Experimental infection and protection against ... - TI Pharma
Experimental infection and protection against ... - TI Pharma
Experimental infection and protection against ... - TI Pharma
You also want an ePaper? Increase the reach of your titles
YUMPU automatically turns print PDFs into web optimized ePapers that Google loves.
Humoral immune responses to a single allele PfAMA1 vaccine in healthy malarianaïve<br />
adults.<br />
*----30---*----40---* ---50 --*----60---*----70---*----80---*----90---*----100--*----110--*----<br />
120--<br />
FVO ∆ Glyc<br />
QNYWEHPYQKSDVYHPINEHREHPKEYEYPLHQEHTYQQEDSGEDENTLQHAYPIDHEGAEPAPQEQNLFSSIEIVERSNYMGNPWTEYMAKYDIEEVHG<br />
3D7 ∆.Glyc ---------N----R----------------------------------------------------------------------------------<br />
---<br />
HB3 ∆ Glyc ---------N----R---------------------------------------------------------------------------------<br />
K---<br />
CAMP ∆ Glyc ---------N—N---------------Q---------------------------------------------------------------------<br />
---<br />
*----130--*----140--*----150--*----160--*----170--*----180--*----190--*----200--*----210--*----<br />
220--<br />
FVO ∆ Glyc<br />
SGIRVDLGEDAEVAGTQYRLPSGKCPVFGKGIIIENSKTTFLKPVATGNQDLKDGGFAFPPTNPLISPMTLNGMRDFYKNNEYVKNLDELTLCSRHAGNM<br />
3D7 ∆ Glyc ------------------------------------------T-------Y-----------E—-M-----DE—-H---D-K---------------<br />
---<br />
HB3 ∆ Glyc ------------------------------------------T----E--------------E--------DQ—-HL—-D-----------------<br />
---<br />
CAMP ∆ Glyc --------------------------------------------------------------E----------------------------------<br />
---<br />
*----230--*----240--*----250--*----260--*----270--*----280--*----290--*----300--*----310--*----<br />
320--<br />
FVO ∆ Glyc<br />
NPDNDKNSNYKYPAVYDYNDKKCHIL<strong>TI</strong>AAQENNGPRYCNKDQSKRNSMFCFRPAKDKLFENYVYLSKNVVDNWEEVCPRKNLENAKFGLWVDGNCEDIP<br />
3D7 ∆ Glyc I----------------DK-----------------------E--------------IS-Q--------------K-------Q-------------<br />
---<br />
HB3 ∆ Glyc ------------------E-----------------------E------------------------------------------------------<br />
---<br />
CAMP ∆ Glyc ---K-E-----------DK-----------------------E---------------S-Q--------------K---------------------<br />
---<br />
*----330--*----340--*----350--*----360--*----370--*----380--*----390--*----400--*----410--*----<br />
420--<br />
FVO ∆ Glyc<br />
HVNEFSANDLFECNKLVFELSASDQPKQYEQHLTDYEKIKEGFKNKNADMIKSAFLPTGAFKADRYKSHGKGYNWGNYNRETQKCEIFNVKPTCLINDKS<br />
3D7 ∆ Glyc -----P-I-----------------------------------------------------------------------T-----------------<br />
---<br />
HB3 ∆ Glyc --------------------------------------------------------------------R----------T-----------------<br />
--<br />
CAMP ∆ Glyc --------------------------------------------------------------------------------K-H--------------<br />
---<br />
*----430--*----440--*----450--*----460--*----470--*----480--*----490--*----500--*----510--*----<br />
520--<br />
FVO ∆ Glyc<br />
YIATTALSHPIEVEHNFPCSLYKDEIKKEIERESKRIKLNDNDDEGNKKIIAPRIFISDDKDSLKCPCDPEMVSQSTCRFFVCKCVERRAEVTSNNEVVV<br />
3D7 ∆ Glyc --------------N-----------M----------------------------------------------------------------------<br />
---<br />
HB3 ∆ Glyc ----------N---N--------------------------------------------------------I------N--------K---------<br />
---<br />
CAMP ∆ GlyC --------------N--------N—-M----------------------------------------------------------------------<br />
----<br />
*----530--*----540--*<br />
FVO ∆ Glyc KEEYKEDYADIPEHKPTYDNM<br />
3D7 ∆ Glyc -------------------K-<br />
HB3 ∆ Glyc ---------------------<br />
CAMP ∆ Glyc ---------------------<br />
Figure 1: Alignment of AMA1 protein sequences amino acids 25 through 545 used for Elisa<br />
measurements. Potential N-glycosylation sited were changed (six for FVO, 3D7 <strong>and</strong> CAMP<br />
<strong>and</strong> five for HB3) to avoid unwanted N-glycosylation: N 162 K (For FVO, 3D7 <strong>and</strong> CAMP.<br />
HB3 AMA1 has K at position 162). T 288 V, S 273 D, N 422 D, S 423 K <strong>and</strong> N 499 Q.<br />
(Alhydrogel, Montanide ISA 720 or AS02) as previously described [19].<br />
Alhydrogel <strong>and</strong> Montanide ISA 720 vaccines were prepared with lot B PfAMA1<br />
<strong>and</strong> AS02 vaccines were prepared with lot C PfAMA1. Formulated vaccines were<br />
kept at 4°C for a maximum of six hours until administration. Vaccine<br />
formulations were tested for stability as previously described [20] <strong>and</strong> all<br />
fulfilled the pre-set specifications. Immunisations were given intramuscularly in<br />
the deltoid region of alternate arms at days 0, 28 <strong>and</strong> 56. Blood was collected in<br />
VacutainerTM CPT tubes (Becton <strong>and</strong> Dickinson), plasma collected after<br />
centrifugation <strong>and</strong> stored at -20°C.<br />
61