Recent Advances in Angiogenesis and ... - Bentham Science
Recent Advances in Angiogenesis and ... - Bentham Science
Recent Advances in Angiogenesis and ... - Bentham Science
Create successful ePaper yourself
Turn your PDF publications into a flip-book with our unique Google optimized e-Paper software.
12 <strong>Recent</strong> <strong>Advances</strong> <strong>in</strong> <strong>Angiogenesis</strong> <strong>and</strong> Antiangiogenesis, 2009 Leali <strong>and</strong> Nald<strong>in</strong>i<br />
OPN acts also as a substrate for matrix<br />
metalloproteases MMP-3 <strong>and</strong> MMP-7, <strong>and</strong> the cleaved<br />
fragments enhanced adhesion <strong>and</strong> migration <strong>in</strong> vitro<br />
through ligation of receptors <strong>in</strong>clud<strong>in</strong>g 1<strong>in</strong>tegr<strong>in</strong> [54].<br />
Indeed, there are two different b<strong>in</strong>d<strong>in</strong>g sites for 41<br />
<strong>in</strong>tegr<strong>in</strong> present <strong>in</strong> a 38-am<strong>in</strong>o acid doma<strong>in</strong> with<strong>in</strong> the<br />
N-term<strong>in</strong>al thromb<strong>in</strong> fragment, correspond<strong>in</strong>g to both<br />
162 SVVYGLR 168 <strong>and</strong> 131 ELVTDFPTDLPAT 143 motifs<br />
[55]. Furthermore, the sequence 43 WLNPDP 48 has<br />
been recently described as a novel functional motif of<br />
OPN, <strong>in</strong>volved <strong>in</strong> migration <strong>and</strong> survival of human<br />
lymphocyte, although the correspond<strong>in</strong>g <strong>in</strong>teract<strong>in</strong>g<br />
receptor has not been identified [56].<br />
A<br />
17<br />
HN 2<br />
N-term<strong>in</strong>us<br />
131 ELVTDFPTDLPAT 143<br />
a1b1 158 168<br />
GRGDSVVYGLR<br />
a1b1,<br />
a1b1 a1<br />
b1,<br />
a1<br />
b1<br />
a b a b<br />
1 1, 1 1<br />
Thromb<strong>in</strong><br />
168 169<br />
R<br />
a1b1<br />
a1b1<br />
a b<br />
1 1<br />
C-term<strong>in</strong>us<br />
CD44v6, CD44v6-v7,<br />
CD44v3, (hepar<strong>in</strong> bridge)<br />
MMP-3,7<br />
1 MRIAVICFCLLGITCAIPVKQADSGSSEEKQLYNKYPDAV<br />
41 ATWLNPDPSQKQNLLAPQNAVSSEETNDFKQETLPSKSNE<br />
Fig. (1). OPN prote<strong>in</strong> structure. (A) Schematic<br />
representation of the human OPN prote<strong>in</strong>. OPN conta<strong>in</strong>s<br />
a thromb<strong>in</strong> cleavage site that separates the Nterm<strong>in</strong>us/<strong>in</strong>tegr<strong>in</strong><br />
b<strong>in</strong>d<strong>in</strong>g <strong>and</strong> the C-term<strong>in</strong>us/CD44v<br />
b<strong>in</strong>d<strong>in</strong>g doma<strong>in</strong>s (am<strong>in</strong>o acid residues 17-168 <strong>and</strong> 169-<br />
314, respectively). Conserved regions <strong>in</strong>volved <strong>in</strong><br />
receptor <strong>in</strong>teractions are <strong>in</strong>dicated. (B) Am<strong>in</strong>o acid<br />
sequence (s<strong>in</strong>gle letter code) of the human OPN prote<strong>in</strong><br />
(GenBank accession number: J04765). The N-term<strong>in</strong>us<br />
<strong>and</strong> C-term<strong>in</strong>us doma<strong>in</strong>s are underl<strong>in</strong>ed <strong>and</strong> shown as<br />
dotted l<strong>in</strong>e, respectively. The signal sequence (am<strong>in</strong>o acid<br />
residues 1-16) is <strong>in</strong> Italics. Arrow <strong>in</strong>dicates the thromb<strong>in</strong><br />
cleavage site.<br />
In keep<strong>in</strong>g with its ability to associate with different<br />
ECM prote<strong>in</strong>s, such as collagen <strong>and</strong> fibronect<strong>in</strong><br />
[57,58], a novel functional doma<strong>in</strong>, spann<strong>in</strong>g both the<br />
SK<br />
314<br />
COOH<br />
81 SHDHMDDMDDEDDDDHVDSQDSIDSNDSDDVDDTDDSHQS<br />
121 DESHHSDESDELVTDFPTDLPATEVFTPVVPTVDTYDGRG<br />
161 DSVVYGLRSKSKKFRRPDIQYPDATDEDITSHMESEELNG<br />
201 AYKAIPVAQDLNAPSDWDSRGKDSYETSQLDDQSAETHSH<br />
241 KQSRLYKRKANDESNEHSDVIDSQELSKVSREFHSHEFHS<br />
281 HEDMLVVDPKSKEEDKHLKFRISHELDSASSEVN<br />
B<br />
NH2-term<strong>in</strong>al <strong>and</strong> the C-term<strong>in</strong>al regions of the<br />
prote<strong>in</strong>, has been recently identified as “collagen<br />
b<strong>in</strong>d<strong>in</strong>g motif”, correspond<strong>in</strong>g to the<br />
166 GLRSKSKKFRRPDIQYPDATDEDITSHM 193<br />
sequence <strong>in</strong> human OPN [59].<br />
The C-term<strong>in</strong>al fragment of OPN conta<strong>in</strong>s a conserved<br />
calcium b<strong>in</strong>d<strong>in</strong>g site <strong>and</strong> <strong>in</strong>teracts directly with<br />
CD44v6- <strong>and</strong> v7-conta<strong>in</strong><strong>in</strong>g isoforms [44,60],<br />
although CD44v3 might <strong>in</strong>directly b<strong>in</strong>d OPN through<br />
a hepar<strong>in</strong> bridge [52]. This RGD-<strong>in</strong>dependent<br />
<strong>in</strong>teraction appears to require the presence of 1<br />
<strong>in</strong>tegr<strong>in</strong>s [61]. It has been recently proposed a model<br />
for human OPN structure <strong>in</strong> which a sequence <strong>in</strong> the<br />
C-term<strong>in</strong>al region forms a -sheet structure with the<br />
RGDSVVYGLR doma<strong>in</strong> <strong>in</strong> the N-term<strong>in</strong>us, thus<br />
<strong>in</strong>terfer<strong>in</strong>g with RGD-<strong>in</strong>tegr<strong>in</strong> <strong>in</strong>teraction [46]. This<br />
model might expla<strong>in</strong> the ability of monoclonal<br />
antibody aga<strong>in</strong>st the C-term<strong>in</strong>us doma<strong>in</strong> to <strong>in</strong>hibit cell<br />
adhesion to OPN, thus suggest<strong>in</strong>g the possibility that<br />
CD44/OPN <strong>in</strong>teraction modulates the cells’ capacity to<br />
recognize the RGD sequence [62].<br />
Although expressed as a ~ 33 kDa nascent prote<strong>in</strong>,<br />
extensive posttranslational modifications (PTMs) such<br />
as Ser/Thr phosphorylation, O-l<strong>in</strong>ked/N-l<strong>in</strong>ked<br />
glycosylation, sialylation, Tyr sulfation <strong>and</strong> enzymatic<br />
cleavage, <strong>in</strong>crease its apparent molecular weight, thus<br />
determ<strong>in</strong><strong>in</strong>g a prote<strong>in</strong> migration <strong>in</strong> SDS-PAGE gels <strong>in</strong><br />
the range of 44-80 kDa depend<strong>in</strong>g on conditions<br />
[24,63]. Polymeric form of OPN has been recently<br />
reported which produces a b<strong>and</strong> around 200 kDa that<br />
is mediated by transglutam<strong>in</strong>ase [64,65]. Many sites of<br />
PTMs are conserved across species; however, the<br />
degree of modification of the prote<strong>in</strong> varies depend<strong>in</strong>g<br />
on the source tissue <strong>and</strong> cell type or differentiation<br />
stage [66-68] <strong>and</strong> <strong>in</strong>fluence OPN function [46].<br />
Phosphorylation of OPN appears necessary for various<br />
physiological functions, <strong>in</strong>clud<strong>in</strong>g migration of cancer<br />
cells [69], adhesion <strong>and</strong> bone resorption by osteoclasts<br />
[70], <strong>in</strong>hibition of smooth muscle cell calcification<br />
[71] <strong>and</strong> regulation of m<strong>in</strong>eralization [72]. The<br />
phosphorylation of OPN is usually heterogeneous, <strong>and</strong><br />
it is not known whether certa<strong>in</strong> specific sites are<br />
critical for a given function; furthermore, it is possible<br />
that differences <strong>in</strong> OPN post-translational modification<br />
status, together with variations <strong>in</strong> the target cell<br />
receptor repertoire, modulate OPN’s functions or the<br />
cellular response to OPN [46].<br />
4. OPN SIGNALING<br />
The role of both secreted <strong>and</strong> <strong>in</strong>tracellular OPN <strong>in</strong> cell<br />
signal<strong>in</strong>g has been recently reviewed <strong>in</strong> the context of<br />
cancer progression <strong>and</strong> immune response [40,73].<br />
Many of the signal<strong>in</strong>g pathways mediated by secreted<br />
OPN are activated by ligation of the <strong>in</strong>tegr<strong>in</strong> <strong>and</strong><br />
CD44 families of receptors. OPN signal<strong>in</strong>g through