergraduate ParticipantsNatalia HerreraNew York University Sackler InstituteUC Santa Cruzngherrer@ucsc.eduLauren HighsmithStanford UniversityHampton Universitylaurenvhighsmith@aol.comDanielle HindesWeill Cornell Graduate SchoolSUNY College at Fredoniahind3359@fredonia.eduElvina HoganMontana State University -BozemanLittle Big Horn Collegeelvinamhogan@gmail.comLinda HonakerHarvard UniversitySan Diego State Universitylindana@me.comNikeeyia HowellUniversity of ChicagoCity College of New Yorknhowell00@citymail.cuny.eduDorcas HuangYale UniversityColumbia Universitydsh2131@columbia.eduDavid HutchinsonWashington University in St. LouisTruman State Universityd.law.hutchinson@gmail.comJere` HutsonUniversity of PennsylvaniaDelaware State Universityraesquare@comcast.netDanielle HyattWeill Cornell Graduate SchoolGonzaga Universitydhyatt@zagmail.gonzaga.eduLena IbrahimUniversity of Colorado BoulderUniversity of West Floridalenibrahim@gmail.comAasha JacksonTufts UniversityBrown Universityaasha_jackson@brown.eduSteven JeffersonUniversity of PennsylvaniaBoston Collegejeffersf@bc.eduDebria JoeUniversity of ChicagoXavier University of Louisianadjoe@xula.eduCatrina JohnsonWeill Cornell Medical CollegeUniversity of Maryland, Baltimore Countyjohncat1@umbc.eduDanyelle JohnsonUniversity of Virginia School of MedicineUniversity of Maryland, Baltimore Countydanyell1@umbc.eduAlexandra JonesPrinceton UniversityRutgers Universityalexj301@gmail.comJoshua JonesHarvard University, Division ofMedical SciencesUniversity of Mainejoshua.m.jones@umit.maine.eduTonee’ JonesHarvard University, Division ofMedical SciencesMorehouse Collegej.tonee3@yahoo.comMaxwell KessellyHoward UniversityAlabama A&M Universitymaxwell.m.k@aol.comTiffany KingUniversity of ChicagoUniversity of North Carolina Chapel Hilltiffankm@email.unc.eduWilhemina KoomsonHarvard University, Division ofMedical SciencesPrinceton Universitywkoomson@princeton.eduMelissa KreiderYale UniversityMassachusetts Institute of Technologymkreider@mit.eduMark LampertWeill Cornell Graduate SchoolOhio State Universitylampert.25@buckeyemail.osu.eduOluwabusayo LanaUniversity of MiamiUniversity of Maryland, Baltimore Countywn97851@umbc.eduKayla LapierMontana State University -BozemanMontana State University -Bozemank_a_y_la_4_ya@yahoo.comCarolina LarrainWeill Cornell Medical CollegeUniversity of Wisconsin Madisonclarrain@wisc.eduMarilyn LeBrown UniversityUniversity of Rhode Islandmarilyncle@gmail.comIrene LeeNew York University Sackler InstituteRice UniversityIrene.Lee@nyumc.orgRachel LeeCornell UniversityCornell Universityrel253@cornell.eduAranza LeonJohns Hopkins UniversityBrooklyn College CUNYaranzab@msn.comRosa LeonUniversity of PennsylvaniaSyracuse Universityrleon@syr.eduMelissa LeungWeill Cornell Medical CollegeWesleyan Universitymleung@wesleyan.eduShannon LitkeHunter CollegeNew York Universitysgl277@nyu.eduAurora LlamasNew York UniversityCornell Universityal626@cornell.eduSydney LomnesUniversity of Colorado BoulderUniversity of Wisconsin La Crosselomnes.sydn@uwlax.edu

Cultivating Excellence and Empowering Great Minds | 85Carolina LopezWeill Cornell Medical CollegeFlorida International Universityclope132@fiu.eduDavys LopezNew York University Sackler InstituteUniversity of Floridadavyslopez@gmail.comNoe LopezBrown UniversityUC Santa Barbaranoelopez@umail.ucsb.eduLeaAnn LovePrinceton UniversityXavier University of Louisianaleaannlove@gmail.comClaudia LovellNew York University Sackler InstituteUC Berkeleyclaudialovell@berkeley.eduAshley LoweryWashington University in St. LouisJackson State Universityashdalow2010@gmail.comPeter LowrieYale UniversityFurman Universitypeter.lowrie@furman.eduJeffrey LueryUniversity of PennsylvaniaUniversity of Pennsylvanialueryj81@students.rowan.eduClaudio MaciasJohns Hopkins UniversityUniversity of Texas at San Antoniomacias.claudio.f@gmail.comKatryna MahoneyBrown UniversitySpelman Collegekatryna.mahoney@gmail.comAhmed MalikNew York University Sackler InstituteIndiana University Purdue Universityammalik@indiana.eduJessica ManfrediTufts UniversityUniversity of Washingtonj.mmanfredi@yahoo.comSarah ManmillerJohns Hopkins UniversityYork College of Pennsylvaniasmanmill@ycp.eduSara MarinUniversity of ChicagoUniversity of Miamismarin@live.comWilliam Marrero-OrtizHarvard University, Division ofMedical SciencesUPR-Rio Piedraswilliam.marrero3@upr.eduShenee’ MartinUniversity of Colorado BoulderUniversity of the Virgin Islandsshen.c7@gmail.comEileen MartinezDartmouth CollegeTexas A&M International Universityeileen.mtz@gmail.comMaria MartinezHarvard UniversityBarry Universitymaria.martinez9@mymail.barry.exuBrian MatillaUniversity of Colorado BoulderFlorida International Universitybmati005@fiu.eduMatthew McCauleyPrinceton UniversityJohns Hopkins Universitymd_mccauley@hotmail.comDanielle McColganColumbia UniversitySmith Collegedlmccolgan@gmail.comShayna McCormackPrinceton UniversityHoward Universitysmccormack92@gmail.comMicah MeliaUniversity of Virginia School of EducationUniversity of Kansasmicahmelia@ku.eduKrystal MendezBrooklyn College CUNYBrooklyn College CUNYkrystal.mendez93@gmail.comPeter Mercado-ReyesBrown UniversityPurdue Universitypmercado@purdue.eduLuis Millán-BareaUniversity of Virginia School of MedicineUPR-Mayaguezluis.millan4@upr.eduDanielle MiyagishimaHarvard University, Division ofMedical SciencesNew Mexico State Universitydanimiyagi@gmail.comCarrie MooreWashington University in St. LouisUniversity of Southern Californiacarrieruthmoore@gmail.comJavier Morales-GonzalezBrown UniversityUPR-Rio Piedrasjfmg2011@gmail.comBryan MoralesUniversity of PennsylvaniaUPR-Rio Piedrasbryan.morales091@gmail.comIsabel MorganBrown UniversityMount Holyoke Collegemorga22i@mtholyoke.eduAlexis MorrisYale UniversityTruman State Universityarm4387@truman.eduAndrew MortonNew York University Sackler InstituteMichigan State Universitymortona2@msu.eduAriel MosleyYale UniversityCSU Sacramentoam6264@saclink.csus.eduDana MuñizPrinceton UniversityUPR-Rio Piedrasdana.muniz@gmail.comRobert MyersWeill Cornell Medical CollegeCollege of New Jerseymyersr2@tcnj.edu

86 | Undergraduate ParticipantsAaron NealUniversity of Colorado BoulderNorth Carolina A&T State Universityajneal1@aggies.ncat.eduHailey NeubauerHarvard UniversityUniversity of Oklahomahailey.neubauer@ou.eduMary NgUniversity of Colorado BoulderBarnard Collegemn2439@barnard.eduDaniel NissaniVanderbilt UniversityNorthwestern Universitydanieln2568@gmail.comKasiemobi NwaedozieHunter CollegeClark Universityknwaedozie@clarku.eduOnyemaechi Nwanaji-EnweremBrown UniversityUniversity of North Carolina Chapel Hillnwanajie@live.unc.eduDiana NwokoyeUniversity of PennsylvaniaUniversity of Floridadiaza@mail.med.upenn.eduN’Kosi OatesColumbia UniversityUniversity of Delawarenoates@udel.eduMichael OkoreehUniversity of ChicagoUC Riversidemokoree@yahoo.comMichelle OkoreehUniversity of ChicagoUC Riversidemokoree@yahoo.comUchenna OkoroNew York University Sackler InstituteUniversity of Maryland, Baltimore Countyuco1@umbc.eduBosoye Olateru-OlagbegiUniversity of Colorado BoulderMichigan State Universitybosoye.o@gmail.comBabajide OluwadareNew York University Sackler InstituteUniversity of Georgiajide13@uga.eduHassan OmarYale UniversityUniversity of Maryland, Baltimore Countyhomar1@umbc.eduAngel Ortiz RodriguezUniversity of PennsylvaniaUPR-Rio Piedrasangelluis_215@live.comLaura OrtizUniversity of Pennsylvania Arts & SciencesUPR-Rio Piedrasortizlau@hotmail.comAdewola OsunsadeWeill Cornell Medical CollegeUniversity of the District of Columbiaw.osunsade@gmail.comAlfonso PachecoColumbia UniversitySaint Mary’s Universityap3216@columbia.eduCoralie PardoHunter CollegeAmherst Collegecoralie.pardo@gmail.comStellJo PassesMontana State University -BozemanLittle Big Horn Collegestellpasses@gmail.comIlkania Paulino CenitJohns Hopkins UniversityBrown Universityilkania_paulino_cenit@brown.eduMadeline PelzUniversity of PennsylvaniaSkidmore Collegempelz@skidmore.eduFei PengTufts University BioMedical SciencesSmith Collegefpeng@smith.eduRafael PerezUniversity of PennsylvaniaYork College of Pennsylvaniarperez@ycp.eduYaritza PerezPrinceton UniversityUniversity of Rochesteryperez@u.rochester.eduGordon PherriboUniversity of PennsylvaniaCarnegie Mellon Universitygpherrib@andrew.cmu.eduNadrienne PinnockBrooklyn College CUNYBrooklyn College CUNYnadriennepinnock@gmail.comNicholas PizziUniversity of Colorado BoulderUniversity of New Hampshire (Durham)njv34@wildcats.unh.eduDarien PollockUniversity of PennsylvaniaMorehouse Collegedarienpollock.dp@gmail.comSaige PompuraHarvard UniversityUC Riversidespomp001@ucr.eduDaniel PowellBrown UniversityUniversity of Utahdanielrpowell@gmail.comCarlos PuentesUniversity of PennsylvaniaUniversity of Central Floridapuentesmn@knights.ucf.eduNatalia Quijano-CardéUniversity of PennsylvaniaUPR-Mayagueznatalia.quijano@upr.eduMonica Quinones-FriasHarvard University, Division ofMedical SciencesUPR-Rio Piedrasmcqf.1992@gmail.comVictoria QuinonesHarvard UniversityHunter Collegevquino@hunter.cuny.eduMichael RabadiBrown UniversityNew York Universitymichael.rabadi92@nyu.edu

Cultivating Excellence and Empowering Great Minds | 87Liorimar Ramos MedinaColumbia UniversityUPR-Rio Piedrasliorimar.ramos@gmail.comAndrea RamosBrooklyn College CUNYBrooklyn College CUNYalynn.ramos@yahoo.comEshaan RaoHarvard University, Division ofMedical SciencesUniversity of Minnesota-Twin Citieseshaan.rao@gmail.comVani RavichandranBrown UniversityUniversity of Maryland, Baltimore Countyvaniravi1@umbc.eduValeria Reyes RuizHarvard University, Division ofMedical SciencesUPR-Humacaovaleria.reyes.ruiz@gmail.comStephon RichardsonBrown UniversityClark Universitystephon1992@gmail.comKaren RicoJohns Hopkins UniversityUniversity of Arizonakrico@email.arizona.eduMayra RiosBrown UniversityCanada Collegemayrartx@yahoo.comStephanie Rivera MoralesNew York University Sackler InstituteUPR-Rio Piedrasstephanie.riv1@gmail.comViviana Rivera-BurgosColumbia UniversityUPR-Mayaguezbsn2107@columbia.eduVeronica Rivera-NegronNew York UniversityUPR-Rio Piedrasverineg@gmail.comAdrian RiveraUniversity of PennsylvaniaUPR-Rio Piedrasadrian.upr.cn@gmail.comSasha RiversMontana State University -BozemanSalish Kootenai Collegesasharivers@student.skc.eduJulian RobyHoward UniversityWiley Collegerobyjulian2@yahoo.comGaddiel RodriguezJohns Hopkins UniversityHunter Collegegr061014@gmail.comEmily RogersColumbia UniversitySarah Lawrence Collegeerogers@gm.slc.eduMiata RogersPrinceton UniversityOberlin Collegemmrogers@oberlin.eduMelisa RojasVanderbilt UniversityPomona Collegemelisa.rojas@pomona.eduFranklin Roman-RodriguezUniversity of Colorado BoulderUPR-Mayaguezsmart@colorado.eduJoshua Rosario SepulvedaUniversity of PennsylvaniaUPR-Cayeyjoshua.rosario@upr.eduAndres RosarioDartmouth CollegeUPR-Bayamonandy.uprb@gmail.comMarlen RosasPrinceton UniversityColumbia Universitymr3085@columbia.eduLloydine RunsaboveMontana State University -BozemanChief Dull Knife Collegelrunsabove@yahoo.comOrnella RutagaramaUniversity of PennsylvaniaRochester Institute of Technologyomr9014@rit.eduRochelle SadeghiUniversity of PennsylvaniaUniversity of Central Floridarochellesadeghi@knights.ucf.eduTanisha SainiHarvard UniversitySan Francisco State Universitytanisha815@yahoo.comTimothy SalazarUniversity of Colorado BoulderUniversity of Chicagotmthslzr@uchicago.eduAlicia SanchezUniversity of Colorado BoulderSaint Mary’s Universityasanchez53@mail.stmarytx.eduElisa SanchezWeill Cornell Graduate SchoolNew Mexico State Universityelisas@nmsu.eduGabriel Augusto SanchezStanford UniversityUCLAgebsanchez@gmail.comKathryn SanchezUniversity of PennsylvaniaNew Mexico State Universityktsanch@nmsu.eduCaio Santos RodriguesUniversity of ChicagoDickinson Collegesantosrc@dickinson.eduCarlos Santos-PerezUniversity of Virginia School of MedicineUPR-Cayeycarlos.santos9@upr.eduSarah SchraderNew York University Sackler InstituteWestern Kentucky Universitysarah.schrader435@gmail.comAmber ShafferBrown UniversityTougaloo Collegeashaffer14.as@gmail.comZakariyah Sharif-SidiWashington University in St. LouisUniversity of Chicagozsharif10@uchicago.edu

88 | Undergraduate ParticipantsTyler SharpPrinceton UniversityUniversity of Delawaretysharp@udel.eduAndrea ShergalisHunter CollegeUniversity of Akronags18@zips.uakron.eduJavier Sierra-PagánUniversity of PennsylvaniaUPR-Rio Piedrasjsierra.890@gmail.comLaTonya SimonUniversity of Colorado BoulderUniversity of Maryland, Baltimore Countylatonya2@umbc.eduAndrei SmidNew York University Sackler InstituteJacobs University Bremenandrei.smid@nyumc.orgMichael SnyderJohns Hopkins UniversityBoston Universitymichael.austin.snyder@gmail.comFolasade SofelaWeill Cornell Medical CollegeHarvard Universityfsofela@college.harvard.eduMary SolimanJohns Hopkins UniversityUC Irvinemgsolima@uci.eduEmilio SotoNew York University Sackler InstituteUPR-Rio Piedrasemilio2soto2@gmail.comZoe SpaffordNew York University Sackler InstituteUniversity of Maryland, Baltimore Countyzoesp1@umbc.eduRyan SpectorColumbia UniversityRochester Institute of Technologyrls5933@rit.eduVaughn SpurrierUniversity of Maryland, Baltimore CountyTemple Universityvaughn.spurrier@temple.eduDarius StantonBrown UniversityClaflin Universitydstanton@claflin.eduAlexis StaverTufts UniversitySan Jose State Universityalexis.staver@gmail.comPhillip StephensWeill Cornell Medical CollegeMorehouse Collegephillip.c.stephens@gmail.comAnna StephensonStanford UniversityUniversity of Notre Dameastephe1@nd.eduShanira SuazoWeill Cornell Medical CollegeClarkson Universityshanira301@gmail.comRaiha TahirJohns Hopkins UniversityVirginia Commonwealth Universitytahirr@vcu.eduNakul TalathiNew York University Sackler InstituteUniversity of Georgiatalathi@uga.eduJoshua TaliaferroUniversity of PennsylvaniaPrinceton Universityjtaliafe@princeton.eduJosh TaylorMontana State University -BozemanMontana State University -Bozemanj.jt0719ftj@gmail.comMacKenzie TaylorNew York University Sackler InstituteMichigan State Universitytaylo895@msu.eduEphrath TesfayeWeill Cornell Graduate SchoolCornell Universityeft29@cornell.eduKrystal ThomasUniversity of Virginia School of EducationVirginia State Universitythomaskrystalr@gmail.comPhillip ThomasNew York University Sackler InstituteNorth Carolina A&T State Universitypathoma1@aggies.ncat.eduSelamawi TilahunNew York University Sackler InstituteJames Madison Universityselexvib@gmail.comGeorge TorresUniversity of ChicagoHarvard Universitygtorres@college.harvard.eduJayilssa TorresYale UniversityUPR-Cayeyjaylissa.torres@gmail.comRaquel TrippNew York University Sackler InstituteCollege of William & Maryrmtripp@email.wm.eduKevin TrujilloUniversity of ChicagoLoyola University of Chicagok.trujillo52@gmail.comAndrew TuckHunter CollegeUniversity of Michigan-Ann Arborantuck@umich.eduKyle TuckerUniversity of Colorado BoulderLafayette Collegetuckerkc@lafayette.eduOsaze UdeagbalaNew York University Sackler InstituteCooper Unionudeagb@cooper.eduCamila UechiWeill Cornell Medical CollegeUniversity of Maryland, College Parkcamila.uechi@gmail.comTayler UlmerBrown UniversitySpelman Collegetulmer@scmail.spelman.eduMeaghan ValliereUniversity of Virginia School of MedicineUMass Amherstmavallie@student.umass.edu

Cultivating Excellence and Empowering Great Minds | 89Marcus VandallMontana State University -BozemanFort Belknap Collegeblueprint10123@yahoo.comKadar VannoyUniversity of MiamiMorehouse Collegekadar.vannoy@yahoo.comStephen VicchioYale UniversityUniversity of Maryland, Baltimore Countyvicchio1@umbc.eduJoseph VillanuevaUniversity of Colorado BoulderUniversity of New MexicoJoeVillan2@gmail.comSahim WallaceJohns Hopkins UniversityMorehouse Collegesai.wall@yahoo.comBrian WalshYale UniversityChaminade University of Honolulubrian.walsh@student.chaminade.eduKelsey WanhainenWashington University in St. LouisColgate Universitykwanhainen@colgate.eduTre WellsPrinceton UniversityMorehouse Collegetre_wells@yahoo.comSagirah WheelerUniversity of Pennsylvania Arts & SciencesMorgan State Universitysagirah.w@gmail.comRaymond WhiteMontana State University -BozemanMontana State University -Bozemanraymond_auto08@yahoo.comJeremiah WilliamsHarvard UniversityUniversity of Colorado at Denverwillijeremiah@gmail.comPrincess WilliamsHarvard UniversityJackson State Universityprincess.h.williams@students.jsums.eduSade WilliamsColumbia UniversityMiddlebury Collegesade.williams229@gmail.comLindsey WirsingUniversity of MiamiUniversity of New Havenlwirs1@unh.newhaven.eduGillian WoodColumbia UniversityWilliams Collegegillian.i.wood@williams.eduKathryn WuUniversity of PennsylvaniaSwarthmore Collegekwu1@swarthmore.eduPauline XuNew York University Sackler InstituteUniversity of Maryland, Baltimore Countypauli1@umbc.eduSaiah YatesNew York University Sackler InstituteUniversity of Maryland, Baltimore Countysaiah1@umbc.eduAspen YooHarvard UniversityCSU Fullertonaspenyoo@csu.fullerton.eduTheodore ZakiHarvard University, Division of MedicalSciencesUC Irvinetzaki@uci.eduAmy ZhangBrown UniversityCarnegie Mellon Universityamyz@cmu.edu

90 | Who’s Who at the SymposiumWho’s Who at the SymposiumS. Tyrone BarksdaleHoward UniversityS. Tyrone Barksdale is a higher education administrator, cancer clinician, professional broadcaster,health policy analyst, motivational speaker and corporate trainer. He presently serves as the LeadershipAlliance Summer Program Coordinator for Howard University. He received undergraduate and graduatedegrees from Howard University in 1980 and 1983 respectively. Prior to joining the Office of the Provostand Chief Academic Officer in 2000, Mr. Barksdale was assistant professor and program director for theHealth Management Program in the College of Pharmacy, Nursing and Allied Health Sciences wherehe specialized in healthcare administration and managed care policy. Mr. Barksdale aka “Tyrone Stanley, ” is presently aproducer/host and on-air personality for WHUR-FM, Washington, DC where he began his broadcast career more than 30years ago hosting the Quiet Strom among the stations many programs. He has appeared on numerous other programs onstations such as Sirius/XM and WHUR-FM. Mr. Barksdale serves on boards of directors of several non-profit organizationsin the metropolitan Washington Area and has been the recipient of numerous awards and citations from various civic andprofessional associations.Erika BarrNational Institutes of HealthDr. Barr, a native of North Carolina, received her Bachelors and Masters of Science degrees in Biologyfrom North Carolina Agricultural & Technical State University. Following, her undergraduate studies,she taught 6th grade science for the N.C. public school system. In addition to teaching, she served asan assistant coordinator for the Greensboro Area Math and Science Education Center (GAMSEC). Thepurpose of GAMSEC was to improve the math and science skills of middle and high school studentsfrom underrepresented backgrounds. Moreover, there was an emphasis in encouraging the students topursue an undergraduate degree in a STEM discipline. After receiving her PhD in Biology, Erika completed two postdoctoralfellowships at the Medical Research Council-London School of Hygiene and Tropical Disease in The Gambia, West Africaand at the National Institutes on Aging in Baltimore, MD. Currently, Dr. Barr is the co-director for the Community CollegeSummer Enrichment Program in the Office of Intramural Training & Education. Dr. Barr has a passion for increasing thenumber of underrepresented individuals in the biomedical sciences.Geneva H. BaxterSpelman CollegeGeneva H. Baxter, Associate Dean for Undergraduate Studies, assists in providing oversight for thedevelopment and implementation of academic standards, policies, and programs. She also works withother offices to provide academic support services for students. She coordinates academic advising forfirst-year students and the First-year Experience Seminar. She also oversees the College’s First-generationStudent Success and Leadership Initiative. A member of several professional and civic organizations,Dr. Baxter received her BA degree in English from Spelman College, MA degree in American Literaturefrom the University of Wisconsin and her PhD in American Literature and Rhetoric from Georgia State University.Jabbar R. Bennett, Ph.D.Brown UniversityDr. Bennett serves as associate dean of the Graduate School, associate dean for diversity in the Divisionof Biology and Medicine, and clinical assistant professor of medicine at The Warren Alpert MedicalSchool of Brown University. In the Graduate School, he is responsible for recruitment and coordinatingprofessional development activities for graduate students and postdocs. In the Division of Biology andMedicine, Dr. Bennett oversees the recruitment and advancement of medical students, faculty and traineeswho are members of underrepresented groups. Prior to joining Brown he served on the faculty at HarvardMedical School and directed the Office for Multicultural Faculty Careers at Brigham and Women’s Hospital. Previously, Dr.Bennett also served as Senior Director of Development for Life Sciences, Healthcare and Education Industry Partnershipswith United Way of Massachusetts Bay (UWMB) in Boston, and as Research and Science Specialist in the Office for Diversityand Community Partnership at Harvard Medical School. Dr. Bennett received his B.S. in biology and minor in Spanish fromNorth Carolina Agricultural and Technical (A&T) State University, and his Ph.D. in biomedical sciences from MeharryMedical College.

Cultivating Excellence and Empowering Great Minds | 91Anastacia BerzatNovartis Institutes for BioMedical ResearchAnastacia Berzat joined Novartis Institutes for BioMedical Research as a Scientific Program Managerfollowing completion of a postdoctoral fellowship at Memorial Sloan-Kettering Cancer Center. Herwork includes the development and implementation of training programs for young scientists. Prior tojoining NIBR, Anastacia earned a BS in Biology from Florida A&M University and a PhD in Geneticsand Molecular Biology from the University of North Carolina at Chapel Hill. As a recipient of graduatefellowships from the National Cancer Institute and UNC-CH, her work examined the molecularmechanisms utilized by small GTPases in regulating cellular transformation. At Memorial Sloan-Kettering, Anastacia wasawarded an American Cancer Society fellowship to investigate the role of Rho GTPases in driving glioma invasion under theguidance of Professor Alan Hall. Anastacia also completed a program management internship with the New York Academy ofSciences and served as an executive member on several postdoctoral advocacy councils during her fellowship.Travis BoyceUniversity of Northern ColoradoDr. Travis Boyce (2001 Yale University SR-EIP fellow) is an Assistant Professor of Africana Studies andSocial Sciences. He holds a B.A. in History (2002) from Claflin University, a M.A. in History (2004) anda Ph.D in Cultural Studies (2009) from Ohio University. Dr. Boyce’s area of expertise is in the history ofeducation; particularly, college presidents at Historically Black Colleges and Universities (HBCUs) duringthe mid-twentieth century. He has articles published in the Journal of Pan African Studies, Journal ofAfrican American Males in Education and the African American National Biography. He has reviewedbooks for the Journal of Negro Education and The South Carolina Historical Magazine and contributed chapters to editedbooks. In addition to his instructional and professional activities, Dr. Boyce serves as the vice-chair of the Liberal ArtsCouncil, the co-editor for UNC’s Undergraduate Research Journal (URJ), co-advisor to the Mortar Board Collegiate HonorSociety, advisor to the Future Secondary Educators Alliance, and a Faculty in Residence (South Hall – 2013/14 academic year)for Housing and Residential Education.Tashalee BrownWeill Cornell/Rockefeller/Sloan-KetteringTashalee Brown is currently a 5th year MD/PhD student at Weill Cornell/Rockefeller/Sloan-KetteringTri-Institutional MD/PhD Program. She earned her BS in Biomedical Engineering at Johns HopkinsUniversity. After graduation, she performed laboratory research at the National Institute on Aging. Herwork has resulted in co-authorship of several papers published in scientific journals, including CirculationResearch. Tashalee is currently pursuing her PhD in the Christini lab in the Department of Physiology,Biophysics & Systems Biology at Weill Cornell Graduate School of Medical Sciences. Her doctoralresearch focuses on investigating arrhythmia mechanisms in cardiac disease using computational modeling and experimentalelectrophysiology. She is an alumni of the Tri-Instiutional Gateway’s to the Laboratory program and has served on itsadmissions committee and as a student mentor.La Marr Jurelle BruceYale UniversityLa Marr Jurelle Bruce earned his B.A. (2003, cum laude) in African-American Studies and English fromColumbia University and his Ph.D. (2013) in African-American Studies and American Studies from YaleUniversity. His dissertation—now a budding book project—examines how “madness” has been ascribedto Afrodiasporic peoples by Eurocentric and white supremacist regimes across modernity. Furthermore,the project explores how twentieth- and twenty-first-century African-American artists have generated,claimed, and instrumentalized “madness” for radical creativity. He has received grants and honors fromthe Beinecke Rare Book and Manuscript Library at Yale University; the Carter G. Woodson Institute at the University ofVirginia; the Fund for Lesbian and Gay Studies at Yale University; the Mellon Foundation; the Social Science ResearchCouncil; and the Text and Academic Authors Association. Among his hobbies are time travel, nature documentaries, coolposing,hand-washing, and self-parody.

92 | Who’s Who at the SymposiumDon Brunson, PhDVanderbilt UniversityDr. Don Brunson is the Assistant Dean of the Vanderbilt University Graduate School and the Directorof the Graduate School’s Enhancing Diversity in Graduate Education Program. He is responsible forleading recruitment and retention efforts for Ph.D. students from under-represented minority groups andother diverse student populations in all fields of study and women Ph.D. students majoring in science,technology, engineering, or mathematics fields. He was a MARC Honors Undergraduate ResearchTraining Program at Morgan State University and attended the Massachusetts Institute of Technology(MIT) on a MARC graduate fellowship where he became the first African-American to earn a Ph.D. in Toxicology from MIT.After completing a two-year post-doctoral fellowship in the Department of Pharmacology and Molecular Sciences at theJohns Hopkins University School of Medicine, he altered his career path from scientific research to university administrationand has held administrative positions at MIT, Morgan State University, and Vanderbilt University.Brooke BruthersAmerican Physiological SocietyBrooke Bruthers is Senior Program Manager, Diversity Programs at the American Physiological Society.Her main responsibilities include developing, organizing, and implementing education projects andprograms aimed at promoting diversity and career advancement among physiologists fromunderrepresented groups. This includes several undergraduate summer research fellowship programs(STEP–UP, STRIDE, and IOSP), Minority Travel Fellowship Awards, Steven M. Horvath ProfessionalOpportunity Awards, Porter Physiology Development Fellowship program, and the K–12 MinorityOutreach Fellowship program. She works extensively with both the Porter Physiology Development and Minority Affairs andthe Women in Physiology Committees on these projects and regularly attends meetings and conferences to give presentationsabout these programs. In addition, she serves as the Chair of the Staff Recognition Committee. Ms. Bruthers received her B.A.degree in Liberal Arts from West Virginia University.Chris CashInstitute for Broadening ParticipationChris is the Director of Student Assistance Programs for IBP. Chris identifies and assists promisingstudents in locating and applying to undergraduate summer research and graduate programs at collegesand universities throughout the United States. She has worked for the last several years in the area ofmarine fisheries education and outreach. She was formerly a marine officer and fellowship coordinator atthe Island Institute, a non-profit educational organization located in mid-coast Maine. Chris continues tostay involved with Maine marine projects and initiatives.Roger ChalkleyVanderbilt UniversityRoger Chalkley has had an extensive career engaged in both teaching and research. The research wasdirected towards the issues of gene regulation in different tissues. His group was the first to outline thekinetics of histone modifications, to correctly identify the process of histone distribution at replication andto outline the formaldehyde cross-linking now used extensively in CHIP assays. Chalkley was responsiblefor designing the Vanderbilt IGP, which has served as a model for many other institutions. In his role asDirector of the IGP (1992-2001), he created the Vanderbilt graduate diversity program, which has now ledto the awarding of its 50th PhD in biomedical research at this institution. Chalkley has been a senior advisor to the VanderbiltBridges program and has served as an advisor to MARC related programs at Arizona State University, Tougaloo College andSavannah State College. He has been director of the Vanderbilt IMSD which has trained over 70 URM students of which>80% have received the PhD or are currently in graduate programs. Over the years, Chalkley has continued his interest ininnovative approaches to graduate education both at Vanderbilt and nationally. He was chair of the NRC WorkforceCommittee on Biomedical Training in 2010.

Cultivating Excellence and Empowering Great Minds | 93Mary CroweFlorida Southern CollegeDr. Mary Crowe is the Associate Provost of Experiential Education at Florida Southern College and the2012-2013 President of the Council on Undergraduate Research (www.cur.org). Over the course of hercareer, she has been an ardent supporter of undergraduate research. As a faculty member, she mentoredstudents in her research programs investigating the burrowing behavior of dung beetles and of fiddlerand ghost crabs, co-authoring multiple peer reviewed manuscripts with her students. As an administratorat Florida Southern College, the University of North Carolina at Greensboro and at Xavier University ofLouisiana she has worked to implement funding, policies and procedures to remove hurdles for faculty- across all disciplines- toengage undergraduate students in their work. She has received extensive external support for undergraduate research trainingand broadening participation of under-representative groups in science and mathematical fields.Jewell DebnamMichigan State UniversityJewell Debnam is currently a Doctoral Candidate in the Department of History at Michigan StateUniversity. She is a Third Year Graduate Student at Michigan State University and received her B.A. inAfrican American and African Studies and History from the University of Virginia in 2010. Her researchfields include United States History since 1865, Labor and Working Class History, African Americanand African Studies. Debnam has received several fellowships, honors, and awards such as the MadisonA. Kuhn Award for United States History from the Department of History at Michigan State University(2011-2012), the Harry A. Brown Graduate Fellowship in American History from the Department of History at MichiganState University (2013) Her professional affiliations include the Association for the Study of African American Life andHistory, American Historical Association. She is a historian of twentieth century United States History, Labor and WorkingClass History, and African American History. Debnam’s current research focuses on the intersections of workers’ rights andresistance, the modern Civil Rights Movement, the Black Power Movement, and black women’s activism.Arnaldo DiazUniversity of PennsylvaniaArnaldo Diaz is an Adjunct Assistant Professor in the Department of Pharmacology and the AssociateDirector of Recruitment and Special Programs at the Perelman School of Medicine, Biomedical GraduateStudies (BGS). Dr. Diaz works collaboratively with the Associate Dean, Administrative Director, andprogram faculty to develop and implement targeted outreach and recruitment strategies aimed at increasingthe total number of students from under-represented backgrounds pursuing PhDs in biomedical graduateprograms. Dr. Diaz also co-directs the Summer Undergraduate Internship Program (SUIP) and thePost-Baccalaureate Research Education Program (PennPREP), and is a member of the PhD Admissions Committee. Dr. Diazreceived his B.S. degree in Chemistry from the University of Puerto Rico and Ph.D. degree in Biochemistry and Biophysicsfrom Texas A&M University, and was a NIH Postdoctoral Fellow in Cancer Pharmacology at the University of Pennsylvania.Lloyd E. DouglasThe University of North Carolina at GreensboroLloyd E. Douglas is the Associate Director of the Office of Contracts and Grants at the University of NorthCarolina at Greensboro (UNCG). Prior to coming to UNCG, he was the Assistant to the Vice Presidentfor Research at the University of Nevada, Reno, after a long career as a Federal employee. Although thatcareer carried him through different disciplines, it began and ended with his being a mathematician, withthe Naval Underwater Systems Center and the National Science Foundation, respectively. Lloyd has apassion for enabling undergraduate research and was instrumental in expanding those opportunities whenhandling the REU program in the mathematical sciences. He currently serves as First Vice President of theMathematical Association of America. Lloyd received his B.S. degree in Mathematics from the City College of New York andhis M.S. in Mathematics from Miami University.

94 | Who’s Who at the SymposiumAndrew DrysdaleWeill Cornell/Rockefeller/Sloan-KetteringAndrew Drysdale is a rising 4th-year student in the Tri-Institutional (Weill-Rockefeller-Sloan-Kettering)MD-PhD Program. He is currently completing his PhD in the Sackler Institute of Cornell under thedirection of BJ Casey. He studies the development and neuroanatomical basis of impulsivity, focusing onadolescents. He graduated from Pomona College in 2009 and previously worked as a research assistant inmolecular biology and cognitive neuroscience laboratories.Mary FarwellEast Carolina UniversityMary Farwell is Professor of Biology and Director of Undergraduate Research and has carried out researchon apoptosis in non-cancer breast cells as well as oxidative stress in fish with Master’s and undergraduatestudents. She has had grant funding from the NIH-AREA program as well as NC Sea Grant for herresearch. She was recently awarded an NSF S-STEM grant and is co-PI on a grant for STEM outreachfor middle school girls. Professor Farwell teaches cell biology and biochemistry, as well as courses inmentoring (for graduate students) and research (for honors students). She has served on grant reviewpanels for NIH and the American Heart Association. Professor Farwell has served as a Council for Undergraduate Research(CUR) Biology councilor and a facilitator for CUR’s Proposal Writing Institute and Proposal Development Workshops. Shereceived her ScB in Biology from Brown University and PhD in Biochemistry from UC-Berkeley.Saul FisherMercy CollegeSaul Fisher is Executive Director of Grants and Academic Initiatives, and Visiting Associate Professor ofPhilosophy, at Mercy College. Previously, he served as Interim Associate Provost for Academic Standardsand Research. Before joining Mercy College, Fisher was Associate Provost and Adjunct Associate Professorof Philosophy at Hunter College (CUNY); Director of Fellowship Programs of the American Council ofLearned Societies; and program officer at The Andrew W. Mellon Foundation, where his portfolio centeredon instruction and curricular reform, information technology, and American universities abroad. Fisherreceived his AB in political science and philosophy from Columbia University, MA in philosophy from Rice University, andPhD in philosophy from the CUNY Graduate Center. He is recipient of Fulbright and Graham Foundation awards. He is apast president of HOPOS—the International Society for the History of Philosophy of Science and past chair of the AmericanPhilosophical Association’s Committee on Non-Academic Careers.Tiffani FonsecaAmerican Society for MicrobiologyTiffani Fonseca is the Fellowship Programs Coordinator in the Education Department of theAmerican Society for Microbiology (ASM). She is responsible for four fellowship programs: the ASM/CDC Postdoctoral Research Fellowship, the ASM Robert D. Watkins Graduate Fellowship, the ASMUndergraduate Research Fellowship, the ASM-Undergraduate Research Capstone Program, along withthe ASM Research Capstone Institute. Prior to working at ASM, she was the Outreach and ProductionSpecialist/Program Coordinator at the Kuwait America Foundation and its affiliate (the Embassy ofthe State of Kuwait). Fonseca holds dual bachelor’s degrees in Cognitive and Experimental Research in Psychology andIntercultural Communications. She has studied abroad in Accra, Ghana, and Roatan, Honduras, and conducted extensiveresearch on blindsight, Parkinson’s disease, Alzheimer’s disease, and for the National Survey of Student Engagement Reportamong others.

Cultivating Excellence and Empowering Great Minds | 95Alyssa GarciaPennsylvania State UniversityAlyssa Garcia Is a Leadership Alliance Alumni from Brown University where she received her Bachelor’sdegree in Cross-Cultural Psychology. She earned her Masters and PhD in Anthropology from theUniversity of Illinois, Urbana-Champaign and currently is an Assistant Professor in the Women’sStudies Department at Pennsylvania State University. Her primary research and teaching interests inLatina/o and Latin American/Caribbean Studies include Intersectionality, Critical Race Theory, FeministEthnography, Applied Anthropology, and Third Wave Feminism. As a recipient of the Woodrow WilsonFoundation Junior Faculty Career Enhancement Fellowship, she is dedicating this year to editing her manuscript “MoralDiscourses, Regulated Bodies: Sex, the State, and Subjectivity in Cuba” which examines the intersections of race, gender, andsexuality in Cuba through a historically grounded ethnographic analysis of discourses of sex-work and the body. Dr Garcia’smore recent project investigates the secondary migration of the Dominican community in the state of Pennsylvania. Herselected publications include: “Latina Faculty Narratives and the Challenges of Tenure: Identifying Strategies, InstitutionalizingAccountability” in Mentoring Faculty of Color: Achieving Tenure and Promotion at Predominantly White Colleges andUniversities; Continuous Moral Economies: The State Regulation of Bodies and Sex-Work in Cuba, Sexualities (2010); SituatingRace, Navigating Belonging: Mapping Afro-Cuban Identities in the U.S., Latina/o Research Review (2009); and Counter-Storiesof Race and Gender: Situating the Experiences of Latinas in the Academy, Latino Studies Journal (2005).Leislie Godo-SoloInstitute for the Recruitment of TeachersLeislie Godo-Solo is the Associate Director of the Institute for Recruitment of Teachers (IRT). Ms. Godo-Solo holds a B.A. in Spanish from Cleveland State University and a M.A. degree in Spanish Literaturefrom the University of Rhode Island. In 2007, Ms. Godo-Solo received an Ed.S. degree in Counselingand Student Affairs from Western Kentucky University. Her thesis, “Success Rates of Minority EducatorRecruitment and Retention (MERR) Scholarship Recipients and Other Education Majors,” documentsthe efficacy of the MERR Scholarship Program and the importance of teacher education pipelines.Additionally, Ms. Godo-Solo has nine years of combined experience as a high school Spanish teacher and recruiter ofundergraduate teacher education candidates. Currently, as the Associate Director of IRT, Mrs. Godo-Solo plays an integralrole in recruiting and counseling talented students who are preparing for graduate school admission. She is deeply passionateabout educational access, mentoring, and programs that ensure students’ success in graduate school.Christine GonzalezHunter CollegeChristine Gonzalez is Associate Program Manager and manages the budget and accounting requirementsfor Hunter’s biomedical facilities and departments. She has also been Summer Program Coordinator forfour years. Ms. Gonzalez received her B.A. degree in Political Science from Queens College and M.S.Ed.degree in Higher Education Administration from Baruch College.

96 | Who’s Who at the SymposiumRuth GotianWeill Cornell/Rockefeller/Sloan-KetteringRuth Gotian has been the Administrative Director of the Weill Cornell/Rockefeller/Sloan-Kettering Tri-Institutional MD-PhD Program for nearly 17 years. She has worked with students in the undergraduate,graduate and post graduate levels, as well as faculty and government officials at all levels. She has workedon higher education issues on the local, regional, national and international levels. She received her B.S.and M.S. in Business Management from the University at Stony Brook in New York and is currentlypursuing certificates in Executive Leadership and Managing for Execution via Cornell University. Sincejoining the staff of the Tri-Institutional MD-PhD Program, Mrs. Gotian has seen the size of the program increase by over40%, the number of applications to their MD-PhD Program has increased by 40% and the number of underrepresentedminority students in their program has doubled and is now one of the highest in the country. Mrs. Gotian also overseesthe unique summer program for pre-MD-PhD students, Gateways to the Laboratory Program. She is also very active onthe national MD-PhD Program scene, as she served on the National MD-PhD Steering Committee of the Association ofAmerican Medical Colleges (AAMC) and is on the National MD-PhD Communications Committee.Dr. Michelle M. GrundyVanderbilt UniversityDr. Michelle M. Grundy serves as Assistant Director of the Medical Scientist Training Program (MSTP)and Assistant Director of Graduate Programs in Biomedical Sciences at Vanderbilt University School ofMedicine. Dr. Grundy earned her Ph.D. in 2000 from the Department of Microbiology and Immunologyat Vanderbilt University. Dr. Grundy is primarily responsible for student recruitment and directing theadmissions process for the Ph.D. programs and M.D./Ph.D. Program in the medical school. Dr. Grundyserves as an active member of the MD/Ph.D. admissions committee, serves on the MSTP Leadership Teamand in an advisory role for the MSTP Student Advisory Committee (SAC). As an advisor to the MSTP SAC, Dr. Grundyhas co-led a subcommittee to evaluate and revise our advising system as well as co-leading a subcommittee to developprogramming to assist our students in identifying and securing external funding sources during their graduate studies.Sonya GwakUniversity of PennsylvaniaSonya Gwak is the Director for Graduate Admissions and the Director for Student Life for the Schoolof Engineering and Applied Science at the University of Pennsylvania. In her dual capacity, Dr. Gwakoversees student affairs from recruitment to graduation for all graduate students. Dr. Gwak received herB.A. degrees in English and Design of Environment, her M.S.Ed in Intercultural Communication, andPh.D. in Education all from the University of Pennsylvania.Louise HainlineBrooklyn CollegeLouise Hainline is Professor of Psychology at Brooklyn College. She is a development and cognitivepsychologist with degrees in Psychology from Brown University and Harvard University. She has doneresearch on the development of infant vision in the area of developmental behavioral neuroscience, witha focus on assessment of early visual disorders and studies of the oculomotor system. She served for overa dozen years as Dean for Research and Graduate Studies for Brooklyn College. Her current researchinterests are on how people learn, particularly in higher education; the effectiveness of different types ofSTEM pedagogy; and the psychological issues confronted by under-represented students in academic settings. She is currentlythe PI/PD on several federally-funded programs to help under-represented students pursue research careers in STEM, as wellas programs to provide professional development for graduate students and post-doctoral fellows.

Cultivating Excellence and Empowering Great Minds | 97Sara Xayarath HernandezCornell UniversitySara Xayarath Hernández is the Director of the Diversity Programs in Engineering (DPE) at CornellUniversity office, which operates programs at the precollege, undergraduate, graduate, and faculty levels tofacilitate the outreach, recruitment, retention, and overall success of underrepresented minorities, women,and other underrepresented groups in Engineering. As director of DPE, Hernández provides leadership ondiversity initiatives across the college. She also serves as the Co-PI for Cornell’s Alfred P. Sloan Foundationsupported Sloan Minority PhD Program and for Cornell’s National Science Foundation supported LouisStokes Alliance for Minority Participation (LSAMP) and STEM Talent Expansion (STEP) Programs. Additionally, Hernándezserves as a Regional Specialist for the Institute for Broadening Participation and supports their outreach work with STEMstudents. Hernández is a first generation college student and holds a Bachelor of Arts in Zoology from Ohio WesleyanUniversity and a Master of Regional Planning from Cornell University.Karen Jackson-WeaverPrinceton UniversityDr. Karen Jackson-Weaver is the Associate Dean of Academic Affairs and Diversity at PrincetonUniversity’s Graduate School. Prior to her post at Princeton, she served as the Executive Director of theNew Jersey Amistad Commission. Dr. Jackson-Weaver’s area of specialization is 20th century African-American history, with a focus on women’s leadership roles in Modern America. She has been a ResearchFellow at the Institute for Research in African-American Studies at Columbia University and a facultymember at the Institute of Youth Ministry at Princeton Theological Seminary. Dr. Jackson-Weaver earnedher Bachelor of Arts degree from Princeton University, where she majored in American History. Upon graduation fromPrinceton, Dr. Jackson-Weaver attended Harvard University where she received a Specialized Master’s Degree in Education.She holds a Doctorate of Philosophy in American History from Columbia University, where she was a Kluge Scholar Fellow,Merit Dissertation winner and nominee for the university-wide teaching award.Rebecca KeiserNASAAs NASA’s associate deputy administrator for strategy & policy, Dr. Rebecca Spyke Keiser reports directlyto Deputy Administrator Lori Garver as the primary coordinator for agency-level policy and strategyefforts. She helps implement a wide range of initiatives in support of NASA’s goals, and integrates theefforts of the agency’s various strategic planning offices to ensure consistency with the White Houseand legislative direction, while supervising an analytic staff in the Office of Strategy Formulation. Keiserpreviously had served as the executive officer for the deputy administrator, chief of staff for the ExplorationSystems Mission Directorate at NASA Headquarters and the executive officer for former NASA Deputy Administrator ShanaDale from 2005 to 2008. Keiser has served in NASA’s Office of International and Interagency Relations as the lead for France,Spain, and Portugal, and the human spaceflight lead for Asia. She also was the assistant to the director for InternationalRelations in the Office of Science and Technology Policy. Keiser earned a Bachelor of Arts degree in Japanese Studies fromWellesley College, a Master of Science degree in Politics of the World Economy from the London School of Economics, anda doctorate in International Studies from the University of South Carolina. She has received numerous NASA awards forexceptional service.Laina KingKeystone Symposia on Molecular and Cellular BiologyDr. King is the Director of Diversity in Life Science Programs and Co-Mentor of the Keystone SymposiaFellows Program. Former Academic Dean and Professor of Pharmaceutical sciences at a regional healthsciences center, she joined Keystone Symposia in 2008. A past appointed member of the AMA/AAMCLiaison Committee on Medical Education (LCME), she has held numerous academic appointments alongwith serving as Japan consultant for the U.S. DOD. She currently is a voting member of a U.S. FDA DrugAdvisory Committee and the Principal Investigator of an NIH MARC T-36 grant. Keystone Symposia, foundedas UCLA Symposia in 1972 offers scholarships and mentoring opportunities for scientists attending the 55+ “cutting-edge”research conferences held globally each year. Dr. King received her B.A., M.A. and Ph.D. from The University of Michigan – Ann Arbor.

98 | Who’s Who at the SymposiumArlene KohlerNew York UniversityArlene Kohler has been affiliated with the MD PhD Program at New York University for over 37 years.Currently working with her seventh Director of the Medical Scientist Training Program (MSTP), herlongevity in the position has earned her the honorific title of “Queen” among administrators and Directorsof MST Programs nationwide. While attending evening classes at NYU’s School of Continuing andProfessional Studies, Ms. Kohler worked for the MSTP at NYU. She earned her B.A. in American Studiesand Literature graduating with honors. Her accumulated wisdom and tireless hard work make her the defacto ombudsman for students, faculty and administrators alike.Nikia A. Laurie, Ph.D.Northwestern University Feinberg School of MedicineNikia A. Laurie, Ph.D., is an Assistant Professor in the Department of Pediatrics at NorthwesternUniversity Feinberg School of Medicine. She is also a member of the Cancer Biology and EpigenomicsProgram, and founder of the Retinoblastoma Center of Excellence at Lurie Children’s Hospital of ChicagoResearch Center. Dr. Laurie received her Ph.D. at Brown University, and her postdoctoral training atSt. Jude Children’s Research Hospital. Dr. Laurie’s laboratory studies retinoblastoma, the most commonpediatric cancer of the eye. Her laboratory’s mission is to understand the molecular mechanisms associatedwith retinoblastoma progression for the identification of novel therapeutic targets. Dr. Laurie has published her research innumerous high-impact journals. She is a proud alumnus of the Leadership Alliance, and credits her early research experienceswith reinforcing her passion for research.Caryl McFarlaneWoodrow Wilson National Fellowship FoundationDr. Caryl McFarlane is the Senior Program Officer and Director of the Andrew W. Mellon and theThomas R. Pickering Programs at the Woodrow Wilson National Fellowship Foundation in Princeton,NJ. Before beginning her work at the Foundation, Caryl was involved in numerous activities in the largerPrinceton community including teaching 20th Century African Diaspora literature at Princeton DaySchool, teaching composition and African Diaspora literature at Rutgers University, working as a testwriter for ETS, working as a coordinator with Upward Bound, teaching a variety of courses for womenin her local community, and recruiting, developing and training teams for work with impoverished youth in the Caribbean.She completed her undergraduate degree at Queens College of the City University of New York (CUNY) and was a recipientof numerous awards and honors including her selection as an awardee for the prestigious Mellon Mays UndergraduateFellowship (MMUF) and her selection as the commencement speaker. She completed her doctoral studies in 20th CenturyAfrican Diaspora Literature at Rutgers University (New Brunswick) funded, in part, by a NJ Minority AdvancementAward. During her doctoral studies, while teaching courses, she also pursued her love of music and administration in herlocal church. She continues to be active in her community, serving on various boards, teaching and mentoring women,and continuing to develop teams and curriculum for her work with youth in the Caribbean. She and her spouse, MauriceMcFarlane have two boys aged 11 and 14.Pushpa MurthyNational Science FoundationPushpa Murthy is currently working at the National Science Foundation. She is a Program Director forthe Graduate Research Fellowship Program. Pushpa got her PhD in chemistry from Brown Universityin Providence, Rhode Island. After her PhD, she conducted postdoctoral research in neurochemistryat the University of Michigan in Ann Arbor, Michigan before joining the Research and DevelopmentDepartment of Stauffer Chemical Company in Dobbs Ferry, New York. After 2 years of industrialresearch she realized that her passion was in teaching and fundamental research so she joined MichiganTechnological University as an Assistant Professor. She is a Professor of Chemistry at her home institution, MichiganTechnological University in Houghton, Michigan. She has taught and conducted research with undergraduate and graduatestudents for over 20 years. She has mentored over 50 undergraduate students in her laboratory. She has been at NSF for a year.

Cultivating Excellence and Empowering Great Minds | 99Michelle NearonYale UniversityMichelle Nearon is Assistant Dean in the Graduate School and Director of the Office for Diversity andEqual Opportunity. She develops and implements strategic planning specific to the office, thus ensuringquality graduate student support services such as mentoring, advising, and professional development.She also coordinates campus-wide admissions initiatives and directs a summer undergraduate researchprogram. Dr. Nearon serves on the President’s Minority Advisory Council and the President’s Committeeon Racial and Ethnic Harassment. Dr. Nearon earned her B.S. and M.S. degrees in aerospace engineeringfrom the Massachusetts Institute of Technology and Brooklyn Polytechnic University, respectively, and a PhD in mechanicalengineering from Stony Brook University. Before joining Yale, she was an Assistant Professor in Stony Brook University’sMechanical Engineering Department while simultaneously serving as Director of Recruitment and Diversification for theCollege of Engineering and Applied Sciences.Chinonye NnakweUniversity of ChicagoChinonye “Chi-Chi” Nnakwe is the Director of Graduate Diversity Recruitment at the University ofChicago. In her position, she collaborates with faculty, students and administrators in all divisionsand professional schools to create, enhance, revise and execute a strategy for recruiting students fromunderrepresented backgrounds. In addition to her outreach work, Dr. Nnakwe is also building curriculaand a research agenda that address educational disparities among underrepresented groups in highereducation. Dr. Nnakwe received her B. Sc. in Biochemistry with Distinction in the Curriculum from theUniversity of Illinois at Urbana-Champaign and her Ph. D. in Pathology, with a concentration in Cancer Biology and YeastGenetics from the University of Chicago.Christine O’BrienNational Academy of ScienceChris O’Brien received her BS degree at St. Joseph’s University and a Master of Arts degree in Educationat Villanova University. Chris taught for six years in the parochial school system of the Archdioceseof Philadelphia before working in fellowship program administration at the National Academies inWashington, DC. Chris’ program oversight has included privately and federally funded fellowshipprograms at the predoctoral, dissertation, and postdoctoral levels. Since 1979, her responsibilities havebeen primarily in the administration of Ford Foundation Fellowships designed to increase and fosterdiversity as a teaching tool in higher education. Along with a colleague, Chris created the Fellowship Roundtable in 1995.This biannual meeting brings together fellowship administrators whose goal is to share best practices and discuss innovationsin the administration of fellowships. The Fellowship Roundtable is in its 18th year of serving as a resource to fellowshipadministrators.

100 | Who’s Who at the SymposiumJoel OppenheimNew York University School of MedicineDr. Joel D. Oppenheim is a Professor of Microbiology and presently serves as the Senior Associate Deanfor Biomedical Sciences and Director of the Sackler Institute of Graduate Biomedical Sciences at NYUSchool of Medicine. In these positions he oversees all PhD (>320 students) and Postdoctoral (>800)trainees and graduate research training programs. He has served on the NYU School of Medicine’s MDand MD/PhD. Admissions Committees and chairs the Ph.D. Admissions Committee for the past 20 years.He is the founder and director of the NYU’s Summer Undergraduate Research and Postdoctoral Programs,and the founder of the “What Can You Be With a PhD?” Symposium, the largest university based career development programfor predoctoral students and postdoctoral fellows in the country. He has served on many national advisory committees(AAMC, NIH, NRC, NSF, ASM, Leadership Alliance, and UNCF/Merck), grant study sections (NCATS, NIAID, NIGMS,NSF, Sloan Foundation, UNCF/Merck), as a reviewer of numerous NRC, NSF and NAS reports involved with graduateeducation, pipeline issues and the recruitment and retention of underrepresented students to graduate programs. He also hasserved (serves) on the external advisory boards and program review boards of a number of state and national accreditingagencies, colleges and universities. Dr. Oppenheim has been an invited speaker to over 70 colleges and universities, at theNRC, NSF and NIH as well as at ABRCMS, Leadership Alliance, McNair, SACNAS and UNCF/Merck national meetings,speaking to students and faculty on topics ranging from how to prepare for and apply to graduate and professional schools, tostrategies for the recruitment and retention of students and career options. In 2010, Dr. Oppenheim was the recipient of theAAAS (American Association of the Advancement of Sciences) Life Time Mentoring Award, one of the nation’s highestmentoring awards. Dr. Oppenheim was also one of the founding members of the Leadership Alliance in 1992.Larry Steven Perry, IIUniversity of VirginiaLarry Steven Perry, II, hails from Timonium, Maryland. Larry is a graduate of Fisk University (B.A. ‘07)and Union Theological Seminary in the City of New York (M.Div. ‘10), and is currently a PhD studentat the University of Virginia in the Religious Studies department with a concentration in AmericanReligious History. More specifically, he focuses on the history of American religious thought and leftistAmerican religious movements. His research attempts to properly place the life and works of, mystic andtheologian, Howard Thurman within the streams of American intellectual history. Larry also has takenpart in ministry work, he was a chaplain intern at Sing Sing Correctional FacilIty during his last year at Union Seminary andis currently an associate minister at the Open Church of Maryland in Baltimore.Kisha PiggottWashington UniversityKisha Piggott is a PGY3 Ophthalmology resident at Washington University School of Medicine. Dr. Piggottreceived her B.S degree in Biology from Spelman College and her medical degree and Ph.D. degree inImmunology at Emory University School of Medicine, where she studied the mechanisms regulatingdysfunctional T cell responses in large vessel vasculitis. She remains committed to the promotion ofdiversity in the medical profession, through mentorship to medical students with a focus on professionaldevelopment. As a recipient of the Resident Diversity Initiative Grant, she remains engaged in theprovision of culturally relevant, patient-centered care and is an active member of the Barnes-Jewish Hospital ResidentDiversity and Fellows Initiative.

Cultivating Excellence and Empowering Great Minds | 101Teresa RamírezBrown UniversityTeresa Ramirez is a PhD Candidate in the Molecular Pharmacology, Physiology and BiotechnologyProgram at Brown University, under the mentorship of Dr. Suzanne de la Monte. She is the founder andpast president of the Brown Society for Advancement of Chicanos and Native Americans in ScienceChapter, which is dedicated in fostering the success of students in pursuing advance degrees, careersand leadership positions in the sciences. Ms. Ramirez is first generation Mexican-American to havegraduated from college and to pursue a doctoral degree. She received her B.S. degree in General Biologyfrom California State University, Dominguez Hills, and did a post-baccalaureate program at the NCI in Frederick, MD. Ms.Ramirez’s dissertation focuses on the effects of excessive alcohol consumption and how it plays a role in insulin resistance,lipid accumulation and ER stress in the liver. In 2009, Ms. Ramirez was awarded the Student Role Model Award from theMinority Access, Inc. and a Pre-doctoral Ford Foundation Fellowship.Nicole RestrickSocial Sciences Research CouncilNicole Restrick is manager of the Fellowships Office and assistant director of the Abe FellowshipProgram at the Social Science Research Council. She also leads the AAS-SSRC Dissertation WorkshopSeries and Korean Studies in North America projects and is a senior advisor to the Drugs, Security andDemocracy (DSD) Program. Prior to joining the Council in 2006, Restrick was an international programsofficer at Ritsumeikan University in Kyoto, Japan. She has also worked as an editor and designer of K–12curricula on Japan and East Asia. She received her MA in East Asian studies from Cornell Universityin 2000 and is fluent in Japanese.Nancy SchwartzUniversity of ChicagoDr. Nancy Schwartz is Associate Dean for Postdoctoral Affairs and Co-director of the Office of GraduateAffairs, having served as Dean for Graduate and Postdoctoral Affairs in the Division of Biological Sciencesfor more than 25 years. She has served on several NIH study sections, foundation review boards andeditorial boards, the AAMC-GREAT Steering Committee, Chair of both Graduate Deans and PostdocLeaders groups, and the Founding Advisory Board of the NPA. She is director of the Kennedy ResearchCenter, the NICHD M.D./Ph.D. training Program, HHMI Med into Grad Program, and NIGMS Postbac(PREP). She has had continuous NIH R01 research funding, received both a MERIT award and a Mentor of Excellencefrom NIH, and is Director of an NIH Program Project and a P30 Center. Dr. Schwartz’s functions and responsibilities ingraduate and postdoctoral education and program administration have focused on evolving and complex educational needsof emerging researchers in the life sciences.Pamela Scott-JohnsonMorgan State UniversityPamela E. Scott-Johnson is Chair and Associate Professor in the Department of Psychology at MorganState University. Dr. Scott-Johnson’s research seeks to examine the gender differences in psychosocialfactors that impact health and wellness. She has been an active participant with the AmericanPsychological Association Education and Science Directorates, Project Kaleidoscope/Faculty for the 21stCentury, and the Association of Heads of Departments of Psychology (AHDP). She served on a numberof review panels within the academic and funding agencies. Prior to her academic affiliations, Dr. Scott-Johnson worked in the food industry as a senior research scientist. Dr. Scott-Johnson held memberships in the Society forNeuroscience, Faculty for Undergraduate Neuroscience (FUN; councilor), the American Psychological Association, and theAssociation for Chemoreception Sciences (AChemS). She earned a B.A. degree in Psychology and graduated magna cumlaude from Spelman College in 1982, and an M.A. and Ph.D. in Psychology and Neuroscience from Princeton University.

102 | Who’s Who at the SymposiumJose A. SolisCivil Environmental and Architectural Engineering, University of Colorado at BoulderJose A. Solis is a PhD candidate starting his 5th year in the Hydrology, Water Resources, andEnvironmental Fluid Mechanics discipline of the Civil, Environmental, and Architectural EngineeringDepartment at the University of Colorado at Boulder. He earned both his B.S. and M.S. degrees in CivilEngineering at New Mexico State University, where he focused in the water resources program within thedepartment. He was awarded the Bridge to the Doctorate Fellowship which allowed him to fund his M.S.degree. Throughout his higher education journey he has mentored and helped several undergraduatestudents, through different type of research programs. In his Ph.D. program, he works on a collaborative project with theKansas Geological Survey (KGS), and the University of Iowa. This project has been funded by National Science Foundationwhere he has been working to improve the understanding of water uptake by riparian vegetation.Patrice SpitalnikColumbia UniversityPatrice F. Spitalnik, M.D. is an Associate Professor of Clinical Pathology and Cell Biology at ColumbiaUniversity College of Physicians and Surgeons. She is the Assistant Director of the M.D-Ph.D Programand teaches general pathology and surgical pathology to second and third year medical students, as well asto M.D-Ph.D students. She is the Section Director of the first year medical student histology course. Sherecently created a new course for M.D-Ph.D students on “Responsible Conduct of Research” in addition toa new lecture series, “Grand Rounds for Graduate Students”. She is interested in medical education relatedto the interface between basic research and clinical medicine and the training of physician-scientists. Dr. Spitalnik earnedher medical degree from the University of Chicago, and was awarded research fellowships from NIH and the University ofPennsylvania Medical School. She has also been awarded numerous honors for her career in teaching.Brian SullivanWashington University in St. LouisMr. Sullivan is the Executive Director of the Medical Scientist Training Program at Washington Universityin St. Louis. He was a founding officer of the MD-PhD Section of the AAMC GREAT Group; he alsoserves as the Secretary-Treasurer of the National Association of MD-PhD Programs. In 2002, Mr. Sullivanestablished BioMedRAP, a summer research program for minority and disadvantaged undergraduates. Mr.Sullivan earned a B.A. in Political Science and a M.A. in Spanish Literature from St. Louis University. Healso earned a M.B.A. from Washington University in St. Louis.José-Marc TechnerNorthwestern University Feinberg School of Medicine MSTPJosé-Marc Techner is transitioning into the graduate Chemistry program after completing his preclinicaltraining. He graduated with a B.S. in Biochemistry and Molecular Biophysics and Molecular and CellularBiology from the University of Arizona in 2011. As an undergraduate he participated in the 2008 BrownUniversity SR-EIP in the Koren lab studying Long QT syndrome. At the UA, he worked in the Hortonlab focusing on studying artificial zinc-finger proteins as a trainee in the NIH Minorities Access toResearch Career (MARC) program. He also worked in the Passegue lab studying hematopoiesis as anAMGEN Scholar at the University of California, San Francisco in 2010. His research interests vary but will focus on the fieldof carbohydrate array development for his Ph.D. with Milan Mrksich. He is also active in the local Physicians for a NationalHealth Program chapter.

Cultivating Excellence and Empowering Great Minds | 103Sheila ThomasHarvard UniversitySheila Thomas is a faculty member in the Division of Medical Sciences (DMS) PhD Programs andDepartment of Medicine at Harvard Medical School and Assistant Dean for Diversity and MinorityAffairs for the Graduate School of Arts and Sciences (GSAS). Her research interests are in cancer cellsignaling; and she is actively involved in teaching and advising students in the DMS PhD programs andsits on the admissions committees for the life science PhD programs as well as the MD/PhD program.As Dean, she oversees diversity efforts for Harvard’s 57 PhD programs. She directs the Summer HonorsUndergraduate Research Program (SHURP), Summer Research Opportunities at Harvard (SROH) and the Graduate School’spost-baccalaureate program, GSAS Research Scholar Initiative. Dr. Thomas received her BA in Biochemistry and Molecularand Cellular Biology from Northwestern University, her PhD in Molecular Genetics from University of Pennsylvania, and didher post-doctoral training at Fred Hutchinson Cancer Research Center.Iboro UmanaUniversity of ChicagoIboro Umana is a third-year MD/PhD candidate at the University of Chicago Pritzker School ofMedicine. He graduated magna cum laude from Washington University in St. Louis with a B.A. degree inPhilosophy-Neuroscience-Psychology in 2010. Iboro currently works in the lab of Dr. Daniel McGehee.He is studying the role of supraspinal nicotinic acetylcholine receptors in modulation of pain perception inmice. In his free time, he enjoys playing and watching soccer, and being a Chicago foodie.Eric VillegasUniversity of CincinnatiEric Villegas is a Research Microbiologist with the US Environmental Protection Agency’s Office ofResearch and Development and an Adjunct Associate Professor with the Department of BiologicalSciences at the University of Cincinnati. His research group focuses on developing tools to assess humanhealth risks associated with microbial contamination, like Cryptosporidium, Giardia, and Toxoplasmagondii in our drinking water supplies. Eric received his doctorate in Immunology and Parasitology at theUniversity of Pennsylvania’s Perelman School of Medicine where he studied host immune responses toinfection with Toxoplasma gondii. He continued his research as a post-doctoral fellow with the Immunology and PathogenesisDivision at University of California Berkeley where he worked on identifying novel genes that regulate host immuneresponses to cancer and infectious diseases. Eric was also a 1993 LANS doctoral scholar at Yale University.Aileen WalterNational Action Council for Minorities in EngineeringAileen Walter serves as vice president of University Programs at the NACME. In this capacity, she managesNACME scholarship programs and scholarship management services. Walter successfully directedNACME’s scholarship efforts (1990-1999), managing the growth of the Corporate Scholars Program andlaying the groundwork for our NASA partnership and alumni outreach activities. In 1994, she receivedan “Outstanding Contribution” award for her work. Walter has more than 20 years of experience inscholarship management, having served as director of financial aid at the Stevens Institute of Technologyprior to joining NACME. She is a long-time member of the National Association of Financial Aid Administrators, and hasserved on the boards of the American Indian Science and Engineering Society, the National Society of Black Engineers andthe Society of Hispanic Professional Engineers. Walter holds a B.A. in English Literature from Montclair State College and aM.A. in Higher Education Administration from New York University.

104 | The Leadership Alliance National Symposium 2013The Leadership Alliance Executive Office StaffMedeva GheeExecutive DirectorDr. Medeva Ghee, a graduate of North Carolina State University with a bachelor’s degree in zoology, earned her M.S.and Ph.D. in microbiology from New York University School of Medicine. Her postdoctoral research was conductedin Paris, France with a team of researchers associated with the National Center for Scientific Research (CNRS), whereshe employed biochemical and gene therapy technologies to investigate the impact of protein aggregation inParkinson’s disease. In 2005, Dr. Ghee worked with the William J. Clinton Foundation as a Laboratory SystemsSpecialist for the HIV/AIDS Initiative. In this capacity, she provided technical assistance and strategic advice on thedevelopment of laboratory plans and systems to support national HIV/AIDS prevention care and treatment programs in the Initiative’spartner countries in Sub-Saharan Africa. Dr. Ghee joined the Leadership Alliance in 2006 and was appointed the Executive Director of theLeadership Alliance in July 2011. Dr. Ghee also has a Clinical Assistant Professor appointment in Public Health at Brown University andteaches a course that leverages multidisciplinary approaches to support HIV/AIDS care and treatment programs in Sub-Saharan Africa.Actively engaged in research aimed at mentoring and supporting students through critical transitions along the academic pathway, Dr. Gheehas been invited to serve as an external consultant for federal mentoring programs and has given keynote lectures regarding mentoringstrategies for graduate students, postdoctoral fellows, faculty members and senior administrators. At Brown, she serves as a mentor for bothundergraduates and graduate students. Her mentoring efforts were honored by the Samuel M. Nabrit Black Graduate Student Associationwith the Ruth J. Simmons Award for Leadership.Deborah CollinsAssociate DirectorDr. Deborah Collins received her Ph.D. in educational research and policy analysis from Virginia Tech in 1984.While at Virginia Tech, she was Co-Director of the Vocational Education Evaluation in Virginia program, as well asthe development and funding of two national research projects through the National Center for Research inVocational Education at UC Berkley/Virginia Tech. As Co-Project Director, her research focused on longitudinalassessment of vocational enrollment patterns and their relationship to academic program achievement andpostsecondary enrollments. At the same time, she co-directed a research project exploring the linkages betweeneducational evaluation utilization and planning in vocational education. Dr. Collins taught research methods courses in both education andsociology, collaborating with colleagues in the sociology department to create and administer Virginia Tech’s Center for Survey Research.As Center Co-Director, she worked with researchers and policy analysts across multiple disciplines to pursue and support funded researchand regional public policy initiatives. In 1997, she came to Brown University as the Director of Research and Evaluation, leading two cyclesof research activities for the Regional Educational Laboratory at Brown University (LAB). During her tenure at The Education Alliance, theResearch and Evaluation division annually fielded up to 20 contract and grant initiatives, including multi-year national research awardsthrough NSF, NIH and the U.S. Department of Education.Barbara KahnCoordinator for Graduate and Undergraduate ProgramsBarbara Kahn is the Coordinator for Graduate and Undergraduate Programs for the Leadership Alliance. In thiscapacity, she coordinates the combined application process for the 21 undergraduate summer research sites andsupervises the Alliance summer research program at Brown University. Prior to her appointment with the LeadershipAlliance, Ms. Kahn was part of the professional development team at Brown University’s Annenberg Institute forSchool Reform, a center promoting quality education for disadvantaged children, especially in urban communities.She came to Brown University from Chaffee & Partners, a public relations and advertising firm in Providence, R.I.Ms. Kahn holds a B.S. in Education from Boston University.Maria DoValeExecutive Assistant/Project CoordinatorMaria DoVale is the Executive Assistant/Project Coordinator for the Leadership Alliance. In this capacity, Ms.DoVale is responsible for providing administrative support for the executive office to ensure the successfulimplementation of Alliance programs and activities. She is also the ex officio member of the Symposium PlanningCommittee. Ms. DoVale comes to us with a wealth of experience in administration, event planning and managementaugmented with exemplary technical, organizational and customer service skills. Prior to her appointment with theLeadership Alliance, Ms. DoVale worked for 5½ years at the Providence Warwick Convention & Visitors Bureauhelping to promote the state of Rhode Island as well as the city of Providence as a convention destination. Prior to this appointment, sheworked for American Express corporate travel for eight years. Ms. DoVale holds a B.A. in Travel & Tourism Management from Johnson &Wales University.

Cultivating Excellence and Empowering Great Minds | 105“at Penn our commitment to diversitymakes Penn a better universityand will helP our studentsshape a better world.”— amy Gutmann, PresidentIncreasing AccessEngaging Locallyand GloballyIntegrating Knowledgediversity.upenn.eduThe Graduate School of Arts and Sciences of Columbia University providesa diverse and distinctive learning environment in New York City for the nextgeneration of scholars, who study and conduct research alongside thedistinguished Columbia faculty.• Courses of study in the humanities, social sciences, and naturalsciences, including the biomedical sciences• More than 50 master’s and 60 doctoral programs available• Global network of 300,000 Columbia alumniFor more information, visit gsas.columbia.edu/LANS2013

106 | The Leadership Alliance National Symposium 2013St. Jude Children's Research Hospital is a non-profit biomedical research institution in Memphis,TN, where 190 basic science and clinical researchers investigate the molecular basis of bothnormal cellular and diseased processes.St. Jude Children’s Research Hospital congratulates The Leadership Alliance on twenty-oneyears of success, and Leadership Alliance Alumni for their achievements. St. Jude is proud torecognize those Alumni who have completed, or are currently in Postdoctoral Fellowships at St.Jude:Candace Carroll, Ph.D., (University of Missouri),St. Jude Postdoctoral Research Associate, Department of BiochemistryDenise Davis, Ph.D., (Yale University),St. Jude Postdoctoral Research Associate, Department of Developmental NeurobiologyNikia Laurie, Ph.D., (Brown University),Former St. Jude Postdoctoral Research Associate, currently faculty at Northwestern UniversityRachelle Salomon, Ph.D., (Brown University),Former St. Jude Postdoctoral Research Associate, currently Basic Research and DiagnosticsProgram Officer, National Institute of Allergy and Infectious DiseasesAisha Walker, Ph.D., (Medical College of Georgia),St. Jude Postdoctoral Research Associate, Department of Pharmaceutical SciencesWe hope you will consider St. Jude Children’s Research Hospital for the next step in yourresearch career, where your success is limited only by your imagination, and where your researchcan make a difference in the fight against childhood diseases.Meet postdoctoral recruiters and learn about St. Jude postdoctoral programs at the RecruitingFair, or contact us at postdoc@stjude.org.www.stjude.org/research

Cultivating Excellence and Empowering Great Minds | 107ANNUAL BIOMEDICAL RESEARCH CONFERENCE FOR MINORITY STUDENTSThe Annual Biomedical Research Conference for MinorityStudents (ABRCMS) advances undergraduates andpostbaccalaureates from underrepresented populations inscience, technology, engineering and mathematics (STEM)along the path toward graduate-level training.The conference features scientific sessions, professionaldevelopment workshops, 1,700 poster and oral presentations,and approximately 300 exhibit booths showcasing summerresearch opportunities, graduate schools and postdoctoralfellowships.Call for Abstracts Must be an undergraduate sophomore, junior, or senior;postbaccalaureate; or graduate student as of November 13,2013 Must have conducted research, used experimentalmethods/methodology and developed results in one of the12 ABRCMS scientific disciplinesABRCMS Travel Award Available to undergraduate and postbaccalaureatepresenting students Award provides up to $1,500 to cover registration,housing, and travelVisit http://www.abrcms.org/TravelGrantGuidelines.htmlImportant DeadlinesAbstract Submission: September 6, 2013Travel Award Application: September 6, 2013Judges’ Travel Subsidy Application: September 27, 2013Discount Registration: October 21, 2013Call for Reviewers & JudgesOver 400 abstract reviewers and judges are needed Postdoctoral scientists, faculty, and program directors areeligibleTravel Subsidies and registration discounts availableVisit http://www.abrcms.org/reviewers_judges.asp2012 ABRCMS Scientific DisciplinesABRCMS Attendees by Location1,815 Total Abstracts SubmittedSocial & Behavioral Sciences andPublic Health - 164 (9.1%)Physiology -121 (6.7%)Neuroscience -188 (10.4%)Molecular andComputationalBiology - 113(6.2%)Microbiology -179 (9.9%)Immunology - 81 (4.4%)Biochemistry - 167 (9.2%)Cancer Biology -159 (8.7%)Cell Biology -157 (8.6%)Chemistry -170 (9.4%)Developmental Biology andGenetics - 163 ( 9%)Engineering, Physics and Mathematics - 153 (8.4%)WAORCANVAKMTIDUTAZHIWYCONMNDSDNEKSOKTXGuamIndiaMNWIIAMOARLAPRMIILINOHKYTNGAMSALFLVINYPAMDWVVANCSCVT NHMACTNJDEDCMERIAttendees300 +200 – 299100 – 19950 – 9925 – 491 - 24www.abrcms.org | abrcms@asmusa.org

108 | The Leadership Alliance National Symposium 2013Brown Brown University’s University's Office of Institutional Diversity and and the theGraduate School CONGRATULATES the LeadershipAlliance Alliance Consortium on its its outstanding support and dedicatedcommitment and dedicated to commitment promising to scholars promising across scholars the country.across the country.

Symposium 2013 Planning CommitteeJabbar Bennett(Chair)Earnestine BakerMarcus JonesFlorence KempnerPatricia Lee-RobinsonBarbara NesmithChinonye NnakweRahmelle ThompsonMaria DoValeAssociate Dean, Graduate SchoolAssociate Dean, Division of Biology and MedicineDirector, Office of Diversity and Multicultural AffairsClinical Assistant Professor of Medicine, The Warren Alpert Medical SchoolBrown UniversityInstitutional CoordinatorUniversity of Maryland, Baltimore CountyAssistant ProfessorJ. Craig Venter InstituteDoctoral Scholar AdvisorMARC Program CoordinatorBrooklyn CollegeAssociate Provost and Director of the Office of Student OpportunitiesChaminade University of HonoluluActing Assistant Director GSAS Office of DiversityColumbia UniversityDirector of Graduate Diversity RecruitmentUniversity of ChicagoDoctoral Scholar AdvisorDirector, Dr. John H. Hopps Research Scholar ProgramMorehouse CollegeEx Officio MemberExecutive Assistant/Project CoordinatorLeadership Alliance Executive OfficeLeadership Alliance StaffMedeva GheeDeborah CollinsBarbara KahnMaria DoValeExecutive DirectorAssociate DirectorCoordinator for Graduate and Undergraduate ProgramsExecutive Assistant/Project CoordinatorThe Leadership Alliance National Symposium is made possible through grant T-36 GM-063480 from the National Institutes ofHealth’s Minority Access to Research Career Program of the National Institute for General Medical Sciences.

The Leadership Alliance is a national consortium of leading research and teaching colleges, universities andprivate industry. The mission of the Alliance is to develop underrepresented students into outstanding leaders and rolemodels in academia, business and the public sector.Member InstitutionsBrooklyn CollegeBrown UniversityChaminade University of HonoluluClaflin UniversityColumbia UniversityCornell UniversityDartmouth CollegeDillard UniversityHarvard UniversityHoward UniversityHunter CollegeJohns Hopkins UniversityMontana State University-BozemanMorehouse CollegeMorgan State UniversityNew York UniversityPrinceton UniversitySpelman CollegeStanford UniversityTougaloo CollegeTufts UniversityUniversity of ChicagoUniversity of Colorado BoulderUniversity of Maryland, Baltimore CountyUniversity of MiamiUniversity of PennsylvaniaUniversity of Puerto RicoUniversity of VirginiaVanderbilt UniversityWashington University in St. LouisXavier University of LouisianaYale UniversityAssociate Member InstitutionNovartis Institutes for BioMedical ResearchExecutive Office133 Waterman Street • Box 1963 • Providence, RI 02912401-863-1474 • www.theleadershipalliance.org